RPSBLAST alignment of GI: 254780911 and protein with PDBid: 1z7e

>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Length = 660
 Score = 84.3 bits (208), Expect = 3e-17
 Identities = 25/161 (15%), Positives = 54/161 (33%), Gaps = 15/161 (9%)

Query: 112 NIVGVVSN---------HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVEL 162
            I  + ++         + +  +L     +P Y           +    +  I + + ++
Sbjct: 25  EISAIFTHTDNPGEKAFYGSVARLAAERGIPVY------APDNVNHPLWVERIAQLSPDV 78

Query: 163 MILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICE 222
           +    Y  ++ D +         N+H S LP ++G  P       G    G T H  +  
Sbjct: 79  IFSFYYRHLIYDEILQLAPAGAFNLHGSLLPKYRGRAPLNWVLVNGETETGVTLHRMVKR 138

Query: 223 LDAGPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNA 263
            DAG I+ Q  + +              +   ++L + + A
Sbjct: 139 ADAGAIVAQLRIAIAPDDIAITLHHKLCHAARQLLEQTLPA 179