RPSBLAST alignment of GI: 254780911 and protein with PDBid: 3n0v

>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Length = 286
 Score =  224 bits (573), Expect = 2e-59
 Identities = 117/278 (42%), Positives = 168/278 (60%), Gaps = 2/278 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--F 60
           ++ILT  CPS      ++  YL  Q C + +   F+D  + + F+R+ F          F
Sbjct: 8   TWILTADCPSMLGTVDVVTRYLFEQRCYVTEHHSFDDRQSGRFFIRVEFRQPDDFDEAGF 67

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A      + F + + +       K +I+VS+ DHCLNDLLYR  IG L +++V VVSNH
Sbjct: 68  RAGLAERSEAFGMAFELTAPNHRPKVVIMVSKADHCLNDLLYRQRIGQLGMDVVAVVSNH 127

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              + L   +++P+Y+  +  ++K   E+K++ +IE+   EL+ILARYMQ+LS  LC ++
Sbjct: 128 PDLEPLAHWHKIPYYHFALDPKDKPGQERKVLQVIEETGAELVILARYMQVLSPELCRRL 187

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            G  INIHHS LP FKGA PY QAY  GVK++GATAHY   +LD GPII Q V  V H+ 
Sbjct: 188 DGWAINIHHSLLPGFKGAKPYHQAYNKGVKMVGATAHYINNDLDEGPIIAQGVEVVDHSH 247

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIV 278
             ED IA G++IE   L +AV  HI++RVF+N  +T+V
Sbjct: 248 YPEDLIAKGRDIECLTLARAVGYHIERRVFLNANRTVV 285