RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780912|ref|YP_003065325.1| hypothetical protein CLIBASIA_04055 [Candidatus Liberibacter asiaticus str. psy62] (68 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 25.7 bits (56), Expect = 2.4 Identities = 12/64 (18%), Positives = 18/64 (28%), Gaps = 33/64 (51%) Query: 5 PLSL--------LSLPS------------FMKSL------------LRS-LELCSQIMQC 31 PL+L L +P+ F K L + EL + + Sbjct: 8 PLTLSHGSLEHVLLVPTASFFIASQLQEQFNKILPEPTEGFAADDEPTTPAELVGKFLGY 67 Query: 32 VSKE 35 VS Sbjct: 68 VSSL 71 >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Score = 23.9 bits (51), Expect = 8.7 Identities = 7/25 (28%), Positives = 11/25 (44%) Query: 5 PLSLLSLPSFMKSLLRSLELCSQIM 29 +L P M SL + + S I+ Sbjct: 704 CANLRMFPLLMHSLTKHMAFRSGIV 728 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.317 0.131 0.357 Gapped Lambda K H 0.267 0.0582 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 476,423 Number of extensions: 14642 Number of successful extensions: 55 Number of sequences better than 10.0: 1 Number of HSP's gapped: 55 Number of HSP's successfully gapped: 3 Length of query: 68 Length of database: 5,693,230 Length adjustment: 38 Effective length of query: 30 Effective length of database: 4,771,958 Effective search space: 143158740 Effective search space used: 143158740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.4 bits)