BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780912|ref|YP_003065325.1| hypothetical protein CLIBASIA_04055 [Candidatus Liberibacter asiaticus str. psy62] (68 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780912|ref|YP_003065325.1| hypothetical protein CLIBASIA_04055 [Candidatus Liberibacter asiaticus str. psy62] Length = 68 Score = 134 bits (336), Expect = 3e-34, Method: Compositional matrix adjust. Identities = 68/68 (100%), Positives = 68/68 (100%) Query: 1 MINNPLSLLSLPSFMKSLLRSLELCSQIMQCVSKEKNTINKASVRAGARNAISNPGKYVI 60 MINNPLSLLSLPSFMKSLLRSLELCSQIMQCVSKEKNTINKASVRAGARNAISNPGKYVI Sbjct: 1 MINNPLSLLSLPSFMKSLLRSLELCSQIMQCVSKEKNTINKASVRAGARNAISNPGKYVI 60 Query: 61 SGLLEGLL 68 SGLLEGLL Sbjct: 61 SGLLEGLL 68 >gi|255764481|ref|YP_003065182.2| UDP-N-acetylglucosamine acyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 271 Score = 23.1 bits (48), Expect = 0.99, Method: Composition-based stats. Identities = 8/25 (32%), Positives = 15/25 (60%) Query: 30 QCVSKEKNTINKASVRAGARNAISN 54 +CV +E TIN+ +V G + + + Sbjct: 91 KCVIREGVTINRGTVEYGGKTIVGD 115 >gi|254780464|ref|YP_003064877.1| M16 family peptidase [Candidatus Liberibacter asiaticus str. psy62] Length = 424 Score = 22.7 bits (47), Expect = 1.2, Method: Composition-based stats. Identities = 9/18 (50%), Positives = 13/18 (72%) Query: 16 KSLLRSLELCSQIMQCVS 33 +S LR+LE+ Q+M C S Sbjct: 348 RSYLRALEISKQVMFCGS 365 >gi|254780264|ref|YP_003064677.1| elongation factor G [Candidatus Liberibacter asiaticus str. psy62] Length = 701 Score = 21.9 bits (45), Expect = 2.0, Method: Composition-based stats. Identities = 11/38 (28%), Positives = 19/38 (50%) Query: 3 NNPLSLLSLPSFMKSLLRSLELCSQIMQCVSKEKNTIN 40 ++PLS+L+ S + SL C +SK + +N Sbjct: 311 SSPLSMLAFKVMADSFVGSLTFCRIYSGKISKGDSLLN 348 >537021.9.peg.477_1 Length = 235 Score = 20.8 bits (42), Expect = 4.0, Method: Compositional matrix adjust. Identities = 7/21 (33%), Positives = 12/21 (57%) Query: 48 ARNAISNPGKYVISGLLEGLL 68 ARN + P K+ I ++ G + Sbjct: 93 ARNDVKTPAKFYILSIVMGFV 113 >gi|254780742|ref|YP_003065155.1| hypothetical protein CLIBASIA_03145 [Candidatus Liberibacter asiaticus str. psy62] Length = 419 Score = 20.8 bits (42), Expect = 4.3, Method: Composition-based stats. Identities = 7/18 (38%), Positives = 14/18 (77%) Query: 20 RSLELCSQIMQCVSKEKN 37 R+L+ CS+I+ + K+K+ Sbjct: 36 RTLQKCSKIIDSIYKKKS 53 >gi|254780806|ref|YP_003065219.1| chromosome partitioning protein A [Candidatus Liberibacter asiaticus str. psy62] Length = 265 Score = 20.4 bits (41), Expect = 5.7, Method: Compositional matrix adjust. Identities = 8/22 (36%), Positives = 15/22 (68%) Query: 21 SLELCSQIMQCVSKEKNTINKA 42 +LE SQ+++ V + + T+N A Sbjct: 159 ALEGLSQLLETVEEVRRTVNSA 180 >gi|254780316|ref|YP_003064729.1| phenylalanyl-tRNA synthetase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 805 Score = 20.0 bits (40), Expect = 7.6, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Query: 2 INNPLSLLSLPSFMKSLLRSLELCSQI-MQCVSKEKNTI 39 I+ PLS S+P +K L LC M CV +N + Sbjct: 191 ISCPLSSESIPLEIKFDLDDSSLCKGFAMCCVKGVRNNV 229 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.317 0.131 0.357 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,586 Number of Sequences: 1233 Number of extensions: 920 Number of successful extensions: 9 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of query: 68 length of database: 328,796 effective HSP length: 39 effective length of query: 29 effective length of database: 280,709 effective search space: 8140561 effective search space used: 8140561 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.2 bits) S2: 31 (16.5 bits)