HHsearch alignment for GI: 254780915 and conserved domain: KOG3690

>KOG3690 consensus.
Probab=99.74  E-value=4.3e-11  Score=97.14  Aligned_cols=514  Identities=12%  Similarity=0.058  Sum_probs=270.6

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCC
Q ss_conf             99899999999999999999999999986420579918999999999999999999887416988719989999998469
Q gi|254780915|r   82 KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQD  161 (626)
Q Consensus        82 ~~~~~l~~~l~~~e~i~~~l~rv~~ya~l~~s~dt~d~~~~~~~~~~~~~~s~~~~~l~~~~~e~~~l~e~~l~~~~~~~  161 (626)
T Consensus        29 ~~e~~~~~fL~~~~~q~~~v~~q~~la~~~y~~~~~~~~~~a-~~ea~~~~~~~~r~~a~q--------~k~~~~~~l~D   99 (646)
T KOG3690          29 TDEEEAKRFLERYNAQARVVYRQEALAGWNYNTNGTEENLLA-LLEAEDKLVEFVRSLATQ--------AKKFDVAELQD   99 (646)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHH-HHHHHHHHHHHHHHHHHH--------HHHCCHHHCCC
T ss_conf             779999999998789999999999999888753798499999-998889999999999877--------75424864048


Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCCCCHH-HHHHHHHCCCHHHHHH
Q ss_conf             001111799999997423317167998766300100036777777644443322100347523-3213541888767999
Q gi|254780915|r  162 PLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLT-KAYKSFFDSDREVRKS  240 (626)
Q Consensus       162 ~~l~~y~~~~~~l~~~~~~~l~~~~E~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~l~~~dr~~Rk~  240 (626)
T Consensus       100 ~---~~rRql~~~s~lg~saL~~~d~~~~~~ll---~~m~~~y~~~~vC~y~~p~~~~L~l~P~l~~i~~~Srd~~eL~~  173 (646)
T KOG3690         100 E---RLRRQLQKVSQLGMSALSPDDLKRYNQLL---SSMSTNYNTATVCAYDQPSACCLLLEPQLQSIMANSRDYDELQW  173 (646)
T ss_pred             H---HHHHHHHHHHHHCCCCCCHHHHHHHHHHH---HHHHHHCCCCEEECCCCCCCCCEECCCCHHHHHHCCCCHHHHHH
T ss_conf             8---89999998866332028978999999999---99985247762128889997540027317888734688899999


Q ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHCCHHHHHH---HHHHHH
Q ss_conf             99999998650542169999998666788654278999889762222589899999999876306289999---999999
Q gi|254780915|r  241 AAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHR---YYELKK  317 (626)
Q Consensus       241 a~~a~~~~~~~~~~~~a~il~~iv~~r~e~A~llGy~s~~~~~l~~~~~~~~~~~~l~~~~~~~~~~~~~~---~~~~~~  317 (626)
T Consensus       174 ~W~~wr~~~g~~---~r~~y~~yv~L~~e~A~lNg~~~~gdyW~~~yE~~~-~~~~~ld~i~~ei~PlY~~LHAYvRr~L  249 (646)
T KOG3690         174 YWVEWRRKIGKA---MRQSYEEYVDLSNEAAQLNGYVNGGDYWRLAYETPG-DFEQDLDAIFEEIRPLYRQLHAYVRRKL  249 (646)
T ss_pred             HHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCH-HHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999986124---467799999999999986498878888999851725-6999999999998899999999999999


Q ss_pred             -HHCCCCCC----------------CHH----HHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH----HHH-
Q ss_conf             -87088753----------------123----4440256554777998999999998666632899999998----642-
Q gi|254780915|r  318 -KWLKLDTM----------------YFW----DRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEK----FFT-  371 (626)
Q Consensus       318 -~~lg~~~l----------------~~w----D~~~~~~~~~~~~~~~ee~~~~v~~~~~~~~~e~~~~~~~----~~~-  371 (626)
T Consensus       250 ~~~Ygp~~i~~~gpiPahLlgnm~gq~Ws~~y~~~~P~pe~~~~dvt~~m~~qg~~--~qkmF~~a~efF~SlGl~~lp~  327 (646)
T KOG3690         250 RGAYGPDGISRDGPIPAHLLGNMWGQDWSNHYDLTTPFPERPLIDVTMEMVKQGYT--VQKMFKLAAEFFTSLGLPALPP  327 (646)
T ss_pred             HHHCCCCCCCCCCCCCHHHHHHHHCCCHHHHHHCCCCCCCCCCCCHHHHHHHCCCC--HHHHHHHHHHHHHHCCCCCCCH
T ss_conf             87528333798898488887656402327553002689887877657999982433--9999999999999769876896


Q ss_pred             CCC-CCHHCCCCCCCCCCC----CCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCC-CCHHHHHHH
Q ss_conf             485-020103799874354----76667775101036533246799999984589999961256877657-800599988
Q gi|254780915|r  372 HNW-IDAPQYDGKGSGAFA----HGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTN-NSSLTLAET  445 (626)
Q Consensus       372 ~~~-iD~~~r~gKr~GA~~----~~~~~~~~~~I~~N~~~~~~dv~TL~HE~GHa~H~~ls~~~~~~~~~-~~~~~~aE~  445 (626)
T Consensus       328 sfw~~s~~~~p~d~~~v~C~~sAwdf~~~~Dfrik~Ct~vd~~~f~~~Hhem~h-iQY~l~y~~qP~llre~anPgFheA  406 (646)
T KOG3690         328 SFWTNSILTRPDDRDMVVCHASAWDFYAGPDFRIKYCTKVDEEDFEQAHHEMGH-IQYYLQYKQQPFLLREGANPGFHEA  406 (646)
T ss_pred             HHHHHHHHCCCCCCCCEEECHHHHCCCCCCCCEEEECCCCCHHHHHHHHHHHHH-HHHHHHHHHCCHHHHCCCCCCHHHH
T ss_conf             887677725788887524356663044688731544475787899999999999-9999998745487627999728899


Q ss_pred             HHHHHHHHHH--HH-----HHCCCCCHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             6888999999--99-----841389989999999998620699999-999999999999721201689998999999999
Q gi|254780915|r  446 ASIFGETLTF--DS-----LLQAASSKEERKILLANKIEDMLNSIV-RQISFYDFELKLHTERRSTGDIPTHRINEIWLE  517 (626)
Q Consensus       446 ~S~~~E~~~~--~~-----~~~~~~~~~~~~~ll~~~~~~~~~~~~-~q~~~~~fe~~~h~~~~~~~~~t~~~l~~~~~~  517 (626)
T Consensus       407 Igd~~als~stPrhL~slgLL~~~~~~d--~~~~IN~L~k~aL~~v~~LPf~y~~DkwR~~V--f~G~i~k~~~N~~~W~  482 (646)
T KOG3690         407 IGDAFALSVSTPRHLHSLGLLSEDLDED--DEVRINRLFKMALDKVAFLPFTYALDKWRYEV--FDGEIPKDQYNCAYWE  482 (646)
T ss_pred             HHHHHHHHCCCHHHHHHHCCCCCCCCCC--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HCCCCCCCHHHHHHHH
T ss_conf             9999998528878888704534233641--17899999999988986402666543468887--6387882024689987


Q ss_pred             HHHHHCCCCCCCCCCCCCCEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHC-------------------CCHHHHH
Q ss_conf             999860776345887888500152541066752589999999999999999956-------------------7332899
Q gi|254780915|r  518 TQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSN-------------------TVDCFKE  578 (626)
Q Consensus       518 ~~~~~~g~~~~~~~~~~~~~w~~~~H~y~~~fY~y~Y~~~~~~a~~l~~~~~~~-------------------~~~~~~~  578 (626)
T Consensus       483 lr~ky~Gv~~P~~r~~~dfD~~akf~~-~~d~~~~ryf~s~vlqFQf~kalC~~agq~~pg~pr~pLh~CDi~~sk~aG~  561 (646)
T KOG3690         483 LRNKYEGVRPPVPRTNKDFDPPAKFHI-QVDVSYTRYFLSTVLQFQFLKALCQAAGQYGPGDPRKPLHNCDIYDSKEAGE  561 (646)
T ss_pred             HHHHHCCCCCCCCCCCCCCCCHHHHCC-CCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHCCCCCCHHHHH
T ss_conf             788736767997675334781354236-7551899999999999999999999846647899987750304647777889


Q ss_pred             HHHHHHHCCCCCCHHHHHHHC-CCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             999998326999979999970-88989988999999999999999
Q gi|254780915|r  579 KYLNILRAGNSKHYSELLLPL-NINLSDPNFWERGLQTVEKMIDD  622 (626)
Q Consensus       579 ~y~~~L~~Ggs~~~~el~k~~-G~d~~~~~~~~~~~~~~~~~i~~  622 (626)
T Consensus       562 kL~~~M~lG~S~~W~evLE~~tGe~els~~~LLeYFePL~~WLk~  606 (646)
T KOG3690         562 KLRTMMSLGSSRHWREVLEEITGEGELSGRALLEYFEPLFTWLKQ  606 (646)
T ss_pred             HHHHHHHCCCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             999999735876389999997189767848899999999999986