HHsearch alignment for GI: 254780915 and conserved domain: cd04280

>cd04280 ZnMc_astacin_like Zinc-dependent metalloprotease, astacin_like subfamily or peptidase family M12A, a group of zinc-dependent proteolytic enzymes with a HExxH zinc-binding site/active site. Members of this family may have an amino terminal propeptide, which is cleaved to yield the active protease domain, which is consequently always found at the N-terminus in multi-domain architectures. This family includes: astacin, a digestive enzyme from Crayfish; meprin, a multiple domain membrane component that is constructed from a homologous alpha and beta chain, proteins involved in (bone) morphogenesis, tolloid from drosophila, and the sea urchin SPAN protein, which may also play a role in development.
Probab=91.84  E-value=0.18  Score=28.43  Aligned_cols=73  Identities=18%  Similarity=0.240  Sum_probs=34.2

Q ss_pred             HHHHHHHHHHHHHHH-HHHHHHHHHHCCCCCHHCCCCCCCCCCCCCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             999999866663289-9999998642485020103799874354766677751010365332467999999845899999
Q gi|254780915|r  347 ARDLVLQSYAKFSPQ-MSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFV  425 (626)
Q Consensus       347 ~~~~v~~~~~~~~~e-~~~~~~~~~~~~~iD~~~r~gKr~GA~~~~~~~~~~~~I~~N~~~~~~dv~TL~HE~GHa~H~~  425 (626)
T Consensus        16 ~~~~I~~Am~~~~~~TCirF~pr~~~~~yi~f~~----~~g--C~S~vG~~~g~q~isl~~~C~~~g~i~HEl~HalG-f   88 (180)
T cd04280          16 DRSLILRAMREIESNTCIRFVPRTTEKDYIRIVK----GSG--CWSYVGRVGGRQVVSLGSGCFSLGTIVHELMHALG-F   88 (180)
T ss_pred             HHHHHHHHHHHHHHCCCEEEEECCCCCCEEEEEC----CCC--EEECCCCCCCEEEEEECCCCCCCCHHHHHHHHHHC-C
T ss_conf             9999999999998679653588899875899965----997--13615701882368847886867633999998745-6


Q ss_pred             H
Q ss_conf             6
Q gi|254780915|r  426 L  426 (626)
Q Consensus       426 l  426 (626)
T Consensus        89 ~   89 (180)
T cd04280          89 Y   89 (180)
T ss_pred             C
T ss_conf             5