HHsearch alignment for GI: 254780915 and conserved domain: cd06456

>cd06456 M3A_DCP_Oligopeptidase_A Peptidase family M3 dipeptidyl carboxypeptidase (DCP; Dcp II; peptidyl dipeptidase; EC 3.4.15.5). This metal-binding M3A family also includes oligopeptidase A (OpdA; EC 3.4.24.70) enzyme. DCP cleaves dipeptides off the C-termini of various peptides and proteins, the smallest substrate being N-blocked tripeptides and unblocked tetrapeptides. DCP from E. coli is inhibited by the anti-hypertensive drug captopril, an inhibitor of the mammalian angiotensin converting enzyme (ACE, also called peptidyl dipeptidase A). Oligopeptidase A (OpdA) may play a specific role in the degradation of signal peptides after they are released from precursor forms of secreted proteins. It can also cleave N-acetyl-L-Ala.
Probab=100.00  E-value=0  Score=486.58  Aligned_cols=350  Identities=17%  Similarity=0.189  Sum_probs=286.4

Q ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCC-CHHHHHHHHHHHHHCCHHHHHHHHHH----HHHHCCCCCCCHHH
Q ss_conf             16999999866678865427899988976222258-98999999998763062899999999----99870887531234
Q gi|254780915|r  255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNV-EPYVIEALMQSVKNYYPKTSHRYYEL----KKKWLKLDTMYFWD  329 (626)
Q Consensus       255 ~~a~il~~iv~~r~e~A~llGy~s~~~~~l~~~~~-~~~~~~~l~~~~~~~~~~~~~~~~~~----~~~~lg~~~l~~wD  329 (626)
T Consensus         1 dN~~~l~~il~lR~e~A~LLGy~syA~~~l~~kMA~spe~V~~FL~~L~~~~~~~a~~El~~L~~~~~~~~~~~~l~pWD   80 (422)
T cd06456           1 DNRPLIEEILALRAEKAKLLGFENYAEYSLADKMAKSPEAVLEFLEDLAPKAKPQAKKELAELQAFAKEEGGEDELEPWD   80 (422)
T ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHH
T ss_conf             91899999999999999985999799999998765899999999999999989999999999999997607988878768


Q ss_pred             HHHCC-----------CCCCCCCCCHHHHHHHHHHHHHH-HHHHHHHHH------------------HHHHHCCCCCHHC
Q ss_conf             44025-----------65547779989999999986666-328999999------------------9864248502010
Q gi|254780915|r  330 RLAPL-----------PGTSQDIIPFEVARDLVLQSYAK-FSPQMSIIA------------------EKFFTHNWIDAPQ  379 (626)
Q Consensus       330 ~~~~~-----------~~~~~~~~~~ee~~~~v~~~~~~-~~~e~~~~~------------------~~~~~~~~iD~~~  379 (626)
T Consensus        81 ~~Yy~~~~r~~~~~~d~~~l~~YFpl~~vl~Glf~l~~~LfGi~f~~~~~~~~Wh~dV~~~~V~d~~~~~lG~~YlDl~~  160 (422)
T cd06456          81 WAYYSEKLRKEKYDLDEEELRPYFPLEKVLDGLFELAERLYGITFKERTDLPVWHPDVRVYEVFDKDGSHIGLFYLDLYA  160 (422)
T ss_pred             HHHHHHHHHHHHCCCCHHHHHCCCCHHHHHHHHHHHHHHHHCEEEEECCCCCCCCCCCEEEEEECCCCCEEEEEEECCCC
T ss_conf             99999998775424786776145538999999999999985746787788887888626999982899778999730457


Q ss_pred             CCCCCCCCCCCCCCCC--------CCCEEECCCCC---------CHHHHHHHHHHHHHHHHHHHHC-CCCCCCCCCCHHH
Q ss_conf             3799874354766677--------75101036533---------2467999999845899999612-5687765780059
Q gi|254780915|r  380 YDGKGSGAFAHGTIPS--------VHPYILLNYLG---------KPQDVMTLAHELGHGIHFVLSS-ETQGILTNNSSLT  441 (626)
Q Consensus       380 r~gKr~GA~~~~~~~~--------~~~~I~~N~~~---------~~~dv~TL~HE~GHa~H~~ls~-~~~~~~~~~~~~~  441 (626)
T Consensus       161 R~~K~~gAw~~~~~~~~~~~~~q~Pv~~lvcNf~~p~~~~psLL~~~ev~TlFHEfGH~lH~lLs~~~y~~~sGt~v~~D  240 (422)
T cd06456         161 REGKRGGAWMNNLRSQSKNGLGQKPVAYLVCNFTKPAGGKPALLTHDEVTTLFHEFGHALHHLLTDVEYPSLGGTNVEWD  240 (422)
T ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHH
T ss_conf             77766885033024556688976886999716789999988652699999999987488888750687453068667501


Q ss_pred             HHHHHHHHHHHHHH----------HHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHH
Q ss_conf             99886888999999----------99841389989999999998620699999999999999999721201689998999
Q gi|254780915|r  442 LAETASIFGETLTF----------DSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRI  511 (626)
Q Consensus       442 ~aE~~S~~~E~~~~----------~~~~~~~~~~~~~~~ll~~~~~~~~~~~~~q~~~~~fe~~~h~~~~~~~~~t~~~l  511 (626)
T Consensus       241 fvE~PSql~E~w~~~~~vL~~~a~Hy~Tgeplp~~li~~l~~~~~~~~g~~~~~ql~~al~Dl~lH~~~~~~---~~~~~  317 (422)
T cd06456         241 FVELPSQFMENWAWEPEVLKLFAKHYETGEPLPDELIDKLLAARNFNSGFATVRQLEFALLDLALHSLTDPE---ILDVV  317 (422)
T ss_pred             HHHCCHHHHHHHCCCHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC---CCCHH
T ss_conf             774678999851376999973244466898186999999999987607999999999999999985689865---45369


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCEEECCCCCCCCCC--CHHHHHHHHHHHHHHHHHHHHCC--CHHHHHHHHH-HHHC
Q ss_conf             99999999986077634588788850015254106675--25899999999999999999567--3328999999-9832
Q gi|254780915|r  512 NEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSF--YVYAYAFGNCLVNSLYDIYKSNT--VDCFKEKYLN-ILRA  586 (626)
Q Consensus       512 ~~~~~~~~~~~~g~~~~~~~~~~~~~w~~~~H~y~~~f--Y~y~Y~~~~~~a~~l~~~~~~~~--~~~~~~~y~~-~L~~  586 (626)
T Consensus       318 ~~~~~~l~~~~~~----~~~~~~~~~~~~F~Hif~~gY~A~YYsYlWsevlAaD~~~~F~~~g~~~~e~G~~~r~~iL~~  393 (422)
T cd06456         318 QFELDALRKEGLV----IPPPPPRYFSNYFSHIFSGGYAAGYYSYKWAEVLDADAFSAFEEEGIFNRETGRRFRDTILSK  393 (422)
T ss_pred             HHHHHHHHHHCCC----CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHC
T ss_conf             9999999985788----999999877876552015873344799999999999999999766999899999999998517


Q ss_pred             CCCCCHHHHHHHC-CCCCCCHHHHHH
Q ss_conf             6999979999970-889899889999
Q gi|254780915|r  587 GNSKHYSELLLPL-NINLSDPNFWER  611 (626)
Q Consensus       587 Ggs~~~~el~k~~-G~d~~~~~~~~~  611 (626)
T Consensus       394 GGs~~~~e~~~~FlGR~P~~~alL~~  419 (422)
T cd06456         394 GGSRDPMELFRAFRGRDPSIEALLRR  419 (422)
T ss_pred             CCCCCHHHHHHHHCCCCCCHHHHHHH
T ss_conf             89949999999856999984789986