HHsearch alignment for GI: 254780915 and conserved domain: cd06460

>cd06460 M32_Taq Peptidase family M32 is a subclass of metallocarboxypeptidases which are distributed mainly in bacteria and archaea, and contain a HEXXH motif that coordinates a divalent cation such as Zn2+ or Co2+, so far only observed in the active site of neutral metallopeptidases but not in carboxypeptidases. M32 includes the thermostable carboxypeptidases (E.C. 3.4.17.19) from Thermus aquaticus (TaqCP) and Pyrococcus furiosus (PfuCP), which have broad specificities toward a wide range of C-terminal substrates that include basic, aromatic, neutral and polar amino acids. These enzymes have a similar fold to the M3 peptidases such as neurolysin and the M2 angiotensin converting enzyme (ACE). Novel peptidases from protozoa Trypanosoma cruzi, a causative agent of Chagas' disease, and Leishmania major, a parasite that causes leishmaniasis, are the first eukaryotic M32 enzymes identified so far, thus making these enzymes an attractive potential target for drug development against these o
Probab=99.75  E-value=2.1e-14  Score=120.69  Aligned_cols=334  Identities=19%  Similarity=0.206  Sum_probs=217.0

Q ss_pred             HHHHHHHHHHHHHHHCC-CCHHHHHHHHHHHHHHHHHHCCCC-CHHHHHHH--HCCCCHHHHHHHHHHHHHCCHHHHHHH
Q ss_conf             79999999999865054-216999999866678865427899-98897622--225898999999998763062899999
Q gi|254780915|r  237 VRKSAAKALSHTFNKSS-HIFSFITNTLAKDEEIQDRWRKYE-KIADSRHL--SNNVEPYVIEALMQSVKNYYPKTSHRY  312 (626)
Q Consensus       237 ~Rk~a~~a~~~~~~~~~-~~~a~il~~iv~~r~e~A~llGy~-s~~~~~l~--~~~~~~~~~~~l~~~~~~~~~~~~~~~  312 (626)
T Consensus         9 a~s~a~~~W~~AR~~nDf~~f~P~L~~vv~L~re~A~~~~~~~~pYDaLLd~YEpg~t~~~ld~iF~~Lk~~l~~li~~I   88 (396)
T cd06460           9 ATSEAEQAWREARKKNDFALFAPYLEKIVELSREIAEYLGYEKHPYDALLDLYEPGMTTAKLDAIFAELKAGLVPLLKKV   88 (396)
T ss_pred             HHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99699999999988688999899999999999999998289998689999861899989999999999999999999999


Q ss_pred             HHHHHHHCCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHCCCCCCCCCCCCCC
Q ss_conf             99999870887531234440256554777998999999998666632899999998642485020103799874354766
Q gi|254780915|r  313 YELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT  392 (626)
Q Consensus       313 ~~~~~~~lg~~~l~~wD~~~~~~~~~~~~~~~ee~~~~v~~~~~~~~~e~~~~~~~~~~~~~iD~~~r~gKr~GA~~~~~  392 (626)
T Consensus        89 ~~~~~---~-----------~~~~~~~~~~~~~~Q~~l--------~~~i~~~~GfDf~~GRlD~S------~HPF~~~~  140 (396)
T cd06460          89 LEKQK---P-----------PDDSLLSGPFPEEKQEAL--------GRELLEALGFDFDRGRLDVS------AHPFTGGL  140 (396)
T ss_pred             HHCCC---C-----------CCCCCCCCCCCHHHHHHH--------HHHHHHHCCCCCCCCEEECC------CCCCCCCC
T ss_conf             95689---9-----------986545799999999999--------99999990958665445245------68866789


Q ss_pred             CCCCCCEEECCCCC--CHHHHHHHHHHHHHHHHHHHHC---CCCCCCCCCCHHHHHHHHHHHHHHHHH------HHHH--
Q ss_conf             67775101036533--2467999999845899999612---568776578005999886888999999------9984--
Q gi|254780915|r  393 IPSVHPYILLNYLG--KPQDVMTLAHELGHGIHFVLSS---ETQGILTNNSSLTLAETASIFGETLTF------DSLL--  459 (626)
Q Consensus       393 ~~~~~~~I~~N~~~--~~~dv~TL~HE~GHa~H~~ls~---~~~~~~~~~~~~~~aE~~S~~~E~~~~------~~~~--  459 (626)
T Consensus       141 ~~-~DvRiTTry~e~d~~~~l~~~iHE~GHalYEqgl~~~~~~~-P~g~~~smgiHESQSr~~En~igrS~~F~~~~~p~  218 (396)
T cd06460         141 GP-GDVRITTRYDENDFRSALFSTIHETGHALYEQGLPPELRGT-PLGGGASMGIHESQSRLWENQVGRSRAFWEFLYPK  218 (396)
T ss_pred             CC-CCCEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCCHHHCCC-CCCCCCEEEECCHHHHHHHHHHHCCHHHHHHHHHH
T ss_conf             86-64012300042247999999998751678861989778568-56677214452289999999997389999999999


Q ss_pred             ---------CCCCCHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             ---------13899899999999986------206999999999999999997212016899989999999999998607
Q gi|254780915|r  460 ---------QAASSKEERKILLANKI------EDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLG  524 (626)
Q Consensus       460 ---------~~~~~~~~~~~ll~~~~------~~~~~~~~~q~~~~~fe~~~h~~~~~~~~~t~~~l~~~~~~~~~~~~g  524 (626)
T Consensus       219 l~~~f~~~~~~~s~e~~y~~~n~V~pslIRveADEvTY~lHImlRyeiEk~li-----~g~l~v~DLP~~Wn~~~~~yLG  293 (396)
T cd06460         219 LKKTFPEQLKDVSLENFYRAVNRVQPSLIRVEADEVTYNLHIMLRYELEKALI-----EGDLEVADLPEAWNEKMKEYLG  293 (396)
T ss_pred             HHHHHCCCCCCCCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHH-----CCCCCHHHHHHHHHHHHHHHCC
T ss_conf             99984702457899999999975377511120054304789999999999998-----5998731449999999999759


Q ss_pred             CCCCCCCCCCCCEEECCCCCCCCCCCHH-HHHHHHHHHHHHHHHHHHCCC-----------HHHHHHHH--HHHHCCCCC
Q ss_conf             7634588788850015254106675258-999999999999999995673-----------32899999--998326999
Q gi|254780915|r  525 PAFDLSDLEYGSFWMMVPHFIESSFYVY-AYAFGNCLVNSLYDIYKSNTV-----------DCFKEKYL--NILRAGNSK  590 (626)
Q Consensus       525 ~~~~~~~~~~~~~w~~~~H~y~~~fY~y-~Y~~~~~~a~~l~~~~~~~~~-----------~~~~~~y~--~~L~~Ggs~  590 (626)
T Consensus       294 i~p~--~d~~G~--LQDiHWs~G~fGYFPtY~LG~~~AaQl~~~~~~~~~~~~~~i~~G~f~~l~~-WL~e~Ih~~G~~~  368 (396)
T cd06460         294 IRPP--NDAEGC--LQDIHWSGGSFGYFPTYTLGNLYAAQLFAAAKKDLPDIDEQIERGDFSPLLE-WLRENIHQHGSRY  368 (396)
T ss_pred             CCCC--CCCCCC--CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHHCCCHHHHHH-HHHHHHHHCCCCC
T ss_conf             8899--965564--6576100674353525688899999999999885567878987589499999-9999998602479


Q ss_pred             CHHHHHHHC-CCCCCCHHHHHH
Q ss_conf             979999970-889899889999
Q gi|254780915|r  591 HYSELLLPL-NINLSDPNFWER  611 (626)
Q Consensus       591 ~~~el~k~~-G~d~~~~~~~~~  611 (626)
T Consensus       369 ~~~eLl~~~TGe~l~-~~~~~~  389 (396)
T cd06460         369 SPDELLKKATGEPLN-PEYFLE  389 (396)
T ss_pred             CHHHHHHHHHCCCCC-HHHHHH
T ss_conf             989999998689998-799999