HHsearch alignment for GI: 254780915 and conserved domain: smart00235

>smart00235 ZnMc Zinc-dependent metalloprotease. Neutral zinc metallopeptidases. This alignment represents a subset of known subfamilies. Highest similarity occurs in the HExxH zinc-binding site/ active site.
Probab=91.71  E-value=0.074  Score=31.22  Aligned_cols=81  Identities=23%  Similarity=0.286  Sum_probs=38.4

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHH--HHCCCCCHHCCCCCCCCCC-CCCCCC-CCCCEEECCCCCCHHHHHHHH
Q ss_conf             779989999999986666328999999986--4248502010379987435-476667-775101036533246799999
Q gi|254780915|r  340 DIIPFEVARDLVLQSYAKFSPQMSIIAEKF--FTHNWIDAPQYDGKGSGAF-AHGTIP-SVHPYILLNYLGKPQDVMTLA  415 (626)
Q Consensus       340 ~~~~~ee~~~~v~~~~~~~~~e~~~~~~~~--~~~~~iD~~~r~gKr~GA~-~~~~~~-~~~~~I~~N~~~~~~dv~TL~  415 (626)
T Consensus        17 ~~~~~~~~r~~i~~A~~~w~~~Tci~F~~~~~~~~~~i~f~~~~~--~gc~~s~~~~~~g~q~~~~~~---~c~~~g~i~   91 (140)
T smart00235       17 SSLSPEEVREAIARAFAEWSDVTCLRFVERTSTADIYISFGKGDG--SGCTLSHAGRPGGDQHFSLGN---GCINTGVAA   91 (140)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCEEEEEEECCC--CCCCEEEEECCCCCEEEECCC---CCCCCCHHH
T ss_conf             999979999999999999985478638965678871899986888--997457630448823345388---816666245


Q ss_pred             HHHHHHHHHHH
Q ss_conf             98458999996
Q gi|254780915|r  416 HELGHGIHFVL  426 (626)
Q Consensus       416 HE~GHa~H~~l  426 (626)
T Consensus        92 HEigHaL-Gl~  101 (140)
T smart00235       92 HELGHAL-GLY  101 (140)
T ss_pred             HHHHHHC-CCC
T ss_conf             5345342-665