HHsearch results for GI: 254780915 and protein with PDBid: 3g5c_A

>3g5c_A ADAM 22; alpha/beta fold, cross-linked domain, alternative splicing, cell adhesion, cleavage on PAIR of basic residues, EGF-like domain; HET: NAG; 2.36A {Homo sapiens}
Probab=91.64  E-value=0.13  Score=27.91  Aligned_cols=38  Identities=21%  Similarity=0.201  Sum_probs=24.0

Q ss_pred             CCCCCCCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHH
Q ss_conf             74354766677751010365332467999999845899
Q gi|254780915|r  385 SGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI  422 (626)
Q Consensus       385 ~GA~~~~~~~~~~~~I~~N~~~~~~dv~TL~HE~GHa~  422 (626)
                      |=||.-++........+..+.+..-.+.|++||+||.+
T Consensus       109 G~A~~g~~C~~~~~~~i~~~~~~~~~~~~~AHElgH~l  146 (510)
T 3g5c_A          109 GAAYIGGICSLLKGGGVNEFGKTDLMAVTLAQSLAHNI  146 (510)
T ss_dssp             EEECTTCTTCTTTSEEEEECCCHHHHHHHHHHHHHHHH
T ss_pred             EEEECCCCCCCCCCEEEEECCCCCEEEEEEEEECCEEE
T ss_conf             51103665667788799974886256788764033351