HHsearch results for GI: 254780915 and protein with PDBid: 3lq0_A

>3lq0_A Proastacin; metallopeptidase, zymogen activation, proenzyme, protease, Z disulfide bond, hydrolase, metal-binding, metalloprotease,; 1.45A {Astacus astacus} PDB: 1iab_A 1iaa_A 1ast_A 1iac_A 1iad_A 1iae_A 1qji_A* 1qjj_A
Probab=91.86  E-value=0.069  Score=29.91  Aligned_cols=39  Identities=18%  Similarity=0.044  Sum_probs=20.3

Q ss_pred             CCCCCCCCCCC--CCEEECCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             43547666777--510103653324679999998458999996
Q gi|254780915|r  386 GAFAHGTIPSV--HPYILLNYLGKPQDVMTLAHELGHGIHFVL  426 (626)
Q Consensus       386 GA~~~~~~~~~--~~~I~~N~~~~~~dv~TL~HE~GHa~H~~l  426 (626)
                      |..|++.+...  ...|.+.-. .-..+.|..||+|||+ |+.
T Consensus        95 ~~GC~S~VG~~gg~Q~vsl~~~-gC~~~g~i~HEl~HaL-Gf~  135 (235)
T 3lq0_A           95 GSGCWSYVGRISGAQQVSLQAN-GCVYHGTILHALMHAI-GFY  135 (235)
T ss_dssp             SSSEEEESSCCSSEEEEEECTT-TTCSHHHHHHHHHHHH-HBC
T ss_pred             CCCCCEECCCCCCCEEEEECCC-CCCCCCHHHHHHHHHH-CCC
T ss_conf             9975762550188145882799-8677557999999985-685