HHSEARCH alignment of GI: 254780915 and SCOP domain: d1nd1a_

Alignment
>d1nd1a_ d.92.1.9 (A:) Snake venom metalloprotease {Terciopelo (Bothrops asper), bap1 [TaxId: 8722]}
Probab=90.82  E-value=0.078  Score=27.81  Aligned_cols=41  Identities=24%  Similarity=0.299  Sum_probs=23.8

Q ss_pred             CCCCCCCCCCCCCCCCCEEECCC--CCCHHHHHHHHHHHHHHH
Q ss_conf             99874354766677751010365--332467999999845899
Q gi|254780915|r  382 GKGSGAFAHGTIPSVHPYILLNY--LGKPQDVMTLAHELGHGI  422 (626)
Q Consensus       382 gKr~GA~~~~~~~~~~~~I~~N~--~~~~~dv~TL~HE~GHa~  422 (626)
                      +..|-||..+++.......+...  ......+.|++||+||.+
T Consensus       106 ~~~G~A~~g~iC~~~~s~~v~~~~~~~~~~~a~~~AHElGH~l  148 (202)
T d1nd1a_         106 NTIGRAYTGGMCDPRHSVGVVRDHSKNNLWVAVTMAHELGHNL  148 (202)
T ss_dssp             GCCEEECTTCTTCTTTSEEEEECCCSSHHHHHHHHHHHHHHHT
T ss_pred             CEEEEEECCCCCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHC
T ss_conf             8046320167667763441551268860489999999988645


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Zincin-like
superfamily: Metalloproteases ("zincins"), catalytic domain
family: Reprolysin-like
domain: Snake venom metalloprotease
species: Terciopelo (Bothrops asper), bap1 [TaxId: 8722]