HHSEARCH alignment of GI: 254780915 and SCOP domain: d1uzea_

Alignment
>d1uzea_ d.92.1.5 (A:) Angiotensin converting enzyme, ACE {Human (Homo sapiens) [TaxId: 9606]}
Probab=100.00  E-value=0  Score=463.99  Aligned_cols=511  Identities=13%  Similarity=0.055  Sum_probs=377.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCH
Q ss_conf             99999999999999999999999986420579918999999999999999999887416988719989999998469001
Q gi|254780915|r   85 HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLT  164 (626)
Q Consensus        85 ~~l~~~l~~~e~i~~~l~rv~~ya~l~~s~dt~d~~~~~~~~~~~~~~s~~~~~l~~~~~e~~~l~e~~l~~~~~~~~~l  164 (626)
                      .+....|+.+|+..+.+.+.++||++.+++|++|+..+. ..+...   +++....++..+...++...        ...
T Consensus         3 ~~a~~~l~~~e~~~~~~~~~~~~A~~~~std~tde~~~~-~~~~~~---~~~~~~~~~~~~~~~~~~~~--------~~~   70 (579)
T d1uzea_           3 AEASKFVEEYDRTSQVVWNEYAEANWNYNTNITTETSKI-LLQKNM---QIANHTLKYGTQARKFDVNQ--------LQN   70 (579)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSCCHHHHHH-HHHHHH---HHHHHHHHHHHHHTTSCGGG--------CCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHH-HHHHHH---HHHHHHHHHHHHHHHHHHHC--------CCC
T ss_conf             999999999999999997999897489770799799999-999999---99999999999998616404--------898


Q ss_pred             HHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCCCCHH--HHHHHHHCCCHHHHHHHH
Q ss_conf             111799999997423317167998766300100036777777644443322100347523--321354188876799999
Q gi|254780915|r  165 LKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLT--KAYKSFFDSDREVRKSAA  242 (626)
Q Consensus       165 ~~y~~~~~~l~~~~~~~l~~~~E~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~l~~~dr~~Rk~a~  242 (626)
                      ..+++.+.++.+..+|.|+++.+..++.......   ..+..   +.. ....+....+.  ....+..++|+..|+.+|
T Consensus        71 ~~~~r~l~~~~~~~~~~L~~~~~~~l~~l~~~~~---~~~~~---~~v-~~~~~~~~~L~~~~~~~~~~s~d~~e~~~~~  143 (579)
T d1uzea_          71 TTIKRIIKKVQDLERAALPAQELEEYNKILLDME---TTYSV---ATV-CHPNGSCLQLEPDLTNVMATSRKYEDLLWAW  143 (579)
T ss_dssp             HHHHHHHHHHTCCGGGGSCHHHHHHHHHHHHHHH---HHHHH---CEE-ECSSSCEEETTTHHHHHHHHCCCHHHHHHHH
T ss_pred             HHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHH---HHHHH---CEE-ECCCCCCCCCCCCHHHHHHCCCCHHHHHHHH
T ss_conf             9999999999852324699999999999999999---98850---132-2689874137620466653276699999999


Q ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCC--HHHHHHHHHHHHHCCHHHHHHHHHHHH-H-
Q ss_conf             999998650542169999998666788654278999889762222589--899999999876306289999999999-8-
Q gi|254780915|r  243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVE--PYVIEALMQSVKNYYPKTSHRYYELKK-K-  318 (626)
Q Consensus       243 ~a~~~~~~~~~~~~a~il~~iv~~r~e~A~llGy~s~~~~~l~~~~~~--~~~~~~l~~~~~~~~~~~~~~~~~~~~-~-  318 (626)
                      .++.+...   ..+..++..++++|++.|+++||+|++++.+...+..  ...++.++..+..... ..+++.+.+. + 
T Consensus       144 ~~~~~~~~---~~~~~~~~~lv~lrn~~A~~~g~~~~~~~~~~~~~~~~~~~~~d~l~~~v~~~~~-~l~~~~~~~l~~~  219 (579)
T d1uzea_         144 EGWRDKAG---RAILQFYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLERLFQELQPLYL-NLHAYVRRALHRH  219 (579)
T ss_dssp             HHHHHHTH---HHHTTTHHHHHHHHHHHHHHTTCSSHHHHHHGGGCCTTHHHHHHHHHHHTHHHHH-HHHHHHHHHHHHH
T ss_pred             HHHHHHHH---HHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHH
T ss_conf             99998733---4444479999999999999846245999987640242499999999999999999-9999999999986


Q ss_pred             ---------------HCCCCCCCHHHHHH----CCCCCCCCCCCHH------HHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             ---------------70887531234440----2565547779989------9999999866663289999999864248
Q gi|254780915|r  319 ---------------WLKLDTMYFWDRLA----PLPGTSQDIIPFE------VARDLVLQSYAKFSPQMSIIAEKFFTHN  373 (626)
Q Consensus       319 ---------------~lg~~~l~~wD~~~----~~~~~~~~~~~~e------e~~~~v~~~~~~~~~e~~~~~~~~~~~~  373 (626)
                                     ++|.....+||..+    |.+......++.+      .+++++..+...|+..+.......+.++
T Consensus       220 ~g~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~p~~~~~~~d~~~~~~~~~~~~~~~~~~a~~~f~~~~~~~~~~~f~~~  299 (579)
T d1uzea_         220 YGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPSAPSMDTTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWNK  299 (579)
T ss_dssp             HCTTTCCTTSCEETTSSSSTTSSCCGGGHHHHCSCTTSCCCCHHHHHHHTTCCHHHHHHHHHHHHHHTTCCCCCHHHHHH
T ss_pred             CCHHHCCCCCCCCHHHHCCHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             04110445330116552105430155305534778777766525887760456999999999987876677768989863


Q ss_pred             CCCHHCCCCCCCCCCCCC--CCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             502010379987435476--667775101036533246799999984589999961256877657800599988688899
Q gi|254780915|r  374 WIDAPQYDGKGSGAFAHG--TIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE  451 (626)
Q Consensus       374 ~iD~~~r~gKr~GA~~~~--~~~~~~~~I~~N~~~~~~dv~TL~HE~GHa~H~~ls~~~~~~~~~~~~~~~aE~~S~~~E  451 (626)
                      |+|.++++||++|++|.+  ++..++|+|+||++++++||.|||||+|||+|+++++ +||+...+++++.+|.||+.++
T Consensus       300 ~~d~~~~~gk~~g~~~~~~~~~~~~~p~i~~n~~~~~~dv~Tl~HElGHa~H~~~~~-~qp~~~~~~~~~~~e~a~~~~~  378 (579)
T d1uzea_         300 SMLEKPTDGREVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYK-DLPVALREGANPGFHEAIGDVL  378 (579)
T ss_dssp             CBCSCCCSSCCCCCSCEEEECSSSSCEEEECCCCSSHHHHHHHHHHHHHHHHHHHTT-TSCGGGCSCSSHHHHHHHHHHH
T ss_pred             HHHHCCCCCCCCCCCCCEECCCCCCCHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHC-CCCCHHCCCCCCCHHHHHHHHH
T ss_conf             044043136876787752026788510320777763048999999999999999971-5874003789830577888899


Q ss_pred             HH-----HHH---H-HHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             99-----999---9-84138998999999999862069999999999999999972120168999899999999999986
Q gi|254780915|r  452 TL-----TFD---S-LLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKES  522 (626)
Q Consensus       452 ~~-----~~~---~-~~~~~~~~~~~~~ll~~~~~~~~~~~~~q~~~~~fe~~~h~~~~~~~~~t~~~l~~~~~~~~~~~  522 (626)
                      .+     ++-   + +.++..+++.....+..++.....++.+|++++.|++.+|+     ++++++++++.|.++.+++
T Consensus       379 ~l~~~~~~~l~~~~~~~~~~~~~e~~~~~l~~~~~~~~~~l~~~~~~~~fe~~v~~-----~~~~~e~~~~~~~~l~~~~  453 (579)
T d1uzea_         379 ALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFD-----GSITKENYNQEWWSLRLKY  453 (579)
T ss_dssp             HHHHTSHHHHHHTTSCCC----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHT-----TSSCTTTHHHHHHHHHHHH
T ss_pred             HHHHCCHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-----CCCCHHHHHHHHHHHHHHH
T ss_conf             99861889997516301245787999999999999998761999999999999857-----9999899999999998875


Q ss_pred             CCCCCCCCCCCCCCEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCC-------------CHHHHHHHHHHHHCCCC
Q ss_conf             07763458878885001525410667525899999999999999999567-------------33289999999832699
Q gi|254780915|r  523 LGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT-------------VDCFKEKYLNILRAGNS  589 (626)
Q Consensus       523 ~g~~~~~~~~~~~~~w~~~~H~y~~~fY~y~Y~~~~~~a~~l~~~~~~~~-------------~~~~~~~y~~~L~~Ggs  589 (626)
                      +|...+++.....+.|.+|+||| +|||||+|+||+|+++++|..++++|             .+.++++|+++|+.|||
T Consensus       454 ~~~~~~~~~~~~~~~~~~~~H~~-~~~yyy~Y~~a~vla~~~~~~~~~~~~~~~~~~~~~~~~~~~ag~~~~~~L~~G~S  532 (579)
T d1uzea_         454 QGLCPPVPRTQGDFDPGAKFHIP-SSVPYIRYFVSFIIQFQFHEALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFS  532 (579)
T ss_dssp             HCEECSSCCCTTCCGGGGSTTTT-TTCCCHHHHHHHHHHHHHHHHHHHHTTCCSCGGGCCCTTCHHHHHHHHHHHTTTTS
T ss_pred             CCCCCCCCCCHHHCCCCCCCEEC-CCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCC
T ss_conf             58899999865536656341007-89847999999999999999999851766775202234889999999999818699


Q ss_pred             CCHHHHHHHC-CCCCCCHHHHHHHHHHHHHHHHHHHC
Q ss_conf             9979999970-88989988999999999999999860
Q gi|254780915|r  590 KHYSELLLPL-NINLSDPNFWERGLQTVEKMIDDVEK  625 (626)
Q Consensus       590 ~~~~el~k~~-G~d~~~~~~~~~~~~~~~~~i~~~e~  625 (626)
                      ++|.|++|.| |++..+|+++.+-++.+..||++-.+
T Consensus       533 ~~~~e~lk~~~G~~~~s~~~ll~yf~pL~~~l~~~~~  569 (579)
T d1uzea_         533 RPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENE  569 (579)
T ss_dssp             SCHHHHHHHHHSSCSCCSHHHHHHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999996399899859999999999999999998


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Zincin-like
superfamily: Metalloproteases ("zincins"), catalytic domain
family: Neurolysin-like
domain: Angiotensin converting enzyme, ACE
species: Human (Homo sapiens) [TaxId: 9606]