BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780915|ref|YP_003065328.1| oligoendopeptidase F
[Candidatus Liberibacter asiaticus str. psy62]
         (626 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780915|ref|YP_003065328.1| oligoendopeptidase F [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040592|gb|ACT57388.1| oligoendopeptidase F [Candidatus Liberibacter asiaticus str. psy62]
          Length = 626

 Score = 1305 bits (3376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 626/626 (100%), Positives = 626/626 (100%)

Query: 1   MTKYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECI 60
           MTKYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECI
Sbjct: 1   MTKYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECI 60

Query: 61  EHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPT 120
           EHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPT
Sbjct: 61  EHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPT 120

Query: 121 IRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKH 180
           IRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKH
Sbjct: 121 IRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKH 180

Query: 181 LLSNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKS 240
           LLSNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKS
Sbjct: 181 LLSNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKS 240

Query: 241 AAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQS 300
           AAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQS
Sbjct: 241 AAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQS 300

Query: 301 VKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSP 360
           VKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSP
Sbjct: 301 VKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSP 360

Query: 361 QMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGH 420
           QMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGH
Sbjct: 361 QMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGH 420

Query: 421 GIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDML 480
           GIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDML
Sbjct: 421 GIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDML 480

Query: 481 NSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMM 540
           NSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMM
Sbjct: 481 NSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMM 540

Query: 541 VPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLN 600
           VPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLN
Sbjct: 541 VPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLN 600

Query: 601 INLSDPNFWERGLQTVEKMIDDVEKM 626
           INLSDPNFWERGLQTVEKMIDDVEKM
Sbjct: 601 INLSDPNFWERGLQTVEKMIDDVEKM 626


>gi|315122737|ref|YP_004063226.1| oligoendopeptidase F [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313496139|gb|ADR52738.1| oligoendopeptidase F [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 621

 Score =  890 bits (2301), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/624 (68%), Positives = 512/624 (82%), Gaps = 8/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K P  +F    FF   ++       DS E LG+LPRWNL+DLYPSHDS+EI  DME ++H
Sbjct: 6   KSPTDDFAPKIFFSPDIKK------DSTEYLGDLPRWNLKDLYPSHDSKEILTDMERLDH 59

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           ESLAF+TRW+GNL +ATNQ     LGAAI+EYE++ +L GRI SYA L Y+ +LS  TI 
Sbjct: 60  ESLAFRTRWKGNLENATNQTGSTGLGAAISEYEKLSDLAGRIYSYAYLLYSTHLSDQTIC 119

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           KF+TD NAK+ D E+ LIFF LEIN LD  LLE+SY QD L LKYS WIKNIRK KKHLL
Sbjct: 120 KFHTDTNAKITDLEQRLIFFTLEINDLDNTLLEKSYNQDLLALKYSPWIKNIRKYKKHLL 179

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
           S+++ECL SDT+Q G EALK FF E +E+LRFK+NDQK+PL KA     + DR++R+S+ 
Sbjct: 180 SDELECLFSDTAQTGSEALKHFFSETLETLRFKVNDQKLPLEKASTLLLNPDRKIRESSG 239

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           KA+S TF K+SHIFSFITNTLAKD EIQD+WRKYE ++DSRHLSN++EPYVIE+L+QSVK
Sbjct: 240 KAISKTFEKNSHIFSFITNTLAKDREIQDKWRKYENVSDSRHLSNDIEPYVIESLVQSVK 299

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           NYYPK SHRYY LKK+WLKLD MYFWDR APL  +S+ IIPFE ARD+ L SYAKFSPQM
Sbjct: 300 NYYPKISHRYYSLKKQWLKLDKMYFWDRSAPLLDSSEVIIPFEKARDITLASYAKFSPQM 359

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           S IAEKFF++NWIDAPQ +GKG GAF+HGT+PS HPYI LNY GK +DV TLAHELGHGI
Sbjct: 360 SEIAEKFFSNNWIDAPQCEGKGIGAFSHGTVPSSHPYISLNYSGKSRDVTTLAHELGHGI 419

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VLS++ QG L  N+ L LAETASIFGE LTFDSL+ + S++ +RKILL +KIED L+S
Sbjct: 420 HQVLSAQ-QGALMANAPLILAETASIFGEALTFDSLIDSISNEHDRKILLTHKIEDSLSS 478

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           I+RQI+FYDFEL++HTERR TG IP  RINEIWLETQKESLGPAF+L +  Y +FWMM+P
Sbjct: 479 IIRQIAFYDFELRIHTERR-TGSIPIQRINEIWLETQKESLGPAFELDNSGYDNFWMMIP 537

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI SSFYVY+Y+FGNCLVNSLY+IYKSNTVD F++KYLNILRAGNSK++SELL PLNI+
Sbjct: 538 HFIHSSFYVYSYSFGNCLVNSLYEIYKSNTVDQFQKKYLNILRAGNSKNHSELLQPLNID 597

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
           LSDPNFW RGLQ VE+MIDD+E+M
Sbjct: 598 LSDPNFWNRGLQAVERMIDDLEQM 621


>gi|227823369|ref|YP_002827341.1| oligoendopeptidase F [Sinorhizobium fredii NGR234]
 gi|227342370|gb|ACP26588.1| oligoendopeptidase F [Sinorhizobium fredii NGR234]
          Length = 622

 Score =  631 bits (1628), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 300/614 (48%), Positives = 414/614 (67%), Gaps = 4/614 (0%)

Query: 13  AFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWE 72
           AF    +R+  +    +  +LG+LP W LEDLY S  S E   D+   E ++LAF+ RW+
Sbjct: 10  AFGPSPVRAPAVQAASAVADLGDLPTWRLEDLYASAGSDEFRRDLAKAEADALAFENRWK 69

Query: 73  GNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKL 132
           GNLA A  +     +GAA+ E+E + +L+GRIAS+A L+Y  + S+P   K Y D+ +KL
Sbjct: 70  GNLADAAARTGDQGIGAAVKEFEALEDLMGRIASFAGLTYFSDTSNPANGKLYGDVQSKL 129

Query: 133 ADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSD 192
            D    L+FF+LE+N +D+ +++ +   D L   Y  WI ++RK K + L + +E L  +
Sbjct: 130 TDISAHLLFFSLELNRIDDKVIDATLEADSLAGHYKPWILDLRKDKPYQLDDRLEQLFLE 189

Query: 193 TSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKS 252
            S  G  A  R F E I SL F ++ + +PL        D+  E RK AA AL+ TF  +
Sbjct: 190 KSMTGANAFNRLFDETIASLTFSVDGEALPLEVTLNLLQDASSENRKKAAIALAETFKAN 249

Query: 253 SHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRY 312
              F+ +TNTLAKD+EI DRWR +E IADSRHL+N VE  V++AL  +VK+ YP+ SHRY
Sbjct: 250 IRTFTLVTNTLAKDKEISDRWRGFEDIADSRHLANRVEREVVDALAAAVKDAYPRLSHRY 309

Query: 313 YELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTH 372
           Y LK KWL ++ M FWDR APLP T   +IP+  A+D VL +Y  F+P+M+ IA +FF  
Sbjct: 310 YGLKAKWLGMEQMEFWDRNAPLPETPNALIPWGEAKDTVLSAYHGFAPEMASIARRFFDD 369

Query: 373 NWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQG 432
            WIDAP   GK  GAFAH T+PSVHPY+L+NY+GKP+DVMTLAHELGHG+H VL+   QG
Sbjct: 370 RWIDAPVRPGKAPGAFAHPTVPSVHPYVLVNYMGKPRDVMTLAHELGHGVHQVLAG-GQG 428

Query: 433 ILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDF 492
            L  ++ LTLAETAS+FGE LTF +LL     K ERK +LA K+EDM+N++VRQI+FY+F
Sbjct: 429 ALMASTPLTLAETASVFGEMLTFRALLDRTKDKRERKAMLAQKVEDMINTVVRQIAFYEF 488

Query: 493 ELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVY 552
           E K+HT R+  G++    + E+WL  Q+ESLGPA  +S+  Y ++W  +PHFI S FYVY
Sbjct: 489 ERKVHTARKQ-GELTADDLGELWLSVQRESLGPAIRISE-GYETYWAYIPHFIHSPFYVY 546

Query: 553 AYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERG 612
           AYAFG+CLVNSLY +Y+ N    F+EKY N+L+AG +KH+SELL P  ++ +DP+FW +G
Sbjct: 547 AYAFGDCLVNSLYAVYR-NAESGFQEKYFNLLKAGGTKHHSELLAPFGLDAADPSFWAQG 605

Query: 613 LQTVEKMIDDVEKM 626
           L  +E +ID++E +
Sbjct: 606 LSMIEGLIDELEAL 619


>gi|163758860|ref|ZP_02165947.1| putative oligoendopeptidase f protein [Hoeflea phototrophica
           DFL-43]
 gi|162284150|gb|EDQ34434.1| putative oligoendopeptidase f protein [Hoeflea phototrophica
           DFL-43]
          Length = 601

 Score =  630 bits (1626), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 297/603 (49%), Positives = 412/603 (68%), Gaps = 4/603 (0%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           MT   +   LG+LP WNL+DLYP   S E ++D+     ++  F+ RW+G L  A N   
Sbjct: 1   MTARSADSELGDLPGWNLDDLYPGPQSAEFTSDLSKARTQAADFEARWKGGLKAAVNATA 60

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
              LGAAI  YER+ EL+GRI SYA L+Y  +   P   KFY D+ + + D    ++FFA
Sbjct: 61  DDGLGAAIEAYERLEELMGRIISYAGLTYFTDSVDPAKAKFYGDVQSAITDISAHILFFA 120

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
           LE+N +D+A+++     D    +Y+ WI+++R  K + L + +E L  + S  GR A  R
Sbjct: 121 LELNRIDDAVIDACIDNDSRAARYAPWIRDLRLDKPYQLEDRVEQLFHEKSVTGRAAWNR 180

Query: 204 FFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTL 263
            F E + SL F I+ + +PL        D+D E RK A  AL+ TF ++   F+ ITNTL
Sbjct: 181 LFDETMTSLEFDIDGEHLPLEATLSMLQDADGERRKKAGLALAATFKQNLRTFTLITNTL 240

Query: 264 AKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLD 323
           AKD+EI DRWR +E IADSRHL+N VE  V++AL Q+V+   P+ SHRYY +K +WL L+
Sbjct: 241 AKDKEISDRWRGFEDIADSRHLANRVERPVVDALAQAVREACPRLSHRYYAMKARWLGLE 300

Query: 324 TMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGK 383
            + FWDR APLP T +  IP++ A++ VL +Y  F+P+M+ IA +FF   WIDAP   GK
Sbjct: 301 KLEFWDRNAPLPETPKATIPWDEAKNTVLSAYHGFAPEMADIARRFFDRQWIDAPSRPGK 360

Query: 384 GSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLA 443
            SGAFAH T+PSVHPY+L+NYLGKP+DVMTLAHELGHG+H VL+   QG L  ++ LTLA
Sbjct: 361 TSGAFAHPTVPSVHPYVLVNYLGKPRDVMTLAHELGHGVHQVLAG-AQGALMASTPLTLA 419

Query: 444 ETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRST 503
           ETAS+FGE LTF +LL+    + ERK +LA K+EDM+N++VRQI+FY+FE ++HT RR  
Sbjct: 420 ETASVFGEMLTFRALLERTEDRRERKAMLAQKVEDMINTVVRQIAFYEFERRVHTARRE- 478

Query: 504 GDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNS 563
           G++ + ++ ++WL+ Q ESLGPA +LS+  Y +FW  +PHFI S FYVYAYAFG+CLVNS
Sbjct: 479 GELTSEQLGKLWLDVQSESLGPAVELSE-GYETFWAYIPHFIHSPFYVYAYAFGDCLVNS 537

Query: 564 LYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDV 623
           LY +Y+  T D F+E+Y ++L+AG +KH+SELL P  ++ SDP FW +GL  +E +ID++
Sbjct: 538 LYAVYE-KTPDGFRERYFDMLKAGGTKHHSELLKPFGLDASDPGFWNQGLSMIEGLIDEL 596

Query: 624 EKM 626
           E M
Sbjct: 597 EAM 599


>gi|241206286|ref|YP_002977382.1| oligoendopeptidase, pepF/M3 family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860176|gb|ACS57843.1| oligoendopeptidase, pepF/M3 family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 617

 Score =  627 bits (1616), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 295/593 (49%), Positives = 404/593 (68%), Gaps = 4/593 (0%)

Query: 34  GNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAE 93
           G LP W L+DLYPS  S     DME     ++AF+ +W+G L  AT +     +GAA+ E
Sbjct: 26  GVLPVWKLQDLYPSATSTAFVADMEKAGKAAIAFEEKWKGTLTEATAKTGAEGIGAALKE 85

Query: 94  YERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEAL 153
           YE + ++IGR+ S+A L+Y  + ++PT  K Y D+ AK+ +F   L+FFALE+N +D+A+
Sbjct: 86  YEALDDIIGRLGSFAGLTYFSDTTNPTNGKLYGDVQAKITEFSGHLLFFALELNRIDDAV 145

Query: 154 LEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLR 213
           ++   A DP    Y  W+ ++RK K + L + +E L  + S     A  R F E +  LR
Sbjct: 146 IDACMANDPAAGHYRPWLLDLRKDKPYQLDDRLEQLFLEKSMTSAAAFNRLFDETMAELR 205

Query: 214 FKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRW 273
           ++I+ +K+PL  A     + D EVR+ AA AL+ TF  +   F+ ITNTLAKD+EI DRW
Sbjct: 206 YEIDGEKVPLEVALNKLQEKDPEVRRKAAMALAETFKANIRTFTLITNTLAKDKEIADRW 265

Query: 274 RKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAP 333
           R +E IADSRHL+N VE  V++AL  +V+  YP+ SHRYY++K KWL ++ M FWDR AP
Sbjct: 266 RGFEDIADSRHLANRVEREVVDALAAAVREAYPRLSHRYYKMKAKWLGMEQMNFWDRNAP 325

Query: 334 LPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTI 393
           LP TS  II +  A+D VL +Y  FSP+M+ IA +FF   WIDAP   GK  GAFAH T+
Sbjct: 326 LPETSSAIISWPEAKDTVLSAYGNFSPEMADIARRFFDEQWIDAPVRAGKAPGAFAHPTV 385

Query: 394 PSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETL 453
           PS HPY+L+NY+GKP+DVMTLAHELGHG+H VL+   QG L   + LTLAETAS+FGE L
Sbjct: 386 PSAHPYVLVNYMGKPRDVMTLAHELGHGVHQVLAG-AQGALMCQTPLTLAETASVFGEML 444

Query: 454 TFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINE 513
           TF +LLQ  +   ERK +LA K+EDM+N++VRQI+FY+FE KLHT R++ G++    I E
Sbjct: 445 TFRALLQKTTDTRERKAMLAQKVEDMINTVVRQIAFYEFERKLHTARKA-GELTADDIGE 503

Query: 514 IWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTV 573
           +WL  Q ESLGPA  +S+  Y ++W  +PHFI S FYVYAYAFG+CLVNSLY +Y+    
Sbjct: 504 LWLSVQSESLGPAISISE-GYETYWAYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQ-KAE 561

Query: 574 DCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
             F+EKY  +LRAG +KH+SELL P  ++ +DP+FW +GL  +E +ID++E +
Sbjct: 562 KGFQEKYFELLRAGGTKHHSELLKPFGLDATDPSFWSQGLSMIEGLIDELEAL 614


>gi|222149716|ref|YP_002550673.1| oligoendopeptidase F [Agrobacterium vitis S4]
 gi|221736698|gb|ACM37661.1| oligoendopeptidase F [Agrobacterium vitis S4]
          Length = 619

 Score =  625 bits (1612), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 294/596 (49%), Positives = 408/596 (68%), Gaps = 4/596 (0%)

Query: 31  ENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAA 90
           + LG LP W L DLYP+  S     D+      SLAF+T+W+G L  A  +     LGAA
Sbjct: 24  QGLGTLPEWQLTDLYPAPSSDLFKADLAKASEMSLAFETKWKGRLEDAAAKDADQGLGAA 83

Query: 91  IAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLD 150
           + E+E + +L+G+I SYA L Y   ++ P   KF+ D+ A+L +    L+FF LE+N LD
Sbjct: 84  LKEFEELEDLLGKIGSYAGLYYYSEMTKPENGKFFGDVQARLTELAAHLLFFTLELNRLD 143

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIE 210
           +A+++ + A+DP T  Y  W+ ++R+ K + L + +E L  + SQ G  A  R F E + 
Sbjct: 144 DAVIDAAIARDPATAHYKPWLIDLRQDKPYQLDDKLEQLFLEKSQTGSAAFNRLFDETLA 203

Query: 211 SLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
           SLRF+I+ +++ L        ++D  +R+ AA ALS TF  +  IF  +TNTLAKD+EI 
Sbjct: 204 SLRFEIDGEQLTLEPVLTMLQEADPALREKAAMALSKTFKDNIRIFVLVTNTLAKDKEIS 263

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
           DRWR +  IADSRHLSN VE  V++AL  +V++ YP+ SHRYY++K KWL ++ M FWDR
Sbjct: 264 DRWRGFADIADSRHLSNRVERPVVDALAAAVRDAYPRLSHRYYKMKAKWLGMEQMNFWDR 323

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
            APLP +   IIP++ AR  VL +Y  F+P M+ IA +FF   WIDAP   GK  GAFAH
Sbjct: 324 NAPLPDSIDRIIPWDEARQTVLSAYGGFAPDMAEIAGRFFDGGWIDAPARPGKAPGAFAH 383

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
            T+PS HPY+L+NYLGKP+DVMTLAHELGHG+H VL+ E QG L   + LTLAETAS+FG
Sbjct: 384 PTVPSAHPYVLVNYLGKPRDVMTLAHELGHGVHQVLAGE-QGALMCQTPLTLAETASVFG 442

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E LTF +LL+ A+   ERK +LA K+EDM+N++VRQI+FY+FE KLHT R+  G++   +
Sbjct: 443 EMLTFRALLEKATDARERKAMLAQKVEDMINTVVRQIAFYEFERKLHTARKE-GELTAEK 501

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
           I E+WL  Q+ESLGPA  +S+  Y ++W  +PHFI S FYVYAYAFG+CLVNSLY +Y+ 
Sbjct: 502 IGELWLSVQEESLGPAIKVSE-GYETWWAYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQ- 559

Query: 571 NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           N    F++KY ++L+AG SKH+SELL P  ++ +DP+FW +GL  +E +ID++E +
Sbjct: 560 NAEQGFQQKYFDLLKAGGSKHHSELLAPFGLDATDPSFWAKGLSMIEGLIDELEAL 615


>gi|306845298|ref|ZP_07477873.1| oligoendopeptidase, pepF/M3 family [Brucella sp. BO1]
 gi|306274214|gb|EFM56026.1| oligoendopeptidase, pepF/M3 family [Brucella sp. BO1]
          Length = 620

 Score =  624 bits (1610), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 302/624 (48%), Positives = 418/624 (66%), Gaps = 7/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K+  Y F S+A  R     +       + +LGNLP WNL DLYP+ DS +++ D+E    
Sbjct: 2   KFMVYRFSSDAILRA---PAADAIAAKKHDLGNLPEWNLADLYPAPDSPQLAGDLEKAMQ 58

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           +S+ F+ RW+G LA    + N  +L  AI E+E + EL+GRI SYA L Y  + + P   
Sbjct: 59  DSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGSYAGLYYYGDTTDPKRM 118

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           K + D   KL D    LIFF LE+N +D+A+LE++  ++P    Y  W+ ++R  K + L
Sbjct: 119 KLFGDAQQKLTDASTPLIFFTLELNRIDDAVLEKAMDENPAIGHYRPWLTDLRMDKPYQL 178

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
            + +E L  + S  G  A  R F E +  LRF+I  +++ +        D+D  VR+ A+
Sbjct: 179 DDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLAIEPTLNMLQDADGTVRRQAS 238

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           +AL+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADS+HLSN VE  V++AL ++V+
Sbjct: 239 EALAKTFAANLRTFTLITNTLAKDKEISDRWRGFKDIADSQHLSNRVEREVVDALAKAVE 298

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           + YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P+M
Sbjct: 299 DAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETPQALIPWDEARETVLSAYGNFAPEM 358

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           + IA KFF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGHG+
Sbjct: 359 ADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGHGV 418

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VL+  +QG L  ++ LTLAETAS+FGE LTF  LL+    K ERK +LA K EDM+N+
Sbjct: 419 HQVLAG-SQGALMASTPLTLAETASVFGEMLTFRLLLERTRDKRERKAMLAQKAEDMINT 477

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           +VRQI+FY FE ++HTERR+ G++ + RI EIW++ Q+ESLG A  L+   Y +FW  +P
Sbjct: 478 VVRQIAFYQFERRVHTERRA-GELTSERIGEIWMDVQRESLGDAVRLNP-GYETFWTYIP 535

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY  +L+AG +KH+ ELL P  ++
Sbjct: 536 HFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLD 594

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
            SDP FW +GL  +E +ID++E M
Sbjct: 595 ASDPGFWNKGLSVIEGIIDELEAM 618


>gi|254699397|ref|ZP_05161225.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella suis
           bv. 5 str. 513]
 gi|254711351|ref|ZP_05173162.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella
           pinnipedialis B2/94]
 gi|256014877|ref|YP_003104886.1| oligoendopeptidase F [Brucella microti CCM 4915]
 gi|256030020|ref|ZP_05443634.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella
           pinnipedialis M292/94/1]
 gi|256059672|ref|ZP_05449867.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella
           neotomae 5K33]
 gi|256158192|ref|ZP_05456101.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella ceti
           M490/95/1]
 gi|256252866|ref|ZP_05458402.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella ceti
           B1/94]
 gi|260166929|ref|ZP_05753740.1| oligoendopeptidase F [Brucella sp. F5/99]
 gi|261219953|ref|ZP_05934234.1| pepF/M3 family oligoendopeptidase [Brucella ceti B1/94]
 gi|261318954|ref|ZP_05958151.1| pepF/M3 family oligoendopeptidase [Brucella pinnipedialis B2/94]
 gi|261323643|ref|ZP_05962840.1| pepF/M3 family oligoendopeptidase [Brucella neotomae 5K33]
 gi|261749846|ref|ZP_05993555.1| pepF/M3 family oligoendopeptidase [Brucella suis bv. 5 str. 513]
 gi|261756314|ref|ZP_06000023.1| neutral zinc metallopeptidase [Brucella sp. F5/99]
 gi|265987042|ref|ZP_06099599.1| pepF/M3 family oligoendopeptidase [Brucella pinnipedialis
           M292/94/1]
 gi|265996704|ref|ZP_06109261.1| pepF/M3 family oligoendopeptidase [Brucella ceti M490/95/1]
 gi|294853108|ref|ZP_06793780.1| oligoendopeptidase F [Brucella sp. NVSL 07-0026]
 gi|255997537|gb|ACU49224.1| oligoendopeptidase F [Brucella microti CCM 4915]
 gi|260918537|gb|EEX85190.1| pepF/M3 family oligoendopeptidase [Brucella ceti B1/94]
 gi|261298177|gb|EEY01674.1| pepF/M3 family oligoendopeptidase [Brucella pinnipedialis B2/94]
 gi|261299623|gb|EEY03120.1| pepF/M3 family oligoendopeptidase [Brucella neotomae 5K33]
 gi|261736298|gb|EEY24294.1| neutral zinc metallopeptidase [Brucella sp. F5/99]
 gi|261739599|gb|EEY27525.1| pepF/M3 family oligoendopeptidase [Brucella suis bv. 5 str. 513]
 gi|262551001|gb|EEZ07162.1| pepF/M3 family oligoendopeptidase [Brucella ceti M490/95/1]
 gi|264659239|gb|EEZ29500.1| pepF/M3 family oligoendopeptidase [Brucella pinnipedialis
           M292/94/1]
 gi|294818763|gb|EFG35763.1| oligoendopeptidase F [Brucella sp. NVSL 07-0026]
          Length = 620

 Score =  624 bits (1609), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 302/624 (48%), Positives = 418/624 (66%), Gaps = 7/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K+  Y F S+A  R     +       + +LGNLP WNL DLYP+ DS ++++D+E    
Sbjct: 2   KFMVYRFSSDAILRA---PAADAIAAKKHDLGNLPEWNLADLYPAPDSPQLASDLEKAMQ 58

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           +S+ F+ RW+G LA    + N  +L  AI E+E + EL+GRI SYA L Y  + + P   
Sbjct: 59  DSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGSYAGLYYYGDTTDPKRM 118

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           K + D   KL D    LIFF LE+N +D+ +LE++  ++P    Y  W+ ++R  K + L
Sbjct: 119 KLFGDAQQKLTDASTPLIFFTLELNRIDDTVLEKAMNENPAIGHYRPWLTDLRMDKPYQL 178

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
            + +E L  + S  G  A  R F E +  LRF+I  +++ +        D+D  VRK A+
Sbjct: 179 DDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLAIEPTLNMLQDADGAVRKQAS 238

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           +AL+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADS+HLSN VE  V++AL ++V+
Sbjct: 239 EALAKTFTANLRTFTLITNTLAKDKEISDRWRGFKDIADSQHLSNRVEREVVDALAKAVE 298

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           + YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P+M
Sbjct: 299 DAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETPQALIPWDEARETVLSAYGNFAPEM 358

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           + IA KFF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGHG+
Sbjct: 359 ADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGHGV 418

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VL+  +QG L  ++ LTLAETAS+FGE LTF  LL+    K ERK +LA K EDM+N+
Sbjct: 419 HQVLAG-SQGALMASTPLTLAETASVFGEMLTFRLLLERTRDKRERKAMLAQKAEDMINT 477

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           +VRQI+FY FE ++HTERR+ G++ + RI EIW++ Q+ESLG A  L+   Y +FW  +P
Sbjct: 478 VVRQIAFYQFERRVHTERRA-GELTSERIGEIWMDVQRESLGDAVRLNP-GYETFWTYIP 535

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY  +L+AG +KH+ ELL P  ++
Sbjct: 536 HFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLD 594

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
            SDP FW +GL  +E +ID++E M
Sbjct: 595 ASDPGFWNKGLSVIEGIIDELEAM 618


>gi|319781622|ref|YP_004141098.1| oligoendopeptidase, pepF/M3 family [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167510|gb|ADV11048.1| oligoendopeptidase, pepF/M3 family [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 610

 Score =  624 bits (1608), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 298/594 (50%), Positives = 402/594 (67%), Gaps = 4/594 (0%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           LG+LP WNL DLY   D+ E+  D+     ++ +F++RW+G LA    +     LG A+ 
Sbjct: 19  LGDLPEWNLADLYAGMDAPELKRDIAKAATDATSFESRWKGTLAAEAERGGAGRLGEALV 78

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
            YE + ELIGRI SYA L Y  N + P   K Y DI  K+ D    L+FFALE+N +D+A
Sbjct: 79  AYEALEELIGRIVSYAGLVYAGNTADPQRAKLYGDIQEKMTDASAHLLFFALELNLIDDA 138

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
            +E + A DP    Y  W+ ++RK K + L + +E L  + S  GR A  R F E +  L
Sbjct: 139 SIEGALAVDPAFGHYRPWVLDLRKDKPYQLEDRVEQLFHEKSITGRGAWNRLFDETMTDL 198

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           RF I+ +++ L  A     D+D EVR+ A++AL+ TF K+   F+ ITNTLAKD+EI DR
Sbjct: 199 RFHIDGEELTLEPALNRLQDADGEVRRRASEALATTFRKNLRTFTLITNTLAKDKEISDR 258

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR +E IADSRHL+N VE  V++AL  +V++ YP+ SHRYY +K +WL ++ M  WDR A
Sbjct: 259 WRGFEDIADSRHLANRVERSVVDALASAVRDAYPRLSHRYYAMKARWLGMEVMNHWDRNA 318

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP T Q II ++ AR+ VL +Y +FSP M+ IA  FF  NWIDAP   GK  GAFAH T
Sbjct: 319 PLPDTPQAIIGWDEARNTVLSAYQRFSPDMAEIARTFFDRNWIDAPVRPGKSPGAFAHPT 378

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +PS HPY+LLNY+GKP+DVMTLAHELGHG+H VL+   QG L  ++ LTLAETAS+FGE 
Sbjct: 379 VPSAHPYVLLNYMGKPRDVMTLAHELGHGVHQVLAG-GQGALMASTPLTLAETASVFGEM 437

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF SLL   + + ERK +LA K+EDM+N++VRQI+FY+FE K+H ER++ G++ + R+ 
Sbjct: 438 LTFRSLLDQTTDRRERKAMLAQKVEDMINTVVRQIAFYEFERKVHAERKN-GELTSDRLG 496

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
           + WLE Q ESLGPA  L +  Y  FW  +PHFI S FYVYAYAFG+CLVNSLY +Y+ N 
Sbjct: 497 QFWLEVQAESLGPAIKLRE-GYEVFWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQ-NA 554

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              F++KY  +LRAG +KH+SELL P  ++ +DP FW+ GL  +  +ID++E +
Sbjct: 555 ERGFQDKYFEMLRAGGTKHHSELLAPFGLDATDPAFWQIGLGVIGGLIDELEAL 608


>gi|225685947|ref|YP_002733919.1| oligoendopeptidase, pepF/M3 family protein [Brucella melitensis
           ATCC 23457]
 gi|256261840|ref|ZP_05464372.1| neutral zinc metallopeptidase [Brucella melitensis bv. 2 str. 63/9]
 gi|225642052|gb|ACO01965.1| oligoendopeptidase, pepF/M3 family protein [Brucella melitensis
           ATCC 23457]
 gi|263091315|gb|EEZ15851.1| neutral zinc metallopeptidase [Brucella melitensis bv. 2 str. 63/9]
 gi|326410269|gb|ADZ67333.1| oligoendopeptidase, pepF/M3 family protein [Brucella melitensis
           M28]
 gi|326553562|gb|ADZ88201.1| oligoendopeptidase, pepF/M3 family protein [Brucella melitensis
           M5-90]
          Length = 620

 Score =  624 bits (1608), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 302/624 (48%), Positives = 418/624 (66%), Gaps = 7/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K+  Y F S+A  R     +       + +LGNLP WNL DLYP+ DS ++++D+E    
Sbjct: 2   KFMVYRFSSDAILRA---PAADAIAAKKHDLGNLPEWNLADLYPAPDSPQLASDLEKAMQ 58

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           +S+ F+ RW+G LA    + N  +L  AI E+E + EL+GRI SYA L Y  + + P   
Sbjct: 59  DSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGSYAGLYYYGDTTDPKRM 118

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           K + D   KL D    LIFF LE+N +D+ +LE++  ++P    Y  W+ ++R  K + L
Sbjct: 119 KLFGDAQQKLTDASTPLIFFTLELNCIDDTVLEKAMNENPAIGHYRPWLTDLRMDKPYQL 178

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
            + +E L  + S  G  A  R F E +  LRF+I  +++ +        D+D  VRK A+
Sbjct: 179 DDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLAIEPTLNMLQDADGAVRKQAS 238

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           +AL+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADS+HLSN VE  V++AL ++V+
Sbjct: 239 EALAKTFTANLRTFTLITNTLAKDKEISDRWRGFKDIADSQHLSNRVEREVVDALAKAVE 298

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           + YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P+M
Sbjct: 299 DAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETPQALIPWDEARETVLSAYGNFAPEM 358

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           + IA KFF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGHG+
Sbjct: 359 ADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGHGV 418

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VL+  +QG L  ++ LTLAETAS+FGE LTF  LL+    K ERK +LA K EDM+N+
Sbjct: 419 HQVLAG-SQGALMASTPLTLAETASVFGEMLTFRLLLERTRDKRERKAMLAQKAEDMINT 477

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           +VRQI+FY FE ++HTERR+ G++ + RI EIW++ Q+ESLG A  L+   Y +FW  +P
Sbjct: 478 VVRQIAFYQFERRVHTERRA-GELTSERIGEIWMDVQRESLGDAVRLNP-GYETFWTYIP 535

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY  +L+AG +KH+ ELL P  ++
Sbjct: 536 HFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLD 594

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
            SDP FW +GL  +E +ID++E M
Sbjct: 595 ASDPGFWNKGLSVIEGIIDELEAM 618


>gi|254720668|ref|ZP_05182479.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella sp.
           83/13]
 gi|265985718|ref|ZP_06098453.1| pepF/M3 family oligoendopeptidase [Brucella sp. 83/13]
 gi|306838879|ref|ZP_07471708.1| oligoendopeptidase, pepF/M3 family [Brucella sp. NF 2653]
 gi|264664310|gb|EEZ34571.1| pepF/M3 family oligoendopeptidase [Brucella sp. 83/13]
 gi|306406031|gb|EFM62281.1| oligoendopeptidase, pepF/M3 family [Brucella sp. NF 2653]
          Length = 620

 Score =  624 bits (1608), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 302/624 (48%), Positives = 418/624 (66%), Gaps = 7/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K+  Y F S+A  R     +       + +LGNLP WNL DLYP+ DS +++ D+E    
Sbjct: 2   KFMVYRFSSDAILRA---PAADAIAAKKHDLGNLPEWNLADLYPAPDSPQLAGDLEKAMQ 58

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           +S+ F+ RW+G LA    + N  +L  AI E+E + EL+GRI SYA L Y  + + P   
Sbjct: 59  DSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGSYAGLYYYGDTTDPKRM 118

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           K + D   KL D    LIFF LE+N +D+++LE++  ++P    Y  W+ ++R  K + L
Sbjct: 119 KLFGDAQQKLTDASTPLIFFTLELNRIDDSVLEKAMNENPAIGHYRPWLTDLRMDKPYQL 178

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
            + +E L  + S  G  A  R F E +  LRF+I  +++ +        D+D  VRK A+
Sbjct: 179 DDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLAIEPTLNMLQDADGAVRKQAS 238

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           +AL+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADS+HLSN VE  V++AL ++V+
Sbjct: 239 EALAKTFAANLRTFTLITNTLAKDKEISDRWRGFKDIADSQHLSNRVEREVVDALAKAVE 298

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           + YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P+M
Sbjct: 299 DAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETPQALIPWDEARETVLSAYGNFAPEM 358

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           + IA KFF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGHG+
Sbjct: 359 ADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGHGV 418

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VL+  +QG L  ++ LTLAETAS+FGE LTF  LL+    K ERK +LA K EDM+N+
Sbjct: 419 HQVLAG-SQGALMASTPLTLAETASVFGEMLTFRLLLKRTRDKRERKAMLAQKAEDMINT 477

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           +VRQI+FY FE ++HTERR+ G++ + RI EIW++ Q+ESLG A  L+   Y +FW  +P
Sbjct: 478 VVRQIAFYQFERRVHTERRA-GELTSERIGEIWMDVQRESLGDAVRLNP-GYETFWTYIP 535

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY  +L+AG +KH+ ELL P  ++
Sbjct: 536 HFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLD 594

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
            SDP FW +GL  +E +ID++E M
Sbjct: 595 ASDPGFWNKGLSVIEGIIDELEAM 618


>gi|256043006|ref|ZP_05445952.1| oligoendopeptidase, pepF/M3 family protein [Brucella melitensis bv.
           1 str. Rev.1]
 gi|260564239|ref|ZP_05834724.1| neutral zinc metallopeptidase [Brucella melitensis bv. 1 str. 16M]
 gi|265989443|ref|ZP_06102000.1| pepF/M3 family oligoendopeptidase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|260151882|gb|EEW86975.1| neutral zinc metallopeptidase [Brucella melitensis bv. 1 str. 16M]
 gi|263000112|gb|EEZ12802.1| pepF/M3 family oligoendopeptidase [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 620

 Score =  624 bits (1608), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 302/624 (48%), Positives = 418/624 (66%), Gaps = 7/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K+  Y F S+A  R     +       + +LGNLP WNL DLYP+ DS ++++D+E    
Sbjct: 2   KFMVYRFSSDAILRA---PAADAIAAKKHDLGNLPEWNLADLYPAPDSPQLASDLEKAMQ 58

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           +S+ F+ RW+G LA    + N  +L  AI E+E + EL+GRI SYA L Y  + + P   
Sbjct: 59  DSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGSYAGLYYYGDTTDPKRM 118

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           K + D   KL D    LIFF LE+N +D+ +LE++  ++P    Y  W+ ++R  K + L
Sbjct: 119 KLFGDAQQKLTDASTPLIFFTLELNCIDDTVLEKAMNENPAIGHYRPWLTDLRMDKPYQL 178

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
            + +E L  + S  G  A  R F E +  LRF+I  +++ +        D+D  VRK A+
Sbjct: 179 DDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLAIEPTLNMLQDADGAVRKQAS 238

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           +AL+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADS+HLSN VE  V++AL ++V+
Sbjct: 239 EALAKTFTANLRTFTLITNTLAKDKEISDRWRGFKDIADSQHLSNRVEREVVDALAKAVE 298

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           + YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P+M
Sbjct: 299 DAYPRLSHRYYALKAKWLDLEKLENWDRNAPLPETPQALIPWDEARETVLSAYGNFAPEM 358

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           + IA KFF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGHG+
Sbjct: 359 ADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGHGV 418

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VL+  +QG L  ++ LTLAETAS+FGE LTF  LL+    K ERK +LA K EDM+N+
Sbjct: 419 HQVLAG-SQGALMASTPLTLAETASVFGEMLTFRLLLERTRDKRERKAMLAQKAEDMINT 477

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           +VRQI+FY FE ++HTERR+ G++ + RI EIW++ Q+ESLG A  L+   Y +FW  +P
Sbjct: 478 VVRQIAFYQFERRVHTERRA-GELTSERIGEIWMDVQRESLGDAVRLNP-GYETFWTYIP 535

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY  +L+AG +KH+ ELL P  ++
Sbjct: 536 HFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLD 594

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
            SDP FW +GL  +E +ID++E M
Sbjct: 595 ASDPGFWNKGLSVIEGIIDELEAM 618


>gi|225628561|ref|ZP_03786595.1| oligoendopeptidase, pepF/M3 family protein [Brucella ceti str.
           Cudo]
 gi|225616407|gb|EEH13455.1| oligoendopeptidase, pepF/M3 family protein [Brucella ceti str.
           Cudo]
          Length = 678

 Score =  623 bits (1607), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 302/624 (48%), Positives = 418/624 (66%), Gaps = 7/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K+  Y F S+A  R     +       + +LGNLP WNL DLYP+ DS ++++D+E    
Sbjct: 60  KFMVYRFSSDAILRA---PAADAIAAKKHDLGNLPEWNLADLYPAPDSPQLASDLEKAMQ 116

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           +S+ F+ RW+G LA    + N  +L  AI E+E + EL+GRI SYA L Y  + + P   
Sbjct: 117 DSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGSYAGLYYYGDTTDPKRM 176

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           K + D   KL D    LIFF LE+N +D+ +LE++  ++P    Y  W+ ++R  K + L
Sbjct: 177 KLFGDAQQKLTDASTPLIFFTLELNRIDDTVLEKAMNENPAIGHYRPWLTDLRMDKPYQL 236

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
            + +E L  + S  G  A  R F E +  LRF+I  +++ +        D+D  VRK A+
Sbjct: 237 DDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLAIEPTLNMLQDADGAVRKQAS 296

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           +AL+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADS+HLSN VE  V++AL ++V+
Sbjct: 297 EALAKTFTANLRTFTLITNTLAKDKEISDRWRGFKDIADSQHLSNRVEREVVDALAKAVE 356

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           + YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P+M
Sbjct: 357 DAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETPQALIPWDEARETVLSAYGNFAPEM 416

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           + IA KFF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGHG+
Sbjct: 417 ADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGHGV 476

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VL+  +QG L  ++ LTLAETAS+FGE LTF  LL+    K ERK +LA K EDM+N+
Sbjct: 477 HQVLAG-SQGALMASTPLTLAETASVFGEMLTFRLLLERTRDKRERKAMLAQKAEDMINT 535

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           +VRQI+FY FE ++HTERR+ G++ + RI EIW++ Q+ESLG A  L+   Y +FW  +P
Sbjct: 536 VVRQIAFYQFERRVHTERRA-GELTSERIGEIWMDVQRESLGDAVRLNP-GYETFWTYIP 593

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY  +L+AG +KH+ ELL P  ++
Sbjct: 594 HFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLD 652

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
            SDP FW +GL  +E +ID++E M
Sbjct: 653 ASDPGFWNKGLSVIEGIIDELEAM 676


>gi|163844280|ref|YP_001621935.1| pepF/M3 family oligoendopeptidase [Brucella suis ATCC 23445]
 gi|163675003|gb|ABY39113.1| oligoendopeptidase, pepF/M3 family [Brucella suis ATCC 23445]
          Length = 620

 Score =  623 bits (1607), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 302/624 (48%), Positives = 417/624 (66%), Gaps = 7/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K+  Y F S+A  R     +       + +LGNLP WNL DLYP+ DS ++++D+E    
Sbjct: 2   KFMVYRFSSDAILRA---PAADAIAAKKHDLGNLPEWNLADLYPAPDSPQLASDLEKAMQ 58

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           +S+ F+ RW+G LA    + N  +L  AI E+E + EL+GRI SYA L Y  + + P   
Sbjct: 59  DSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGSYAGLYYYGDTTDPKRM 118

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           K + D   KL D    LIFF LE+N +D+ +LE++  ++P    Y  W+ ++R  K + L
Sbjct: 119 KLFGDAQQKLTDASTPLIFFTLELNRIDDTVLEKAMNENPAIGHYRPWLTDLRMDKPYQL 178

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
            + +E L  + S  G  A  R F E +  LRF+I  +++ +        D+D  VRK A+
Sbjct: 179 DDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLAIEPTLNMLQDADGAVRKQAS 238

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           +AL+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADS+HLSN VE  V+ AL ++V+
Sbjct: 239 EALAKTFTANLRTFTLITNTLAKDKEISDRWRGFKDIADSQHLSNRVEREVVNALAKAVE 298

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           + YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P+M
Sbjct: 299 DAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETPQALIPWDEARETVLSAYGNFAPEM 358

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           + IA KFF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGHG+
Sbjct: 359 ADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGHGV 418

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VL+  +QG L  ++ LTLAETAS+FGE LTF  LL+    K ERK +LA K EDM+N+
Sbjct: 419 HQVLAG-SQGALMASTPLTLAETASVFGEMLTFRLLLERTRDKRERKAMLAQKAEDMINT 477

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           +VRQI+FY FE ++HTERR+ G++ + RI EIW++ Q+ESLG A  L+   Y +FW  +P
Sbjct: 478 VVRQIAFYQFERRVHTERRA-GELTSERIGEIWMDVQRESLGDAVRLNP-GYETFWTYIP 535

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY  +L+AG +KH+ ELL P  ++
Sbjct: 536 HFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLD 594

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
            SDP FW +GL  +E +ID++E M
Sbjct: 595 ASDPGFWNKGLSVIEGIIDELEAM 618


>gi|256112010|ref|ZP_05452955.1| oligoendopeptidase, pepF/M3 family protein [Brucella melitensis bv.
           3 str. Ether]
 gi|265993456|ref|ZP_06106013.1| pepF/M3 family oligoendopeptidase [Brucella melitensis bv. 3 str.
           Ether]
 gi|262764326|gb|EEZ10358.1| pepF/M3 family oligoendopeptidase [Brucella melitensis bv. 3 str.
           Ether]
          Length = 620

 Score =  623 bits (1607), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 302/624 (48%), Positives = 418/624 (66%), Gaps = 7/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K+  Y F S+A  R     +       + +LGNLP WNL DLYP+ DS ++++D+E    
Sbjct: 2   KFMVYRFSSDAILRA---PAADAIAAKKHDLGNLPEWNLADLYPAPDSPQLASDLEKAMQ 58

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           +S+ F+ RW+G LA    + N  +L  AI E+E + EL+GRI SYA L Y  + + P   
Sbjct: 59  DSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGSYAGLYYYGDTTDPKRM 118

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           K + D   KL D    LIFF LE+N +D+ +LE++  ++P    Y  W+ ++R  K + L
Sbjct: 119 KLFGDAQQKLTDASTPLIFFTLELNCIDDTVLEKAMNENPAIGHYRPWLTHLRMDKPYQL 178

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
            + +E L  + S  G  A  R F E +  LRF+I  +++ +        D+D  VRK A+
Sbjct: 179 DDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLAIEPTLNMLQDADGAVRKQAS 238

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           +AL+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADS+HLSN VE  V++AL ++V+
Sbjct: 239 EALAKTFTANLRTFTLITNTLAKDKEISDRWRGFKDIADSQHLSNRVEREVVDALAKAVE 298

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           + YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P+M
Sbjct: 299 DAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETPQALIPWDEARETVLSAYGNFAPEM 358

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           + IA KFF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGHG+
Sbjct: 359 ADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGHGV 418

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VL+  +QG L  ++ LTLAETAS+FGE LTF  LL+    K ERK +LA K EDM+N+
Sbjct: 419 HQVLAG-SQGALMASTPLTLAETASVFGEMLTFRLLLERTRDKRERKAMLAQKAEDMINT 477

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           +VRQI+FY FE ++HTERR+ G++ + RI EIW++ Q+ESLG A  L+   Y +FW  +P
Sbjct: 478 VVRQIAFYQFERRVHTERRA-GELTSERIGEIWMDVQRESLGDAVRLNP-GYETFWTYIP 535

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY  +L+AG +KH+ ELL P  ++
Sbjct: 536 HFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLD 594

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
            SDP FW +GL  +E +ID++E M
Sbjct: 595 ASDPGFWNKGLSVIEGIIDELEAM 618


>gi|332716498|ref|YP_004443964.1| Oligoendopeptidase F [Agrobacterium sp. H13-3]
 gi|325063183|gb|ADY66873.1| Oligoendopeptidase F [Agrobacterium sp. H13-3]
          Length = 616

 Score =  623 bits (1606), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 298/598 (49%), Positives = 401/598 (67%), Gaps = 4/598 (0%)

Query: 29  SQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG 88
           S   LG+LP W L DLYPS DS E   D+E     + AF+ +W+G L  A      + +G
Sbjct: 18  SGPALGDLPGWKLSDLYPSGDSPEYKGDIEKAATLAAAFEDKWKGKLEDAAKATGANGIG 77

Query: 89  AAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINT 148
           AA+ EYE + +LIGRI S+A L+Y  + S+P   K Y D  AKL D    L+FF LE+N 
Sbjct: 78  AALKEYEALDDLIGRIGSFAGLTYFSDTSNPANGKLYGDAQAKLTDISAHLLFFTLELNR 137

Query: 149 LDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCEN 208
           +D+A+++   A D L   Y  W+ ++RK K H L + +E L  + S     A  R F E 
Sbjct: 138 IDDAVMDACMANDALAGHYRPWLVDLRKDKPHQLDDQLEQLFLEKSMTSASAFNRLFDET 197

Query: 209 IESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEE 268
           +  LRF I+   + L        + + E RK AA+ALS TF  +  +F+ ITNTLAKD++
Sbjct: 198 MADLRFDIDGASLSLEVTLNMLQEPEPETRKKAAQALSTTFTNNLRVFTLITNTLAKDKD 257

Query: 269 IQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFW 328
           I DRWRK+E IADSRHL+N VE  V++AL  +VKN YP+ SHRYY +K KWL ++ M +W
Sbjct: 258 ISDRWRKFEDIADSRHLANRVEREVVDALAAAVKNAYPRLSHRYYAMKAKWLGMEQMNYW 317

Query: 329 DRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAF 388
           DR APLP TS  IIP++ A+D VL +Y  F+P+M+ IA +FF   WIDAP   GK  GAF
Sbjct: 318 DRNAPLPDTSNTIIPWDEAKDTVLSAYGDFAPEMADIARRFFDEQWIDAPARPGKAPGAF 377

Query: 389 AHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASI 448
           AH T+PS HPY+L+NYLGKP+DVMTLAHELGHG+H VL+ + QG L   + LTLAETAS+
Sbjct: 378 AHPTVPSAHPYVLVNYLGKPRDVMTLAHELGHGVHQVLAGD-QGALMCATPLTLAETASV 436

Query: 449 FGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPT 508
           FGE LTF  LL       ERK +LA K+EDM+N++VRQI+FY+FE KLHT R+  G++ +
Sbjct: 437 FGEMLTFRKLLDDTKDVRERKAMLARKVEDMINTVVRQIAFYEFERKLHTARKQ-GELTS 495

Query: 509 HRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIY 568
            +I E+WL  Q ESLGPA  +S+  Y ++W  +PHFI S FYVYAYAFG+CLVNSLY +Y
Sbjct: 496 EQIGELWLSIQAESLGPAIKISE-GYETWWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVY 554

Query: 569 KSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           +      F+EKY  +L+AG +KH+SELL P  ++ +DP+FW++GL  +E +ID++E +
Sbjct: 555 QKAET-GFQEKYFELLKAGGTKHHSELLKPFGLDATDPSFWDKGLAVIEGLIDELEAL 611


>gi|254706358|ref|ZP_05168186.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella
           pinnipedialis M163/99/10]
 gi|261313805|ref|ZP_05953002.1| pepF/M3 family oligoendopeptidase [Brucella pinnipedialis
           M163/99/10]
 gi|261302831|gb|EEY06328.1| pepF/M3 family oligoendopeptidase [Brucella pinnipedialis
           M163/99/10]
          Length = 620

 Score =  622 bits (1605), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 301/624 (48%), Positives = 417/624 (66%), Gaps = 7/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K+  Y F S+A  R     +       + +LGNLP WNL DLYP+ DS ++++D+E    
Sbjct: 2   KFMVYRFSSDAILRA---PAADAIAAKKHDLGNLPEWNLADLYPAPDSPQLASDLEKAMQ 58

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           +S+ F+ RW+G LA    + N  +L  AI E+E + EL+GRI SYA L Y  + + P   
Sbjct: 59  DSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGSYAGLYYYGDTTDPKRM 118

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           K + D   KL D    LIFF LE+N +D+ +LE++  ++P    Y  W+ ++R  K + L
Sbjct: 119 KLFGDAQQKLTDASTPLIFFTLELNRIDDTVLEKAMNENPAIGHYRPWLTDLRMDKPYQL 178

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
            + +E L  + S  G  A  R F E +  LRF+I  +++ +        D+D  VRK A+
Sbjct: 179 DDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLAIEPTLNMLQDADGAVRKQAS 238

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           + L+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADS+HLSN VE  V++AL ++V+
Sbjct: 239 EVLAKTFTANLRTFTLITNTLAKDKEISDRWRGFKDIADSQHLSNRVEREVVDALAKAVE 298

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           + YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P+M
Sbjct: 299 DAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETPQALIPWDEARETVLSAYGNFAPEM 358

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           + IA KFF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGHG+
Sbjct: 359 ADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGHGV 418

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VL+  +QG L  ++ LTLAETAS+FGE LTF  LL+    K ERK +LA K EDM+N+
Sbjct: 419 HQVLAG-SQGALMASTPLTLAETASVFGEMLTFRLLLERTRDKRERKAMLAQKAEDMINT 477

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           +VRQI+FY FE ++HTERR+ G++ + RI EIW++ Q+ESLG A  L+   Y +FW  +P
Sbjct: 478 VVRQIAFYQFERRVHTERRA-GELTSERIGEIWMDVQRESLGDAVRLNP-GYETFWTYIP 535

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY  +L+AG +KH+ ELL P  ++
Sbjct: 536 HFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLD 594

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
            SDP FW +GL  +E +ID++E M
Sbjct: 595 ASDPGFWNKGLSVIEGIIDELEAM 618


>gi|254711950|ref|ZP_05173761.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella ceti
           M644/93/1]
 gi|254715020|ref|ZP_05176831.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella ceti
           M13/05/1]
 gi|261216723|ref|ZP_05931004.1| pepF/M3 family oligoendopeptidase [Brucella ceti M13/05/1]
 gi|261319590|ref|ZP_05958787.1| pepF/M3 family oligoendopeptidase [Brucella ceti M644/93/1]
 gi|260921812|gb|EEX88380.1| pepF/M3 family oligoendopeptidase [Brucella ceti M13/05/1]
 gi|261292280|gb|EEX95776.1| pepF/M3 family oligoendopeptidase [Brucella ceti M644/93/1]
          Length = 620

 Score =  622 bits (1604), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 301/624 (48%), Positives = 418/624 (66%), Gaps = 7/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K+  Y F S+A  R     +       + +LGNLP WNL DLYP+ DS ++++D++    
Sbjct: 2   KFMVYRFSSDAILRA---PAADAIAAKKHDLGNLPEWNLADLYPAPDSPQLASDLKKAMQ 58

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           +S+ F+ RW+G LA    + N  +L  AI E+E + EL+GRI SYA L Y  + + P   
Sbjct: 59  DSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGSYAGLYYYGDTTDPKRM 118

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           K + D   KL D    LIFF LE+N +D+ +LE++  ++P    Y  W+ ++R  K + L
Sbjct: 119 KLFGDAQQKLTDASTPLIFFTLELNRIDDTVLEKAMNENPAIGHYRPWLTDLRMDKPYQL 178

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
            + +E L  + S  G  A  R F E +  LRF+I  +++ +        D+D  VRK A+
Sbjct: 179 DDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLAIEPTLNMLQDADGAVRKQAS 238

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           +AL+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADS+HLSN VE  V++AL ++V+
Sbjct: 239 EALAKTFTANLRTFTLITNTLAKDKEISDRWRGFKDIADSQHLSNRVEREVVDALAKAVE 298

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           + YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P+M
Sbjct: 299 DAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETPQALIPWDEARETVLSAYGNFAPEM 358

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           + IA KFF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGHG+
Sbjct: 359 ADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGHGV 418

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VL+  +QG L  ++ LTLAETAS+FGE LTF  LL+    K ERK +LA K EDM+N+
Sbjct: 419 HQVLAG-SQGALMASTPLTLAETASVFGEMLTFRLLLERTRDKRERKAMLAQKAEDMINT 477

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           +VRQI+FY FE ++HTERR+ G++ + RI EIW++ Q+ESLG A  L+   Y +FW  +P
Sbjct: 478 VVRQIAFYQFERRVHTERRA-GELTSERIGEIWMDVQRESLGDAVRLNP-GYETFWTYIP 535

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY  +L+AG +KH+ ELL P  ++
Sbjct: 536 HFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLD 594

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
            SDP FW +GL  +E +ID++E M
Sbjct: 595 ASDPGFWNKGLSVIEGIIDELEAM 618


>gi|62317040|ref|YP_222893.1| PepF, oligoendopeptidase F [Brucella abortus bv. 1 str. 9-941]
 gi|83269034|ref|YP_418325.1| peptidase M3 [Brucella melitensis biovar Abortus 2308]
 gi|189022307|ref|YP_001932048.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella
           abortus S19]
 gi|254691476|ref|ZP_05154730.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella
           abortus bv. 6 str. 870]
 gi|254695228|ref|ZP_05157056.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella
           abortus bv. 3 str. Tulya]
 gi|254698327|ref|ZP_05160155.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|254731770|ref|ZP_05190348.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella
           abortus bv. 4 str. 292]
 gi|256256661|ref|ZP_05462197.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella
           abortus bv. 9 str. C68]
 gi|260544276|ref|ZP_05820097.1| neutral zinc metallopeptidase [Brucella abortus NCTC 8038]
 gi|260757096|ref|ZP_05869444.1| pepF/M3 family oligoendopeptidase [Brucella abortus bv. 6 str. 870]
 gi|260759534|ref|ZP_05871882.1| pepF/M3 family oligoendopeptidase [Brucella abortus bv. 4 str. 292]
 gi|260762778|ref|ZP_05875110.1| pepF/M3 family oligoendopeptidase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260882905|ref|ZP_05894519.1| pepF/M3 family oligoendopeptidase [Brucella abortus bv. 9 str. C68]
 gi|261215590|ref|ZP_05929871.1| pepF/M3 family oligoendopeptidase [Brucella abortus bv. 3 str.
           Tulya]
 gi|297250016|ref|ZP_06933717.1| oligoendopeptidase F [Brucella abortus bv. 5 str. B3196]
 gi|62197233|gb|AAX75532.1| PepF, oligoendopeptidase F [Brucella abortus bv. 1 str. 9-941]
 gi|82939308|emb|CAJ12246.1| Peptidase M3:Neutral zinc metallopeptidases, zinc-binding region
           [Brucella melitensis biovar Abortus 2308]
 gi|189020881|gb|ACD73602.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella
           abortus S19]
 gi|260097547|gb|EEW81421.1| neutral zinc metallopeptidase [Brucella abortus NCTC 8038]
 gi|260669852|gb|EEX56792.1| pepF/M3 family oligoendopeptidase [Brucella abortus bv. 4 str. 292]
 gi|260673199|gb|EEX60020.1| pepF/M3 family oligoendopeptidase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260677204|gb|EEX64025.1| pepF/M3 family oligoendopeptidase [Brucella abortus bv. 6 str. 870]
 gi|260872433|gb|EEX79502.1| pepF/M3 family oligoendopeptidase [Brucella abortus bv. 9 str. C68]
 gi|260917197|gb|EEX84058.1| pepF/M3 family oligoendopeptidase [Brucella abortus bv. 3 str.
           Tulya]
 gi|297173885|gb|EFH33249.1| oligoendopeptidase F [Brucella abortus bv. 5 str. B3196]
          Length = 620

 Score =  622 bits (1604), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 301/624 (48%), Positives = 418/624 (66%), Gaps = 7/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K+  Y F S+A  R     +       + +LGNLP WNL DLYP+ DS ++++++E    
Sbjct: 2   KFMVYRFSSDAILRA---PAADAIAAKKHDLGNLPEWNLADLYPAPDSPQLASNLEKAMQ 58

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           +S+ F+ RW+G LA    + N  +L  AI E+E + EL+GRI SYA L Y  + + P   
Sbjct: 59  DSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGSYAGLYYYGDTTDPKRM 118

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           K + D   KL D    LIFF LE+N +D+ +LE++  ++P    Y  W+ ++R  K + L
Sbjct: 119 KLFGDAQQKLTDASTPLIFFTLELNRIDDTVLEKAMNENPAIGHYRPWLTDLRMDKPYQL 178

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
            + +E L  + S  G  A  R F E +  LRF+I  +++ +        D+D  VRK A+
Sbjct: 179 DDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLAIEPTLNMLQDADGAVRKQAS 238

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           +AL+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADS+HLSN VE  V++AL ++V+
Sbjct: 239 EALAKTFTANLRTFTLITNTLAKDKEISDRWRGFKDIADSQHLSNRVEREVVDALAKAVE 298

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           + YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P+M
Sbjct: 299 DAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETPQALIPWDEARETVLSAYGNFAPEM 358

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           + IA KFF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGHG+
Sbjct: 359 ADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGHGV 418

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VL+  +QG L  ++ LTLAETAS+FGE LTF  LL+    K ERK +LA K EDM+N+
Sbjct: 419 HQVLAG-SQGALMASTPLTLAETASVFGEMLTFRLLLERTRDKRERKAMLAQKAEDMINT 477

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           +VRQI+FY FE ++HTERR+ G++ + RI EIW++ Q+ESLG A  L+   Y +FW  +P
Sbjct: 478 VVRQIAFYQFERRVHTERRA-GELTSERIGEIWMDVQRESLGDAVRLNP-GYETFWTYIP 535

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY  +L+AG +KH+ ELL P  ++
Sbjct: 536 HFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLD 594

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
            SDP FW +GL  +E +ID++E M
Sbjct: 595 ASDPGFWNKGLSVIEGIIDELEAM 618


>gi|239834491|ref|ZP_04682819.1| oligoendopeptidase, pepF/M3 family [Ochrobactrum intermedium LMG
           3301]
 gi|239822554|gb|EEQ94123.1| oligoendopeptidase, pepF/M3 family [Ochrobactrum intermedium LMG
           3301]
          Length = 712

 Score =  622 bits (1604), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 305/626 (48%), Positives = 421/626 (67%), Gaps = 8/626 (1%)

Query: 1   MTKYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECI 60
           MT++ +  FF+NA    A  ++     D    LGNLP WNL DLYPS DS E+ ND+E  
Sbjct: 93  MTRFSESVFFNNASHAPAGDAAAAEKAD----LGNLPEWNLGDLYPSADSPELKNDIEKA 148

Query: 61  EHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPT 120
             ++ AF+ RW+G L     + N  +   AI E+E + EL+GRI S+A L Y  + + P 
Sbjct: 149 MKDAAAFEERWKGKLGDEAAKPNGGNFADAIKEFEALDELMGRIGSFAGLYYYGDTTDPK 208

Query: 121 IRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKH 180
             K + D   KL D    LIFF LE+N +D+A+LE++   +     Y  W+ ++R  K +
Sbjct: 209 RMKLFGDTQQKLTDASTHLIFFGLELNRIDDAVLEKAMNDNAAIGHYRPWLTDLRLDKPY 268

Query: 181 LLSNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKS 240
            L + +E L  + S  G  A  R F E +  LRF+I+ +++ +        D+D  VR+ 
Sbjct: 269 QLDDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIDGKELSIEPTLNMLQDADGAVRRK 328

Query: 241 AAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQS 300
           A++AL+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADSRHL+N VE  V++AL ++
Sbjct: 329 ASEALAKTFAANLRTFTLITNTLAKDKEISDRWRGFQDIADSRHLANRVERDVVDALAKA 388

Query: 301 VKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSP 360
           V++ YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P
Sbjct: 389 VEDAYPRLSHRYYALKAKWLGLERLENWDRNAPLPETPQALIPWDDARETVLSAYGNFAP 448

Query: 361 QMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGH 420
           +M+ IA+KFF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGH
Sbjct: 449 EMAEIAKKFFDKNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGH 508

Query: 421 GIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDML 480
           G+H VL+  +QG L  ++ LTLAETAS+FGE LTF SLL A   K ERK +LA K EDM+
Sbjct: 509 GVHQVLAG-SQGALMASTPLTLAETASVFGEMLTFRSLLAATQDKRERKAMLAQKAEDMI 567

Query: 481 NSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMM 540
           N++VRQI+FY FE ++HTERR  G++   RI EIW++ Q+ESLG A +L+   Y +FW  
Sbjct: 568 NTVVRQIAFYQFERRVHTERRE-GELTAERIGEIWMDVQRESLGDAVNLNP-GYETFWTY 625

Query: 541 VPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLN 600
           +PHFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY ++L+AG +KH+ ELL P  
Sbjct: 626 IPHFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFDMLKAGGTKHHKELLAPFG 684

Query: 601 INLSDPNFWERGLQTVEKMIDDVEKM 626
           ++ SDP+FW +GL  +E +ID++E M
Sbjct: 685 LDASDPDFWSKGLSVIEGIIDELEAM 710


>gi|17988356|ref|NP_540989.1| oligoendopeptidase F [Brucella melitensis bv. 1 str. 16M]
 gi|17984133|gb|AAL53253.1| oligoendopeptidase f [Brucella melitensis bv. 1 str. 16M]
          Length = 607

 Score =  622 bits (1603), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 296/597 (49%), Positives = 409/597 (68%), Gaps = 4/597 (0%)

Query: 30  QENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGA 89
           + +LGNLP WNL DLYP+ DS ++++D+E    +S+ F+ RW+G LA    + N  +L  
Sbjct: 13  KHDLGNLPEWNLADLYPAPDSPQLASDLEKAMQDSVRFEERWKGKLADEAAKPNGGNLAE 72

Query: 90  AIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTL 149
           AI E+E + EL+GRI SYA L Y  + + P   K + D   KL D    LIFF LE+N +
Sbjct: 73  AIREFEALSELMGRIGSYAGLYYYGDTTDPKRMKLFGDAQQKLTDASTPLIFFTLELNCI 132

Query: 150 DEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENI 209
           D+ +LE++  ++P    Y  W+ ++R  K + L + +E L  + S  G  A  R F E +
Sbjct: 133 DDTVLEKAMNENPAIGHYRPWLTDLRMDKPYQLDDKLEQLFHEKSITGYSAWNRLFDETM 192

Query: 210 ESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEI 269
             LRF+I  +++ +        D+D  VRK A++AL+ TF  +   F+ ITNTLAKD+EI
Sbjct: 193 SGLRFEIGGEQLAIEPTLNMLQDADGAVRKQASEALAKTFTANLRTFTLITNTLAKDKEI 252

Query: 270 QDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWD 329
            DRWR ++ IADS+HLSN VE  V++AL ++V++ YP+ SHRYY LK KWL L+ +  WD
Sbjct: 253 SDRWRGFKDIADSQHLSNRVEREVVDALAKAVEDAYPRLSHRYYALKAKWLDLEKLENWD 312

Query: 330 RLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFA 389
           R APLP T Q +IP++ AR+ VL +Y  F+P+M+ IA KFF  NWIDAP   GK  GAFA
Sbjct: 313 RNAPLPETPQALIPWDEARETVLSAYGNFAPEMADIARKFFDRNWIDAPVRPGKAPGAFA 372

Query: 390 HGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIF 449
           H T+PS HPY+LLNY+GKP+DVMTLAHELGHG+H VL+  +QG L  ++ LTLAETAS+F
Sbjct: 373 HPTVPSAHPYVLLNYMGKPRDVMTLAHELGHGVHQVLAG-SQGALMASTPLTLAETASVF 431

Query: 450 GETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTH 509
           GE LTF  LL+    K ERK +LA K EDM+N++VRQI+FY FE ++HTERR+ G++ + 
Sbjct: 432 GEMLTFRLLLERTRDKRERKAMLAQKAEDMINTVVRQIAFYQFERRVHTERRA-GELTSE 490

Query: 510 RINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYK 569
           RI EIW++ Q+ESLG A  L+   Y +FW  +PHFI S FYVYAYAFG+CLVNSLY +Y+
Sbjct: 491 RIGEIWMDVQRESLGDAVRLNP-GYETFWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQ 549

Query: 570 SNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            N+   F++KY  +L+AG +KH+ ELL P  ++ SDP FW +GL  +E +ID++E M
Sbjct: 550 -NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLDASDPGFWNKGLSVIEGIIDELEAM 605


>gi|237816603|ref|ZP_04595595.1| oligoendopeptidase, pepF/M3 family [Brucella abortus str. 2308 A]
 gi|237787416|gb|EEP61632.1| oligoendopeptidase, pepF/M3 family [Brucella abortus str. 2308 A]
          Length = 678

 Score =  621 bits (1602), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 301/624 (48%), Positives = 418/624 (66%), Gaps = 7/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K+  Y F S+A  R     +       + +LGNLP WNL DLYP+ DS ++++++E    
Sbjct: 60  KFMVYRFSSDAILRA---PAADAIAAKKHDLGNLPEWNLADLYPAPDSPQLASNLEKAMQ 116

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           +S+ F+ RW+G LA    + N  +L  AI E+E + EL+GRI SYA L Y  + + P   
Sbjct: 117 DSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGSYAGLYYYGDTTDPKRM 176

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           K + D   KL D    LIFF LE+N +D+ +LE++  ++P    Y  W+ ++R  K + L
Sbjct: 177 KLFGDAQQKLTDASTPLIFFTLELNRIDDTVLEKAMNENPAIGHYRPWLTDLRMDKPYQL 236

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
            + +E L  + S  G  A  R F E +  LRF+I  +++ +        D+D  VRK A+
Sbjct: 237 DDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLAIEPTLNMLQDADGAVRKQAS 296

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           +AL+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADS+HLSN VE  V++AL ++V+
Sbjct: 297 EALAKTFTANLRTFTLITNTLAKDKEISDRWRGFKDIADSQHLSNRVEREVVDALAKAVE 356

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           + YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P+M
Sbjct: 357 DAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETPQALIPWDEARETVLSAYGNFAPEM 416

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           + IA KFF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGHG+
Sbjct: 417 ADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGHGV 476

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VL+  +QG L  ++ LTLAETAS+FGE LTF  LL+    K ERK +LA K EDM+N+
Sbjct: 477 HQVLAG-SQGALMASTPLTLAETASVFGEMLTFRLLLERTRDKRERKAMLAQKAEDMINT 535

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           +VRQI+FY FE ++HTERR+ G++ + RI EIW++ Q+ESLG A  L+   Y +FW  +P
Sbjct: 536 VVRQIAFYQFERRVHTERRA-GELTSERIGEIWMDVQRESLGDAVRLNP-GYETFWTYIP 593

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY  +L+AG +KH+ ELL P  ++
Sbjct: 594 HFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLD 652

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
            SDP FW +GL  +E +ID++E M
Sbjct: 653 ASDPGFWNKGLSVIEGIIDELEAM 676


>gi|327188780|gb|EGE55974.1| oligoendopeptidase F protein [Rhizobium etli CNPAF512]
          Length = 779

 Score =  621 bits (1601), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 292/594 (49%), Positives = 404/594 (68%), Gaps = 4/594 (0%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           LG+LP W L+DLYPS  S     DME     ++AF+ RW+G LA A  +     +GAA+ 
Sbjct: 187 LGDLPVWKLQDLYPSATSTAFVADMEKAGKAAIAFEQRWKGKLADAATKAGAEGIGAALK 246

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
           EYE + +++GR+ S+A L+Y  + ++P   K Y D+ AK+ +F   L+FFALE+N +D+ 
Sbjct: 247 EYEALDDIMGRLGSFAGLTYFSDTTNPANGKLYGDVQAKITEFSGHLLFFALELNRIDDT 306

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
           +++ S A DP    Y  W+ ++RK K + L + +E L  + S     A  R F E +  L
Sbjct: 307 VIDASIANDPDAGHYRPWLIDLRKDKPYQLDDRLEQLFLEKSMTSAAAFNRLFDETMAEL 366

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           R++I+  K+PL  A     + D EVR+ AA AL+ TF  +  IF+ ITNTLAKD++I DR
Sbjct: 367 RYEIDGAKVPLEVALNMLQEKDPEVRRKAAMALAETFKANIRIFTLITNTLAKDKDISDR 426

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR +E IADSRHL+N VE  V++AL  +V+  YP+ SHRYY++K KWL ++ M FWDR A
Sbjct: 427 WRGFEDIADSRHLANRVEREVVDALAAAVREAYPRLSHRYYKMKAKWLGMEQMNFWDRNA 486

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP TS  +I +  A+D VL +Y  F+P+M+ IA +FF   WIDAP   GK  GAFAH T
Sbjct: 487 PLPETSSAVISWSDAKDTVLSAYGNFAPEMADIARRFFDEQWIDAPVRPGKAPGAFAHPT 546

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +PS HPY+L+NY+GKP+DVMTLAHELGHG+H VL+   QG L   + LTLAETAS+FGE 
Sbjct: 547 VPSAHPYVLVNYMGKPRDVMTLAHELGHGVHQVLAG-AQGALMCQTPLTLAETASVFGEM 605

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF +LL+  +   ERK +LA K+EDM+N++VRQI+FY+FE KLHT R+S G++    I 
Sbjct: 606 LTFRALLEKTTDSRERKAMLAQKVEDMINTVVRQIAFYEFERKLHTARKS-GELTADDIG 664

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
           E+WL  Q ESLGPA  +S+  Y ++W  +PHFI S FYVYAYAFG+CLVNSLY +Y+   
Sbjct: 665 ELWLSVQSESLGPAISISE-GYETYWAYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQ-KA 722

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              F+EKY  +L+AG +KH+SELL P  ++ +DP+FW  GL  +E +ID++E +
Sbjct: 723 EKGFQEKYFELLKAGGTKHHSELLKPFGLDATDPSFWSHGLSMIEGLIDELEAL 776


>gi|110635064|ref|YP_675272.1| pepF/M3 family oligoendopeptidase [Mesorhizobium sp. BNC1]
 gi|110286048|gb|ABG64107.1| oligoendopeptidase, pepF/M3 family [Chelativorans sp. BNC1]
          Length = 616

 Score =  621 bits (1601), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 303/597 (50%), Positives = 399/597 (66%), Gaps = 4/597 (0%)

Query: 30  QENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGA 89
           + +LG LP WNL DLYPS DS E S D+     E+ AF+  W+G LA    +     LG 
Sbjct: 21  KADLGALPEWNLADLYPSMDSTEFSEDLARAAREATAFEQNWKGRLAEEAGKGTSGRLGE 80

Query: 90  AIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTL 149
           A+ EYE + EL GRI SYA L Y  + S P   KFY D+  KL D    L+FF LE+N +
Sbjct: 81  AVREYEALDELFGRIGSYAGLLYTGDTSDPKRAKFYGDVQEKLTDASTHLLFFTLELNKI 140

Query: 150 DEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENI 209
           D+AL+E +   DP+   Y  W+ +IRK + H L + +E L  ++   GR A  R F E +
Sbjct: 141 DDALIEAAMKDDPIFGHYRPWVLDIRKYRPHQLEDSIERLFHESDVTGRGAWNRLFDETM 200

Query: 210 ESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEI 269
             LRF ++ +++ L        D D E R+ AA AL+ T   +  +F+ ITNTLAKD+EI
Sbjct: 201 TGLRFDVDGEELTLEPTLNLMQDPDGEKRRKAAAALAVTLKDNMRLFTLITNTLAKDKEI 260

Query: 270 QDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWD 329
            DRWR +  +ADSRHLSN VE  V+EAL  SV   +P+ SHRYY +K KWL ++ +  WD
Sbjct: 261 SDRWRNFADVADSRHLSNRVEREVVEALAASVCAAFPRISHRYYAMKAKWLGMEKLNHWD 320

Query: 330 RLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFA 389
           R APLP T Q +I ++ A++ VL +YA F+P+M+ IA+ FF  NWIDAP   GK  GAFA
Sbjct: 321 RNAPLPETPQSVIGWDEAKETVLSAYASFAPEMADIAKHFFDRNWIDAPVRPGKSPGAFA 380

Query: 390 HGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIF 449
           H T+PSVHPY++LNY+GKP+DVMTLAHELGHG+H VL++  QG L   + LTLAETAS+F
Sbjct: 381 HPTVPSVHPYVMLNYMGKPRDVMTLAHELGHGVHQVLAA-GQGSLMAATPLTLAETASVF 439

Query: 450 GETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTH 509
           GE LTF SLL   + K ERK +LA K EDM+N++VRQI+FY+FE K+HTERR  G++   
Sbjct: 440 GEMLTFRSLLARTTDKRERKAMLAQKAEDMINTVVRQIAFYEFERKVHTERRQ-GELTAD 498

Query: 510 RINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYK 569
           RI EIWLE Q ESLGPA  L +  Y +FW  +PHFI S FYVYAYAFG+CLVNSL+ +Y+
Sbjct: 499 RIGEIWLEVQAESLGPAIALRE-GYETFWAYIPHFIHSPFYVYAYAFGDCLVNSLFAVYQ 557

Query: 570 SNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
                 F+EKY  +L+AG +KH+SELL P  ++ SDP FW +GL  +E +ID++E +
Sbjct: 558 -QAEKGFQEKYFEMLKAGGTKHHSELLAPFGLDASDPAFWTKGLSVIESLIDELEAL 613


>gi|23499848|ref|NP_699288.1| oligoendopeptidase F [Brucella suis 1330]
 gi|161620171|ref|YP_001594057.1| pepF/M3 family oligoendopeptidase [Brucella canis ATCC 23365]
 gi|254702515|ref|ZP_05164343.1| pepF/M3 family oligoendopeptidase [Brucella suis bv. 3 str. 686]
 gi|260568579|ref|ZP_05839048.1| neutral zinc metallopeptidase [Brucella suis bv. 4 str. 40]
 gi|261753088|ref|ZP_05996797.1| pepF/M3 family oligoendopeptidase [Brucella suis bv. 3 str. 686]
 gi|23463419|gb|AAN33293.1| oligoendopeptidase F [Brucella suis 1330]
 gi|161336982|gb|ABX63286.1| oligoendopeptidase, pepF/M3 family [Brucella canis ATCC 23365]
 gi|260155244|gb|EEW90325.1| neutral zinc metallopeptidase [Brucella suis bv. 4 str. 40]
 gi|261742841|gb|EEY30767.1| pepF/M3 family oligoendopeptidase [Brucella suis bv. 3 str. 686]
          Length = 620

 Score =  621 bits (1601), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 301/624 (48%), Positives = 417/624 (66%), Gaps = 7/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K+  Y F S+A  R     +       + +LGNLP WNL DLYP+ DS ++++D+E    
Sbjct: 2   KFMVYRFSSDAILRA---PAADAIAAKKHDLGNLPEWNLADLYPAPDSPQLASDLEKAMQ 58

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           +S+ F+ RW+G LA    + N  +L  AI E+E + EL+GRI SYA L Y  + + P   
Sbjct: 59  DSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGSYAGLYYYGDTTDPKRM 118

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           K + D   KL D    LIFF LE+N +D+ +LE++  ++P    Y  W+ ++R  K + L
Sbjct: 119 KLFGDAQQKLTDASTPLIFFTLELNRIDDTVLEKAMNENPAIGHYRPWLTDLRMDKPYQL 178

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
            + +E L  + S  G  A  R F E +  LRF+I  +++ +        D+D  VRK A+
Sbjct: 179 DDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLAIEPTLNMLQDADGAVRKQAS 238

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           +AL+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADS+HLSN VE  V++AL ++V+
Sbjct: 239 EALAKTFTANLRTFTLITNTLAKDKEISDRWRGFKDIADSQHLSNRVEREVVDALAKAVE 298

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           + YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P+M
Sbjct: 299 DAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETPQALIPWDEARETVLSAYGNFAPEM 358

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           + IA KFF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP +VMTLAHELGHG+
Sbjct: 359 ADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPHNVMTLAHELGHGV 418

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VL+  +QG L  ++ LTLAETAS+FGE LTF  LL+    K ERK +LA K EDM+N+
Sbjct: 419 HQVLAG-SQGALMASTPLTLAETASVFGEMLTFRLLLERTRDKRERKAMLAQKAEDMINT 477

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           +VRQI+FY FE ++HTERR+ G++ + RI EIW++ Q+ESLG A  L+   Y +FW  +P
Sbjct: 478 VVRQIAFYQFERRVHTERRA-GELTSERIGEIWMDVQRESLGDAVRLNP-GYETFWTYIP 535

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY  +L+AG +KH+ ELL P  ++
Sbjct: 536 HFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLD 594

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
            SDP FW +GL  +E +ID++E M
Sbjct: 595 ASDPGFWNKGLSVIEGIIDELEAM 618


>gi|15966549|ref|NP_386902.1| putative oligoendopeptidase F protein [Sinorhizobium meliloti 1021]
 gi|307300414|ref|ZP_07580194.1| oligoendopeptidase, pepF/M3 family [Sinorhizobium meliloti BL225C]
 gi|307318279|ref|ZP_07597714.1| oligoendopeptidase, pepF/M3 family [Sinorhizobium meliloti AK83]
 gi|15075820|emb|CAC47375.1| Putative oligoendopeptidase F [Sinorhizobium meliloti 1021]
 gi|306895961|gb|EFN26712.1| oligoendopeptidase, pepF/M3 family [Sinorhizobium meliloti AK83]
 gi|306904580|gb|EFN35164.1| oligoendopeptidase, pepF/M3 family [Sinorhizobium meliloti BL225C]
          Length = 627

 Score =  621 bits (1601), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 298/606 (49%), Positives = 404/606 (66%), Gaps = 5/606 (0%)

Query: 21  SSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
            +D  T    E LG LP W L DLY S  S+E  +D+   E +++AF+ +W+G L  A  
Sbjct: 24  GADQATAAPTE-LGELPSWRLTDLYLSPSSEEFRSDLAKAEADAIAFEAKWKGKLKEAAG 82

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
           +     +GAA+ E+E + +L+GRIAS+A L+Y  + S+P   K Y D+ +KL D    L+
Sbjct: 83  RTGDQGIGAAVKEFEALDDLMGRIASFAGLTYFSDTSNPANGKLYGDVQSKLTDISAHLL 142

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           FF+LE+N +D+ +++ +   D L   Y  WI ++RK K + L + +E L  + S  G  A
Sbjct: 143 FFSLELNRIDDKVIDDALTTDSLAAHYRPWILDLRKDKPYQLDDRLEQLFLEKSMTGANA 202

Query: 201 LKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFIT 260
             R F E I SL F ++ ++ PL        D   EVRK AA AL+ TF  +   F+ +T
Sbjct: 203 FNRLFDETIASLTFSVDGKEQPLEVTLNLLQDPSVEVRKKAALALAETFKANIRTFTLVT 262

Query: 261 NTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWL 320
           NTLAKD+EI DRWR +E IADSRHL+N VE  V++AL  SVK  YP+ SHRYY +K KWL
Sbjct: 263 NTLAKDKEISDRWRGFEDIADSRHLANRVEREVVDALAASVKAAYPRLSHRYYAMKAKWL 322

Query: 321 KLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQY 380
            ++ M FWDR APLP T   +IP+  ARD VL +Y  F+P+M+ IA +FF   WIDAP  
Sbjct: 323 GMEQMDFWDRNAPLPETPNALIPWNEARDTVLSAYHAFAPEMAAIARRFFDDGWIDAPVR 382

Query: 381 DGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSL 440
            GK  GAFAH T+PSVHPY+L+NY+GKP+DVMTLAHELGHG+H VL+   QG L  ++ L
Sbjct: 383 PGKAPGAFAHPTVPSVHPYVLVNYMGKPRDVMTLAHELGHGVHQVLAG-AQGALMASTPL 441

Query: 441 TLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTER 500
           TLAETAS+FGE LTF +LL     K ERK +LA K+EDM+N++VRQI+FYDFE K+HT R
Sbjct: 442 TLAETASVFGEMLTFRALLDRTKDKRERKAMLAQKVEDMINTVVRQIAFYDFERKVHTAR 501

Query: 501 RSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCL 560
           +  G++    +  IWL  Q ESLGPA  LS+  Y ++W  +PHFI S FYVYAYAFG+CL
Sbjct: 502 KE-GELTAEDLGRIWLSVQSESLGPAIRLSE-SYETYWAYIPHFIHSPFYVYAYAFGDCL 559

Query: 561 VNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMI 620
           VNSLY +Y+ N    F+EKY  +L+AG +KH+SELL P  ++ +DP+FW +GL  +E +I
Sbjct: 560 VNSLYAVYQ-NAERGFQEKYFEMLKAGGTKHHSELLAPFGLDATDPSFWAQGLSMIEGLI 618

Query: 621 DDVEKM 626
           D++E +
Sbjct: 619 DELEAL 624


>gi|86359140|ref|YP_471032.1| oligoendopeptidase F protein [Rhizobium etli CFN 42]
 gi|86283242|gb|ABC92305.1| oligoendopeptidase F protein [Rhizobium etli CFN 42]
          Length = 699

 Score =  620 bits (1599), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 290/594 (48%), Positives = 408/594 (68%), Gaps = 4/594 (0%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           LG+LP W L+DLYPS  S     DME     ++AF+ +W+G LA A        +GAA+ 
Sbjct: 107 LGDLPVWKLQDLYPSATSTAFVADMEKAGKAAIAFEEKWKGKLAEAAVMTGAEGIGAALK 166

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
           EYE + +++GR+ S+A L+Y  + ++P   K Y D+ AK+ +F   L+FFALE+N +D+A
Sbjct: 167 EYEALDDIMGRLGSFAGLTYFSDTTNPANGKLYGDVQAKITEFSGHLLFFALELNRIDDA 226

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
           +++   A+DP    Y  W+ ++RK K + L + +E L  + S     A  R F E +  L
Sbjct: 227 VIDACMAKDPDAGHYRPWLIDLRKDKPYQLDDRLEQLFLEKSMTSASAFNRLFDETMAEL 286

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           R++I+ +K+PL  A     + D EVR+ AA AL+ TF  +  IF+ ITNTLAKD++I DR
Sbjct: 287 RYEIDGEKVPLEVALNMLQEKDPEVRRKAAMALAETFKANIRIFTLITNTLAKDKDISDR 346

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR +E IADSRHL+N VE  V++AL  +V+  YP+ SHRYY++K KWL ++ M FWDR A
Sbjct: 347 WRGFEDIADSRHLANRVEREVVDALAAAVREAYPRLSHRYYKMKAKWLGMEQMNFWDRNA 406

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP TS  +I +  A+D VL +Y  F+ +M+ IA +FF   WIDAP   GK  GAFAH T
Sbjct: 407 PLPETSSAVISWSDAKDTVLSAYGNFAAEMADIARRFFDEQWIDAPVRPGKAPGAFAHPT 466

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +PS HPY+L+NY+GKP+DVMTLAHELGHG+H VL+   QG L   + LTLAETAS+FGE 
Sbjct: 467 VPSAHPYVLVNYMGKPRDVMTLAHELGHGVHQVLAG-AQGALMCQTPLTLAETASVFGEM 525

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF +LL+  + + ERK +LA K+EDM+N++VRQI+FY+FE KLHT R++ G++    I 
Sbjct: 526 LTFRALLEKTTDRRERKAMLAQKVEDMINTVVRQIAFYEFERKLHTARKA-GELTAEDIG 584

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
           E+WL  Q ESLGPA ++S+  Y ++W  +PHFI S FYVYAYAFG+CLVNSLY +Y+  T
Sbjct: 585 ELWLSVQSESLGPAINISE-GYETYWAYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQ-KT 642

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              F+EKY  +L+AG +KH+SELL P  ++ +DP+FW +GL  +E +ID++E +
Sbjct: 643 EKGFQEKYFELLKAGGTKHHSELLKPFGLDATDPSFWSQGLSMIEGLIDELETL 696


>gi|148558781|ref|YP_001257157.1| oligoendopeptidase F [Brucella ovis ATCC 25840]
 gi|148370066|gb|ABQ62938.1| oligoendopeptidase F [Brucella ovis ATCC 25840]
          Length = 620

 Score =  620 bits (1599), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 300/624 (48%), Positives = 418/624 (66%), Gaps = 7/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K+  Y F S+A  R     +       + +LGNLP WNL DLYP+ DS ++++D+E    
Sbjct: 2   KFMVYRFSSDAILRA---PAADAIAAKKHDLGNLPEWNLADLYPAPDSPQLASDLEKAMQ 58

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           +S+ F+ RW+G LA    + N  +L  AI E+E + EL+GRI SYA L Y  + + P   
Sbjct: 59  DSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGSYAGLYYYGDTTDPKRM 118

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           K + D   KL D    LIFF LE+N +D+ +LE++  ++P    Y  W+ ++R  K + L
Sbjct: 119 KLFGDAQQKLTDASTPLIFFTLELNRIDDTVLEKAMNENPAIGHYRPWLTDLRMDKPYQL 178

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
            + +E L  + S  G  A  R F E +  L+F+I  +++ +        D+D  VRK A+
Sbjct: 179 DDKLEQLFHEKSITGYSAWNRLFDETMSGLQFEIGGEQLAIEPTLNMLQDADGAVRKQAS 238

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           +AL+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADS+HLSN VE  V++AL ++V+
Sbjct: 239 EALAKTFTANLRTFTLITNTLAKDKEISDRWRGFKDIADSQHLSNRVEREVVDALAKAVE 298

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           + YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P+M
Sbjct: 299 DAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETPQALIPWDEARETVLSAYGNFAPEM 358

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           + IA KFF  NWI+AP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGHG+
Sbjct: 359 ADIARKFFDRNWINAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGHGV 418

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VL+  +QG L  ++ LTLAETAS+FGE LTF  LL+    K ERK +LA K EDM+N+
Sbjct: 419 HQVLAG-SQGALMASTPLTLAETASVFGEMLTFRLLLERTRDKRERKAMLAQKAEDMINT 477

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           +VRQI+FY FE ++HTERR+ G++ + RI EIW++ Q+ESLG A  L+   Y +FW  +P
Sbjct: 478 VVRQIAFYQFERRVHTERRA-GELTSERIGEIWMDVQRESLGDAVRLNP-GYETFWTYIP 535

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY  +L+AG +KH+ ELL P  ++
Sbjct: 536 HFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLD 594

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
            SDP FW +GL  +E +ID++E M
Sbjct: 595 ASDPGFWNKGLSVIEGIIDELEAM 618


>gi|306841140|ref|ZP_07473856.1| oligoendopeptidase, pepF/M3 family [Brucella sp. BO2]
 gi|306288766|gb|EFM60084.1| oligoendopeptidase, pepF/M3 family [Brucella sp. BO2]
          Length = 620

 Score =  619 bits (1597), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 300/624 (48%), Positives = 415/624 (66%), Gaps = 7/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K+  Y F S+A  R     +       + +LGNLP WNL DLYP+ DS +++ D+E    
Sbjct: 2   KFMVYRFSSDAILRA---PAADAIAAKKHDLGNLPEWNLADLYPAPDSPQLAGDLEKAMQ 58

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           +S+ F+ RW+G LA    + N  +L  AI E+E + EL+GRI SYA L Y  + + P   
Sbjct: 59  DSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGSYAGLYYYGDTTDPKRM 118

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           K + D   KL D    LIFF LE+N +D+ +LE++  ++P    Y  W+ ++R  K + L
Sbjct: 119 KLFGDAQQKLTDASTPLIFFTLELNRIDDTVLEKAMNENPAIGHYRPWLTDLRMDKPYQL 178

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
            + +E L  + S  G  A  R F E +  LRF+I  +++ +        D+D  VR+ A+
Sbjct: 179 DDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLAIEPTLNMLQDADGAVRRQAS 238

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           +AL+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADS+HLSN VE  V++AL ++V+
Sbjct: 239 EALAKTFAANLRTFTLITNTLAKDKEISDRWRGFKDIADSQHLSNRVEREVVDALAKAVE 298

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           + YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P+M
Sbjct: 299 DAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETPQALIPWDEARETVLSAYGNFAPEM 358

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           + IA KFF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGH +
Sbjct: 359 ADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGHSV 418

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VL+  +QG L  ++ LTLAETAS+FGE LTF  LL+    K ERK +LA K EDM+N+
Sbjct: 419 HQVLAG-SQGALMASTPLTLAETASVFGEMLTFRLLLERTRDKRERKAMLAQKAEDMINT 477

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           +VRQI+FY FE ++HTERR+ G++ + RI EIW+  Q+ESLG A  L+   Y +FW  +P
Sbjct: 478 VVRQIAFYQFERRVHTERRA-GELTSERIGEIWMNVQRESLGDAVRLNP-GYETFWTYIP 535

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY  +L+AG +KH+ ELL P  ++
Sbjct: 536 HFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLD 594

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
            SDP FW +GL  +E +ID++E M
Sbjct: 595 ASDPGFWNKGLSVIEGIIDELEAM 618


>gi|222087066|ref|YP_002545601.1| oligoendopeptidase F protein [Agrobacterium radiobacter K84]
 gi|221724514|gb|ACM27670.1| oligoendopeptidase F protein [Agrobacterium radiobacter K84]
          Length = 618

 Score =  619 bits (1596), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 287/594 (48%), Positives = 407/594 (68%), Gaps = 4/594 (0%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           LG+LP W L DLYPS  S   + DME     ++AF+ +W+G LA A  +     +GAA+ 
Sbjct: 25  LGDLPAWKLSDLYPSATSTAFTGDMEKAGKLAVAFEEKWKGKLAEAATKSGDAGIGAALK 84

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
           EYE + ++IGR+ S+A L+Y  N S P   K Y D+  +L D+   L+FF LE+N +D+A
Sbjct: 85  EYEALDDIIGRLGSFAGLTYFSNTSDPANGKLYGDVQTRLTDYAAHLLFFPLELNRIDDA 144

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
           +++   A DP    Y  W+ ++RK K + L + +E L  + S     A  R F E +  L
Sbjct: 145 VMDACMANDPTAGHYRPWLVDLRKDKPYQLDDRLEQLFLEKSMTSAAAFNRLFDETMAEL 204

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           RF+++ +K+PL        + D EVR+ AA+AL+ TF  +  +F+ ITNTLAKD++I DR
Sbjct: 205 RFEVDGEKLPLEVTLNMLQEKDPEVRRKAAEALTTTFKANLRVFTLITNTLAKDKDIADR 264

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR +E IADSRHL+N VE  V++AL  +V++ YP+ SHRYY++K KWL ++ M FWDR A
Sbjct: 265 WRGFEDIADSRHLANRVEREVVDALAAAVRDAYPRLSHRYYKMKAKWLGMEQMNFWDRNA 324

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP +S  +IP+  A++ VL +Y  F+P+M+ IA++FF   WIDAP   GK  GAFAH T
Sbjct: 325 PLPESSNALIPWSEAKETVLSAYGNFAPEMADIAKRFFDEEWIDAPVRPGKAPGAFAHPT 384

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +PS HPY+L+NY+GKP+DVMTLAHELGHG+H VL+   QG L   + LTLAETAS+FGE 
Sbjct: 385 VPSAHPYVLVNYMGKPRDVMTLAHELGHGVHQVLAG-GQGALMCQTPLTLAETASVFGEM 443

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF +LL   + K ERK +LA K+EDM+N++VRQI+FY+FE K+H  R++ G++ +  I 
Sbjct: 444 LTFRALLDKTTDKRERKAMLAQKVEDMINTVVRQIAFYEFERKVHAARKN-GELTSDDIG 502

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
           E+WL  Q ESLGPA  +S+  Y ++W  +PHFI S FYVYAYAFG+CLVNSLY +Y+ N 
Sbjct: 503 ELWLSVQSESLGPAIRISE-GYETYWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQ-NA 560

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + F+ KY  +L+AG +KH+SELL P  ++ +DP+FW +GL  +E +ID++E +
Sbjct: 561 EEGFQAKYFELLKAGGTKHHSELLKPFGLDATDPSFWSKGLSMIEGLIDELEAL 614


>gi|209550872|ref|YP_002282789.1| oligoendopeptidase, pepF/M3 family [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536628|gb|ACI56563.1| oligoendopeptidase, pepF/M3 family [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 617

 Score =  619 bits (1595), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 288/593 (48%), Positives = 403/593 (67%), Gaps = 4/593 (0%)

Query: 34  GNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAE 93
           G+LP W L+DLYPS  S     DME     ++AF+ +W+G LA A  +     +GAA+ E
Sbjct: 26  GDLPVWKLQDLYPSATSTAFVADMEKAGKAAIAFEEKWKGKLADAATKTGTEGIGAALKE 85

Query: 94  YERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEAL 153
           YE + +++GR+ S+A L+Y  + + P   K Y D+  K+ +F   L+FFALE+N +D+A+
Sbjct: 86  YEALDDIMGRLGSFAGLTYFSDTTDPANGKLYGDVQTKITEFSGHLLFFALELNRIDDAV 145

Query: 154 LEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLR 213
           ++ S   DP    Y  W+ ++RK K + L + +E L  + S     A  R F E +  LR
Sbjct: 146 IDASMVNDPAAGHYRPWLVDLRKDKPYQLDDRLEQLFLEKSMTSAAAFNRLFDETMAELR 205

Query: 214 FKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRW 273
           ++I+ +K+PL  A     + D +VR+ AA AL+ TF  +  IF+ ITNTLAKD++I DRW
Sbjct: 206 YEIDGEKVPLEVALNMLQEKDPDVRRKAAMALAATFKANIRIFTLITNTLAKDKDIADRW 265

Query: 274 RKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAP 333
           R +E IADSRHL+N VE  V++AL  +V+  YP+ SHRYY++K KWL ++ M FWDR AP
Sbjct: 266 RGFEDIADSRHLANRVEREVVDALAAAVREAYPRLSHRYYKMKAKWLGMEQMNFWDRNAP 325

Query: 334 LPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTI 393
           LP TS  +I +  A+D VL +Y  F+P+M+ IA +FF   WIDAP   GK  GAFAH T+
Sbjct: 326 LPETSSAVISWPEAKDTVLSAYGNFAPEMADIARRFFDEQWIDAPVRPGKAPGAFAHPTV 385

Query: 394 PSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETL 453
           PS HPY+L+NY+GKP+DVMTLAHELGHG+H VL+   QG L   + LTLAETAS+FGE L
Sbjct: 386 PSAHPYVLVNYMGKPRDVMTLAHELGHGVHQVLAG-AQGALMCQTPLTLAETASVFGEML 444

Query: 454 TFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINE 513
           TF +LL+  S K ERK +LA K+EDM+N++VRQI+FY+FE KLHT R++ G++    I E
Sbjct: 445 TFRALLEKTSDKRERKAMLAQKVEDMINTVVRQIAFYEFERKLHTARKA-GELTADDIGE 503

Query: 514 IWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTV 573
           +WL  Q ESLGPA  +S+  Y ++W  +PHFI S FYVYAYAFG+CLVNSLY +Y+    
Sbjct: 504 LWLSVQSESLGPAISISE-GYETYWAYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQKAET 562

Query: 574 DCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
             F+ KY  +L+AG +KH+SELL P  ++ +DP+FW +GL  +E +ID++E +
Sbjct: 563 -GFQAKYFELLKAGGTKHHSELLKPFGLDATDPSFWSQGLSMIEGLIDELEAL 614


>gi|116253806|ref|YP_769644.1| peptidase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115258454|emb|CAK09557.1| putative peptidase [Rhizobium leguminosarum bv. viciae 3841]
          Length = 618

 Score =  618 bits (1593), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 290/590 (49%), Positives = 399/590 (67%), Gaps = 4/590 (0%)

Query: 37  PRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYER 96
           P W L+DLYPS  S     DME     ++AF+ +W+G L  A  +     +G+A+ EYE 
Sbjct: 29  PVWKLQDLYPSATSTAFVADMEKAGKAAIAFEEKWKGTLTEAAAKTGAEGIGSALKEYEA 88

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQ 156
           + ++IGR+ S+A L+Y  + ++PT  K Y D+ AK+ +F   L+FFALE+N +D+A+++ 
Sbjct: 89  LDDIIGRLGSFAGLTYFSDTTNPTNGKLYGDVQAKITEFSGHLLFFALELNRIDDAVIDA 148

Query: 157 SYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI 216
             A DP    Y  W+ ++RK K + L + +E L  + S     A  R F E +  LR+ I
Sbjct: 149 CMANDPAAGHYRPWLLDLRKDKPYQLDDRLEQLFLEKSMTSAAAFNRLFDETMAELRYDI 208

Query: 217 NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKY 276
           +  K+PL  A     + D EVR+ AA AL+ TF  +   F+ ITNTLAKD+EI DRWR +
Sbjct: 209 DGAKVPLEVALNKLQEKDPEVRRKAAMALAETFKANIRTFTLITNTLAKDKEIADRWRGF 268

Query: 277 EKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPG 336
           E IADSRHL+N VE  V++AL  +V+  YP+ SHRYY++K KWL ++ M FWDR APLP 
Sbjct: 269 EDIADSRHLANRVEREVVDALAAAVREAYPRLSHRYYKMKAKWLGMEQMNFWDRNAPLPE 328

Query: 337 TSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSV 396
           TS  II +  A+D VL +Y  F+P+M+ IA +FF   WIDAP   GK  GAFAH T+PS 
Sbjct: 329 TSSAIISWPEAKDTVLSAYGNFAPEMADIARRFFDEQWIDAPVRAGKAPGAFAHPTVPSA 388

Query: 397 HPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFD 456
           HPY+L+NY+GKP+DVMTLAHELGHG+H VL+   QG L   + LTLAETAS+FGE LTF 
Sbjct: 389 HPYVLVNYMGKPRDVMTLAHELGHGVHQVLAG-AQGALMCQTPLTLAETASVFGEMLTFR 447

Query: 457 SLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWL 516
           +LLQ  +   ERK +LA K+EDM+N++VRQI+FY+FE KLHT R++ G++    I E+WL
Sbjct: 448 ALLQKTTDTRERKAMLAQKVEDMINTVVRQIAFYEFERKLHTARKA-GELTADDIGELWL 506

Query: 517 ETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCF 576
             Q ESLGPA  +S+  Y ++W  +PHFI S FYVYAYAFG+CLVNSLY +Y+      F
Sbjct: 507 SVQSESLGPAISISE-GYETYWAYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQ-KAEKGF 564

Query: 577 KEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           +EKY  +LRAG +KH+SELL P  ++ +DP+FW +GL  +E +ID++E +
Sbjct: 565 QEKYFELLRAGGTKHHSELLKPFGLDATDPSFWSQGLSMIEGLIDELEAL 614


>gi|153011575|ref|YP_001372789.1| pepF/M3 family oligoendopeptidase [Ochrobactrum anthropi ATCC
           49188]
 gi|151563463|gb|ABS16960.1| oligoendopeptidase, pepF/M3 family [Ochrobactrum anthropi ATCC
           49188]
          Length = 620

 Score =  616 bits (1588), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 300/620 (48%), Positives = 416/620 (67%), Gaps = 7/620 (1%)

Query: 9   FFSNAFFRKALRS--SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLA 66
           F  +  F K L +  SD    ++  +LGNLP WNL DLYPS DS E+ ND+E    ++ A
Sbjct: 4   FSESVSFNKVLHAPASDAVAAETT-DLGNLPEWNLGDLYPSADSAELKNDIEKAMKDAAA 62

Query: 67  FKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYT 126
           F+ RW+G L     + N  +   AI E+E + EL+GRI S+A L Y  + S P   K + 
Sbjct: 63  FEERWKGKLGDEAAKTNGGNFVDAIREFEALDELMGRIGSFAGLYYYGDTSDPKRMKLFG 122

Query: 127 DINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDM 186
           D+  KL D    LIFF LE+N +++A+LE++ + +     Y  W+ ++R  K + L + +
Sbjct: 123 DVQQKLTDASTHLIFFGLELNRIEDAVLEKAMSDNAAIGHYRPWLTDLRMDKPYQLDDKL 182

Query: 187 ECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALS 246
           E L  + S  G  A  R F E +  LRF+I+ +++ +        D+D  VRK A+ AL+
Sbjct: 183 EQLFHEKSITGYSAWNRLFDETMSGLRFEIDGKELSIEPTLNMLQDADGAVRKKASDALA 242

Query: 247 HTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYP 306
            TF  +   F+ ITNTLAKD+EI DRWR ++ IADSRHL+N VE  V++AL ++V++ YP
Sbjct: 243 KTFAANLRTFTLITNTLAKDKEISDRWRGFQDIADSRHLANRVEREVVDALAKAVEDAYP 302

Query: 307 KTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIA 366
           + SHRYY LK KWL L+ +  WDR APLP T Q +I ++ AR+ VL +Y  F+P+M+ IA
Sbjct: 303 RLSHRYYALKAKWLGLEKLENWDRNAPLPETPQALISWDEARETVLSAYGNFAPEMAAIA 362

Query: 367 EKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVL 426
           + FF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGHG+H +L
Sbjct: 363 KDFFDKNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGHGVHQIL 422

Query: 427 SSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQ 486
           +   QG L  ++ LTLAETAS+FGE LTF SLL+    K ERK +LA K EDM+N++VRQ
Sbjct: 423 AG-GQGALMASTPLTLAETASVFGEMLTFRSLLERTKDKRERKAMLAQKAEDMINTVVRQ 481

Query: 487 ISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIE 546
           I+FY FE ++HTERR  G++   RI EIW++ Q+ESLG A +L+   Y +FW  +PHFI 
Sbjct: 482 IAFYQFERRVHTERRE-GELTAERIGEIWMDVQRESLGDAVNLNP-GYETFWTYIPHFIH 539

Query: 547 SSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDP 606
           S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY ++L+AG +KH+ ELL P  ++ SDP
Sbjct: 540 SPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFDMLKAGGTKHHKELLAPFGLDASDP 598

Query: 607 NFWERGLQTVEKMIDDVEKM 626
           +FW +GL  +E +ID++E M
Sbjct: 599 DFWSKGLSVIEGIIDELEAM 618


>gi|90418903|ref|ZP_01226814.1| oligoendopeptidase F [Aurantimonas manganoxydans SI85-9A1]
 gi|90336983|gb|EAS50688.1| oligoendopeptidase F [Aurantimonas manganoxydans SI85-9A1]
          Length = 643

 Score =  615 bits (1586), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 300/596 (50%), Positives = 405/596 (67%), Gaps = 5/596 (0%)

Query: 31  ENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAA 90
           +  G LP WNL DLYP+ DS E++ D+E    ++ AF+ RW G L  A   ++   L AA
Sbjct: 52  DETGALPEWNLSDLYPAMDSPELTRDVERARADAEAFQERWRGRLEEAAKAEDG-DLAAA 110

Query: 91  IAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLD 150
           +A +E + EL+GRI SYA L Y+ + S P   KFY DI + + D    L+FF LE+N + 
Sbjct: 111 VASFEALEELLGRIISYAGLVYSGDTSDPARAKFYGDIQSVVTDISSRLLFFPLELNRIA 170

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIE 210
           +A ++ +  +DP    Y  W+ ++R  K + L + +E L  + +  GR A  R F E + 
Sbjct: 171 DADMDAAMDRDPALAHYRPWLVDLRLDKPYQLEDRVEELFHEKAITGRGAFNRLFDETLT 230

Query: 211 SLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
           SLRF ++   + L        D DRE R+ AA AL++ F+++   F+ ITNTLAKD+EI 
Sbjct: 231 SLRFTVDGDDLALEATLNILQDPDREKRRKAASALTNVFSENLRTFTLITNTLAKDKEIS 290

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
           DRWR +E +ADSRHL+N VE  V++AL Q+V + YP  SHRYY +K KWL  D + +WDR
Sbjct: 291 DRWRGFEDVADSRHLANRVERDVVDALSQAVTDAYPSISHRYYAMKAKWLGQDVLDYWDR 350

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
            APLP +++  I ++ AR  VL +Y+ F+P+M+ IAE+FFT++WIDA    GK  GAFAH
Sbjct: 351 NAPLPDSTRRDISWDEARHTVLSAYSGFAPEMASIAERFFTNDWIDAAIRPGKSPGAFAH 410

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
            T+PSVHPY+LLNY+GKP+DVMTLAHELGHG+H VL+   QG L   + LTLAETAS+FG
Sbjct: 411 PTVPSVHPYVLLNYMGKPRDVMTLAHELGHGVHQVLAGR-QGALMAATPLTLAETASVFG 469

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E LTF SLL  A++K ERK LLA+K+EDM+N++VRQI+FY FE  LH ERR  G++ T R
Sbjct: 470 EMLTFRSLLDQATTKAERKTLLASKVEDMINTVVRQIAFYQFERALHEERRG-GELTTER 528

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
           I EIW++ QK SLGPA  L D  Y ++W  VPHFI S FYVYAYAFG+CLVNSLY +Y+ 
Sbjct: 529 IGEIWMDIQKRSLGPALRLGD-GYETYWTYVPHFIHSPFYVYAYAFGDCLVNSLYAVYE- 586

Query: 571 NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           N+   F+EKY  +L+AG +KH+SELL P  ++ SDP FW RGL  +   ID++E M
Sbjct: 587 NSEAGFQEKYFEMLKAGGTKHHSELLQPFGLDASDPAFWSRGLAMISGFIDELEAM 642


>gi|260460647|ref|ZP_05808898.1| oligoendopeptidase, pepF/M3 family [Mesorhizobium opportunistum
           WSM2075]
 gi|259033752|gb|EEW35012.1| oligoendopeptidase, pepF/M3 family [Mesorhizobium opportunistum
           WSM2075]
          Length = 612

 Score =  614 bits (1584), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 297/595 (49%), Positives = 404/595 (67%), Gaps = 4/595 (0%)

Query: 32  NLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAI 91
            LG+LP WNL DLY   D+ E+  D+     +++AF+ RW+G LA    + +   LG A+
Sbjct: 20  GLGDLPEWNLADLYTGMDAPELKRDIARAAADAIAFEARWKGTLAAEAERGSAGRLGEAL 79

Query: 92  AEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDE 151
             YE + ELIGRI SYA L Y  N + P   K Y DI  K+ D    L+FFALE+N +D+
Sbjct: 80  VAYEALEELIGRIVSYAGLVYAGNTADPQRAKLYGDIQEKMTDASAHLLFFALELNLIDD 139

Query: 152 ALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIES 211
           A +E + A DP    Y  W+ ++R  K + L + +E L  + S  GR A  R F E +  
Sbjct: 140 AAIEGALAGDPAFGHYRPWVLDLRMDKPYQLEDRVEQLFHEKSITGRGAWNRLFDETMTD 199

Query: 212 LRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
           LRF ++ +++ L  A     D+D EVR+ A++AL+ TF K+   F+ ITNTLAKD+EI D
Sbjct: 200 LRFDVDGEELTLEPALNRLQDADGEVRRRASEALAATFRKNLRTFTLITNTLAKDKEISD 259

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRL 331
           RWR +E IADSRHL+N VE  V++AL  +V+  YP+ SHRYY++K +WL ++ M  WDR 
Sbjct: 260 RWRGFEDIADSRHLANRVERSVVDALATAVREAYPRLSHRYYQMKARWLGMEVMNHWDRN 319

Query: 332 APLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHG 391
           APLP T Q +I ++ AR+ VL +Y +FSP M+ IA  FF  NWIDAP   GK  GAFAH 
Sbjct: 320 APLPETPQAVIGWDEARNTVLSAYQRFSPDMAEIARTFFDRNWIDAPVRPGKSPGAFAHP 379

Query: 392 TIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE 451
           T+PS HPY+LLNY+GKP+DVMTLAHELGHG+H VL++  QG L  ++ LTLAETAS+FGE
Sbjct: 380 TVPSAHPYVLLNYMGKPRDVMTLAHELGHGVHQVLAA-GQGALMASTPLTLAETASVFGE 438

Query: 452 TLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRI 511
            LTF SLL+  + + ERK +LA K+EDM+N++VRQI+FY+FE K+H ERR+ G++ + R+
Sbjct: 439 MLTFRSLLEQTTDRRERKAMLAQKVEDMINTVVRQIAFYEFERKVHAERRN-GELTSDRL 497

Query: 512 NEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSN 571
            + WLE Q ESLGPA  L +  Y  FW  +PHFI S FYVYAYAFG+CLVNSLY +Y+ N
Sbjct: 498 GQFWLEVQAESLGPAIKLRE-GYEVFWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQ-N 555

Query: 572 TVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
               F++KY  +LRAG +KH+SELL P  ++ +DP FW+ GL  +  +ID++E +
Sbjct: 556 AERGFQDKYFEMLRAGGTKHHSELLAPFGLDATDPAFWQIGLGVIGGLIDELEAL 610


>gi|190893376|ref|YP_001979918.1| oligoendopeptidase F protein [Rhizobium etli CIAT 652]
 gi|190698655|gb|ACE92740.1| oligoendopeptidase F protein [Rhizobium etli CIAT 652]
          Length = 617

 Score =  613 bits (1580), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 293/594 (49%), Positives = 406/594 (68%), Gaps = 4/594 (0%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           LG+LP W L+DLYPS  S     DME     ++AF+ RW+G LA A  +     +GAA+ 
Sbjct: 25  LGDLPVWKLQDLYPSATSTAFVADMEKAGKAAIAFEQRWKGKLADAATKAGAEGIGAALK 84

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
           EYE + +++GR+ S+A L+Y  + ++PT  K Y D+ AK+ +F   L+FFALE+N +D+A
Sbjct: 85  EYEALDDIMGRLGSFAGLTYFSDTTNPTNGKLYGDVQAKITEFSGHLLFFALELNRIDDA 144

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
           +++   A DP    Y  W+ ++RK K + L + +E L  + S     A  R F E +  L
Sbjct: 145 VIDACIANDPDAGHYRPWLIDLRKDKPYQLDDRLEQLFLEKSMTSAAAFNRLFDETMAEL 204

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           R++I+  K+PL  A     + D EVR+ AA AL+ TF  +  IF+ ITNTLAKD++I DR
Sbjct: 205 RYEIDGAKVPLEVALNMLQEKDPEVRRKAAMALAETFKANIRIFTLITNTLAKDKDISDR 264

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR +E IADSRHL+N VE  V++AL  +V+  YP+ SHRYY++K KWL ++ M FWDR A
Sbjct: 265 WRGFEDIADSRHLANRVERVVVDALAAAVREAYPRLSHRYYKMKAKWLGMEQMNFWDRNA 324

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP TS  +I +  A+D VL +Y  F+P+M+ IA +FF   WIDAP   GK  GAFAH T
Sbjct: 325 PLPETSSAVISWSDAKDTVLSAYGNFAPEMADIARRFFDEQWIDAPVRPGKAPGAFAHPT 384

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +PS HPY+L+NY+GKP+DVMTLAHELGHG+H VL+   QG L   + LTLAETAS+FGE 
Sbjct: 385 VPSAHPYVLVNYMGKPRDVMTLAHELGHGVHQVLAG-AQGALMCQTPLTLAETASVFGEM 443

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF +LL+  + + ERK +LA K+EDM+N++VRQI+FY+FE KLHT R+S G++    I 
Sbjct: 444 LTFRALLEKTTDRRERKAMLAQKVEDMINTVVRQIAFYEFERKLHTARKS-GELTADDIG 502

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
           E+WL  Q ESLGPA  +S+  Y ++W  +PHFI S FYVYAYAFG+CLVNSLY +Y+   
Sbjct: 503 ELWLSVQSESLGPAISISE-GYETYWAYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQ-KA 560

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              F+EKY  +L+AG +KH+SELL P  ++ +DP+FW  GL  +E +ID++E +
Sbjct: 561 EKGFQEKYFELLKAGGTKHHSELLKPFGLDATDPSFWSHGLSMIEGLIDELEAL 614


>gi|150397882|ref|YP_001328349.1| pepF/M3 family oligoendopeptidase [Sinorhizobium medicae WSM419]
 gi|150029397|gb|ABR61514.1| oligoendopeptidase, pepF/M3 family [Sinorhizobium medicae WSM419]
          Length = 627

 Score =  612 bits (1579), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 300/614 (48%), Positives = 410/614 (66%), Gaps = 5/614 (0%)

Query: 14  FFRKALRSSDMTTMDSQ-ENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWE 72
             R AL +S      S    LG+LP W L DLY S  S+E  +D+   E +++AF+ +W+
Sbjct: 15  LLRAALANSGADQAASAPAELGDLPSWRLTDLYLSPSSEEFRSDLARAEADAVAFEAKWK 74

Query: 73  GNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKL 132
           G L  A  +     LGAA+ E+E + +L+GRIAS+A L+Y  + S+P   K Y DI +KL
Sbjct: 75  GKLDQAAGRTGDEGLGAAVNEFEALDDLMGRIASFAGLTYFSDTSNPANGKLYGDIQSKL 134

Query: 133 ADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSD 192
            D    L+FF+LE+N +D+  ++ + A D L   Y+ WI ++RK K + L + +E L  +
Sbjct: 135 TDISAHLLFFSLELNRIDDKRVDAALAADGLAAHYAPWILDLRKDKPYQLDDRLEQLFLE 194

Query: 193 TSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKS 252
            +  G  A  R F E I SL F ++ ++ PL        DS  EVR+ AA AL+ TF  +
Sbjct: 195 KTMTGANAFNRLFDETIASLTFSVDGKEQPLEVTLNLLQDSSVEVRRKAALALAETFKAN 254

Query: 253 SHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRY 312
              F+ +TNTLAKD+EI DRWR +E IADSRHL+N VE  V++AL  SVK  YP+ SHRY
Sbjct: 255 IRTFTLVTNTLAKDKEISDRWRGFEDIADSRHLANRVEREVVDALAASVKAAYPRLSHRY 314

Query: 313 YELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTH 372
           Y +K KWL ++ M FWDR APLP T   +IP+  ARD VL +Y  F+P+M+ IA +FF  
Sbjct: 315 YAMKAKWLGMEQMDFWDRNAPLPETPNALIPWNDARDTVLSAYHAFAPEMASIARRFFDD 374

Query: 373 NWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQG 432
            WIDAP   GK  GAFAH T+PSVHPY+L+NY+GKP+DVMTLAHELGHG+H VL+   QG
Sbjct: 375 GWIDAPVRPGKAPGAFAHPTVPSVHPYVLVNYMGKPRDVMTLAHELGHGVHQVLAG-AQG 433

Query: 433 ILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDF 492
            L  ++ LTLAETAS+FGE LTF +LL     + ERK +LA K+EDM+N++VRQI+FYDF
Sbjct: 434 ALMASTPLTLAETASVFGEMLTFRALLDRTKDRRERKAMLAQKVEDMINTVVRQIAFYDF 493

Query: 493 ELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVY 552
           E K+HT R+  G++    +  IW+  Q ESLGPA  LS+  Y ++W  +PHFI S FYVY
Sbjct: 494 ERKVHTARKE-GELTAEDLGRIWMSVQSESLGPAIRLSE-SYETYWAYIPHFIHSPFYVY 551

Query: 553 AYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERG 612
           AYAFG+CLVNSLY +Y+ N    F+EKY ++L+AG +KH+SELL P  ++ +DP+FW +G
Sbjct: 552 AYAFGDCLVNSLYAVYQ-NAERGFQEKYFDMLKAGGTKHHSELLAPFGLDAADPSFWAQG 610

Query: 613 LQTVEKMIDDVEKM 626
           L  +E +ID++E +
Sbjct: 611 LSMIEGLIDELEAL 624


>gi|13472641|ref|NP_104208.1| oligoendopeptidase F [Mesorhizobium loti MAFF303099]
 gi|14023387|dbj|BAB49994.1| oligoendopeptidase F [Mesorhizobium loti MAFF303099]
          Length = 612

 Score =  605 bits (1560), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 294/594 (49%), Positives = 400/594 (67%), Gaps = 4/594 (0%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           LG+LP WNL DLY   ++ E+  D+     +++AF+TRW+G LA    +     LG A+ 
Sbjct: 21  LGDLPEWNLADLYAGMEAPELKRDIAKAAADAIAFETRWKGTLAAEAGRGGAGKLGEALV 80

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
            YE + ELIGRI SYA L Y  N + P   K Y DI  K+ D    L+FFALE+N +D+A
Sbjct: 81  AYEALEELIGRIVSYAGLVYAGNTADPQRAKLYGDIQEKMTDASAHLLFFALELNLIDDA 140

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
            +E +   D     Y  W+ ++R  K + L + +E L  + S  GR A  R F E +  L
Sbjct: 141 AIESALTSDSAFGHYRPWVLDLRMDKPYQLEDRVEQLFHEKSITGRGAWNRLFDETMTDL 200

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           RF +  +++ L  A     D+  EVR+ A++AL+ TF K+   F+ ITNTLAKD+EI DR
Sbjct: 201 RFDVEGEELTLEPALNRLQDAYGEVRRRASEALAATFRKNLRTFTLITNTLAKDKEISDR 260

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR +E IADSRHL+N VE  V++AL  +V+  YP+ SHRYY +K +WL +D M  WDR A
Sbjct: 261 WRGFEDIADSRHLANRVERGVVDALATAVREAYPRLSHRYYAMKARWLGMDVMNHWDRNA 320

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP T Q +I ++ AR+ VL +Y +FSP+M+ IA  FF  NWIDAP   GK  GAFAH T
Sbjct: 321 PLPETPQAVIGWDEARNTVLSAYQRFSPEMAEIARTFFDRNWIDAPVRPGKSPGAFAHPT 380

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +PS HPY+LLNY+GKP+DVMTLAHELGHG+H VL++  QG L  ++ LTLAETAS+FGE 
Sbjct: 381 VPSAHPYVLLNYMGKPRDVMTLAHELGHGVHQVLAA-GQGALMASTPLTLAETASVFGEM 439

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF SLL+  + + ERK +LA K+EDM+N++VRQI+FY+FE K+H ERR+ G++ + R+ 
Sbjct: 440 LTFRSLLEQTTDRRERKAMLAQKVEDMINTVVRQIAFYEFERKVHAERRN-GELTSDRLG 498

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
           + WLE Q ESLGPA  L +  Y  FW  +PHFI S FYVYAYAFG+CLVNSLY +Y+ N 
Sbjct: 499 QFWLEVQAESLGPAIKLRE-GYEVFWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQ-NA 556

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              F++KY  +LRAG +KH+S+LL P  ++ +DP FW+ GL  +  +ID++E +
Sbjct: 557 ERGFQDKYFEMLRAGGTKHHSQLLAPFGLDATDPAFWQIGLGVISGLIDELETL 610


>gi|159185890|ref|NP_356857.2| oligoendopeptidase F [Agrobacterium tumefaciens str. C58]
 gi|159141024|gb|AAK89642.2| oligoendopeptidase F [Agrobacterium tumefaciens str. C58]
          Length = 616

 Score =  603 bits (1554), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 291/594 (48%), Positives = 397/594 (66%), Gaps = 4/594 (0%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           LG+LP W L DLYPS DS E   D+E     + AF+ +W+  L  A   K    +GAA+ 
Sbjct: 22  LGDLPGWKLSDLYPSGDSPEYKRDLEKAASMAAAFEAKWKDKLESAAKAKGEDGIGAALK 81

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
           +YE + +LIGRI S+A L+Y  + S+P   K Y D  AKL +    L+FF LE+N +D+A
Sbjct: 82  DYEALDDLIGRIGSFAGLTYFSDTSNPANGKLYGDAQAKLTEISAHLLFFTLELNRIDDA 141

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
           +++   A D     Y  W+ ++RK K H L + +E L  + S     A  R F E +  L
Sbjct: 142 VMDACMANDAAAGHYRPWLVDLRKDKPHQLDDQLEQLFLEKSMTSAAAFNRLFDETMADL 201

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           RF I+   + L        + + E R+ AA+ALS TF  +  +F+ ITNTLAKD++I DR
Sbjct: 202 RFDIDGASLSLEVTLNMLQEPEPETRRKAAEALSATFKDNLRVFTLITNTLAKDKDISDR 261

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR +E IADSRHL+N VE  V++AL  +VK  YP+ SHRYY +K KWL ++ M +WDR A
Sbjct: 262 WRNFEDIADSRHLANRVERDVVDALAAAVKKAYPRLSHRYYAMKAKWLGMEQMNYWDRNA 321

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP TS  IIP++ A+D VL +Y  F+P+M+ IA +FF   WIDAP   GK  GAFAH T
Sbjct: 322 PLPDTSNTIIPWDEAKDTVLSAYGNFAPEMADIARRFFDEEWIDAPARPGKAPGAFAHPT 381

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +PS HPY+L+NYLGKP+DVMTLAHELGHG+H VL+ + QG L   + LTLAETAS+FGE 
Sbjct: 382 VPSAHPYVLVNYLGKPRDVMTLAHELGHGVHQVLAGQ-QGALMCATPLTLAETASVFGEM 440

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF  LL       ERK +LA K+EDM+N++VRQI+FY+FE KLHT R+  G++ + +I 
Sbjct: 441 LTFRKLLDDTKDIRERKAMLARKVEDMINTVVRQIAFYEFERKLHTARKE-GELTSEQIG 499

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
           E+WL  Q ESLGPA  +S+  Y ++W  +PHFI S FYVYAYAFG+CLVNSLY +Y+   
Sbjct: 500 ELWLSVQAESLGPAIRISE-GYETWWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQKAE 558

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              F+EKY  +L+AG +KH+SELL P  ++ +DP+FW++GL  +E +ID++E++
Sbjct: 559 A-GFQEKYFELLKAGGTKHHSELLKPFGLDATDPSFWDKGLSMIEGLIDELEEL 611


>gi|114706840|ref|ZP_01439740.1| Peptidase M3:Neutral zinc metallopeptidases, zinc-binding region
           [Fulvimarina pelagi HTCC2506]
 gi|114537788|gb|EAU40912.1| Peptidase M3:Neutral zinc metallopeptidases, zinc-binding region
           [Fulvimarina pelagi HTCC2506]
          Length = 609

 Score =  600 bits (1546), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 295/595 (49%), Positives = 397/595 (66%), Gaps = 5/595 (0%)

Query: 32  NLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAI 91
            +  LP W+L+DLYPS DS E+ +D++    ++  FK  W+G LA   N  +   L  ++
Sbjct: 19  GISELPEWSLDDLYPSMDSPELQSDLDKARQDATRFKENWKGKLADLAN-ADPAGLARSV 77

Query: 92  AEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDE 151
           +EYE++ EL+GRI SYA L Y  + S P   KFY DI   + D    L+FF LE+N +++
Sbjct: 78  SEYEKLEELLGRIISYAGLVYAGDTSDPVRAKFYGDIQGSVTDIATNLLFFTLELNRIED 137

Query: 152 ALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIES 211
           A+++ +   +P    +  W+ ++RK K   L + +E L  +    G  A  R F E + S
Sbjct: 138 AVMDSAMEAEPALAHFRPWLVDLRKDKPFQLEDRVEELFHEKGITGAGAWNRLFDETLTS 197

Query: 212 LRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
           LRF ++   + L        D DR+ R+ AA AL++ F+++   F+ ITNTLAKD+EI D
Sbjct: 198 LRFTVDGDDLALEATLNLLQDDDRDKRRKAAAALANVFSRNLRTFTLITNTLAKDKEISD 257

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRL 331
           RWR +E +ADSRHL+N VE  V++AL  +V   YP  SHRYY +K KWL LD + FWDR 
Sbjct: 258 RWRGFEDVADSRHLANRVEREVVDALNTAVIQAYPSISHRYYAMKAKWLGLDALEFWDRN 317

Query: 332 APLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHG 391
           APLP   +  I ++ AR+ VL +Y+ FSP M+ IA++FF  +WIDA    GK  GAFAH 
Sbjct: 318 APLPNAKRRDISWDDARETVLSAYSGFSPDMAEIAKRFFDRSWIDASLRPGKSPGAFAHP 377

Query: 392 TIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE 451
           T+PSVHPY+LLNY+GKP+DVMTLAHELGHG+H VL+ + QG L   + LTLAETAS+FGE
Sbjct: 378 TVPSVHPYVLLNYMGKPRDVMTLAHELGHGVHQVLAGD-QGALMAATPLTLAETASVFGE 436

Query: 452 TLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRI 511
            LTF SLL  A + EERK LLA+K+EDM+N++VRQI+FY FE  LH ERRS G++ + RI
Sbjct: 437 MLTFRSLLAQAKTPEERKTLLASKVEDMINTVVRQIAFYQFERALHEERRS-GELTSERI 495

Query: 512 NEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSN 571
            EIWL  Q  SLGPA  L D  Y ++W  VPHFI S FYVYAYAFG+CLVNSLY +Y+ N
Sbjct: 496 GEIWLSVQSRSLGPAVRLGD-GYETYWTYVPHFIHSPFYVYAYAFGDCLVNSLYSVYE-N 553

Query: 572 TVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
               F++KY  +L+AG +KH+SELL P  ++ SDP FW RGLQ +   ID++EKM
Sbjct: 554 AQAGFQDKYFEMLKAGGTKHHSELLAPFGLDASDPAFWSRGLQMISGFIDELEKM 608


>gi|115526097|ref|YP_783008.1| pepF/M3 family oligoendopeptidase [Rhodopseudomonas palustris
           BisA53]
 gi|115520044|gb|ABJ08028.1| oligoendopeptidase, pepF/M3 family [Rhodopseudomonas palustris
           BisA53]
          Length = 635

 Score =  598 bits (1541), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 290/595 (48%), Positives = 394/595 (66%), Gaps = 6/595 (1%)

Query: 34  GN-LPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS-LGAAI 91
           GN LP WNL DLY   D+ EI+ D++ I+ + +AF+  ++G LA  T ++   + L  A+
Sbjct: 44  GNKLPEWNLADLYLGIDAPEIARDLDRIDADCIAFEQDYKGKLAEETAKEGGGAWLAGAV 103

Query: 92  AEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDE 151
             YE I +L GR+ SYA L++  +   P I KFY D++ +L      L+FFALE+N +D+
Sbjct: 104 KRYEAIDDLAGRLGSYAGLAHAGDSVDPAITKFYGDVSERLTAASVHLLFFALELNRIDD 163

Query: 152 ALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIES 211
            ++E++  Q P    Y  WI++ RK K + L + +E L  + SQ G  A  R F + I  
Sbjct: 164 TVIERAMQQAPELGHYRPWIEDSRKDKPYQLEDRVEQLFHEKSQTGYSAFNRLFDQTIAG 223

Query: 212 LRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
           LRFK+  +++ +        D D   RK+A +AL+ TF  +   F+ ITNTLAKD+EI D
Sbjct: 224 LRFKLGGKELAIEPTLNQLQDRDPAKRKAAGQALAKTFKANERTFALITNTLAKDKEISD 283

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRL 331
           RWR +E IAD+RHLSN VE  V++AL+ SV+  YPK SHRYY LK +W K  ++  WDR 
Sbjct: 284 RWRGFEDIADARHLSNRVEREVVDALVNSVRAAYPKLSHRYYALKARWFKKKSLAHWDRN 343

Query: 332 APLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHG 391
           APLP  +   I +  A+D+VL +Y  FSP+M+ IA++FF   WIDAP   GK  GAF+H 
Sbjct: 344 APLPFAATGSIGWPEAQDMVLSAYGAFSPEMASIAQRFFADRWIDAPVRPGKAPGAFSHP 403

Query: 392 TIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE 451
           T PS HPY+L+NY GKP+DVMTLAHELGHG+H VL+++  G L   + LTLAETAS+FGE
Sbjct: 404 TTPSAHPYVLMNYQGKPRDVMTLAHELGHGVHQVLAAKN-GALMAPTPLTLAETASVFGE 462

Query: 452 TLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRI 511
            LTF  LL    S ++R+ LLA K+EDM+N++VRQI+FY FE  +HTERR  G++   RI
Sbjct: 463 MLTFKRLLGQTKSPKQRQALLAGKVEDMINTVVRQIAFYSFERAIHTERRQ-GELTAERI 521

Query: 512 NEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSN 571
            +IWL  Q ESLGPA D+    Y +FWM +PHFI S FYVYAYAFG+CLVNSLY +Y+ N
Sbjct: 522 GQIWLSVQSESLGPAIDIKP-GYETFWMYIPHFIHSPFYVYAYAFGDCLVNSLYAVYE-N 579

Query: 572 TVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
             + F E+YL +L AG +KHYSELL P  ++  DP FW+ GL  +  MID++E M
Sbjct: 580 AQEGFAERYLAMLSAGGTKHYSELLKPFGLDARDPQFWDGGLSVIAGMIDELEAM 634


>gi|254561919|ref|YP_003069014.1| oligoendopeptidase F [Methylobacterium extorquens DM4]
 gi|254269197|emb|CAX25163.1| putative oligoendopeptidase F [Methylobacterium extorquens DM4]
          Length = 625

 Score =  595 bits (1534), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 293/615 (47%), Positives = 393/615 (63%), Gaps = 15/615 (2%)

Query: 13  AFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWE 72
           A  R A++++D         LG LP W+L DLYPS D+    +D++  E ES AF  R+ 
Sbjct: 22  AAVRGAIQAAD---------LGVLPEWDLTDLYPSMDAPAFRDDLDRAEAESRAFAERYA 72

Query: 73  GNLAHATNQKNCHS-LGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAK 131
           G +A      +  S LG A+  +ERI +L+GR+ SYA L Y+ + +  T  KFY D   +
Sbjct: 73  GRIAEIAAGPDASSVLGEAVQTFERIEDLMGRLMSYAGLVYSGDTTDETRAKFYGDTRER 132

Query: 132 LADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLS 191
           L      L+FF LE+N +++A+L+ + A  PL   Y  WI+++R+ K H L +  E L  
Sbjct: 133 LTTASGDLLFFGLELNRVEDAVLDAAMADGPLA-HYRPWIEDLRREKPHQLDDRTEKLFL 191

Query: 192 DTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNK 251
           D S     A  R F E I SLRF +  +++ L        DSD  VR+ AA+AL  T   
Sbjct: 192 DKSVTSNAAWDRLFNETIASLRFSVQGERLTLEPTLNKLVDSDGAVRQEAAQALGETLRA 251

Query: 252 SSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHR 311
           +  IF+ ITNTLAKD+EI DRWR ++ +AD+RHLSN VEP V+ A++++V+  YP+ SHR
Sbjct: 252 NLRIFTLITNTLAKDKEISDRWRGFKDVADARHLSNRVEPEVVAAMVEAVRAAYPRLSHR 311

Query: 312 YYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFT 371
           YY LK KW  ++ + +WDR APLP   Q  IP+  ARD VL++Y  FSP M+ IA+KFF 
Sbjct: 312 YYRLKAKWFGVEALPYWDRNAPLPKVEQRTIPWAQARDTVLEAYDAFSPDMAGIAKKFFD 371

Query: 372 HNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQ 431
             WIDAP   GK  GAFAH T+PS HPY+L+NY GKP+DVMTLAHELGHG+H VL++   
Sbjct: 372 GGWIDAPTRPGKAPGAFAHPTVPSAHPYVLVNYQGKPRDVMTLAHELGHGVHQVLAA-PN 430

Query: 432 GILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYD 491
           G L   + LTLAETAS+FGE LTF  LL   +   +R+ +LA K+EDM+N++VRQI+FY 
Sbjct: 431 GALMAPTPLTLAETASVFGEMLTFQRLLGQTTDPTQRRAMLAAKVEDMINTVVRQIAFYS 490

Query: 492 FELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYV 551
           FE K+H   R+ G++   +INE+W+  Q ESLGPA  L D  Y  FW  +PHFI S FYV
Sbjct: 491 FERKVHLA-RAKGELTAEQINELWMSVQSESLGPAITL-DKGYEPFWAYIPHFIHSPFYV 548

Query: 552 YAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWER 611
           YAYAFG+CLVNSLY +Y +     F E+Y  +L AG SK Y ELL P  ++ SDP FW+ 
Sbjct: 549 YAYAFGDCLVNSLYGVY-ARAEPGFVERYFALLSAGGSKPYGELLKPFGLDASDPGFWQI 607

Query: 612 GLQTVEKMIDDVEKM 626
           GL  +E MI ++E M
Sbjct: 608 GLGMIEGMIAELEAM 622


>gi|90425449|ref|YP_533819.1| peptidase M3B, oligoendopeptidase-like clade 3 [Rhodopseudomonas
           palustris BisB18]
 gi|90107463|gb|ABD89500.1| Peptidase M3B, oligoendopeptidase-related clade 3 [Rhodopseudomonas
           palustris BisB18]
          Length = 626

 Score =  594 bits (1532), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 292/598 (48%), Positives = 395/598 (66%), Gaps = 6/598 (1%)

Query: 30  QENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS-LG 88
           Q     LP W+L DLY S DS E++ D++ I+ + +AF+  ++G LA  T +      L 
Sbjct: 33  QAKAAQLPEWDLADLYTSIDSPEVARDLDKIDADCIAFEHDYKGKLAEETAKGGGGVWLA 92

Query: 89  AAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINT 148
            A+A YE I +L GR+ASYA L +  +   P + KFY D++ +L      L+FFALE+N 
Sbjct: 93  EAVARYEAIDDLAGRLASYAGLIHAGDSVDPKLSKFYGDVSERLTAASVHLLFFALELNR 152

Query: 149 LDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCEN 208
           +D+A++E +  Q P    Y  WI++ RK K + L + +E L  + SQ G  A  R F + 
Sbjct: 153 VDDAVMEMAM-QAPELGHYRPWIEDSRKDKPYQLEDRIEQLFHEKSQTGYGAFNRLFDQT 211

Query: 209 IESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEE 268
           I +LRFK+  +++ +        D D + RK+A +AL+ TF  +   F+ ITNTLAKD+E
Sbjct: 212 ISALRFKLGAKELAIEPTLTLLQDRDPQKRKAAGQALAKTFKANERTFALITNTLAKDKE 271

Query: 269 IQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFW 328
           I DRWR +E +ADSRHL+N VE  V++AL+ SV+  YPK SHRYY LK +W     +  W
Sbjct: 272 ISDRWRGFEDVADSRHLANRVEREVVDALVASVRAAYPKLSHRYYALKARWFGKKQLAHW 331

Query: 329 DRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAF 388
           DR APLP  +   I +  A+D+VL +Y  FSP+M+ IAE+FFT  WIDAP   GK  GAF
Sbjct: 332 DRNAPLPFAATGTIGWPEAKDMVLTAYTAFSPEMAKIAERFFTDRWIDAPVRPGKAPGAF 391

Query: 389 AHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASI 448
           +H T PS HPY+L+NY GKP+DVMTLAHELGHG+H VL+++  G L   + LTLAETAS+
Sbjct: 392 SHPTTPSAHPYVLMNYQGKPRDVMTLAHELGHGVHQVLAAKN-GALMAPTPLTLAETASV 450

Query: 449 FGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPT 508
           FGE LTF  LL    S ++R+ LLA K+EDM+N++VRQI+FY FE  +HTERR+ G++  
Sbjct: 451 FGEMLTFKRLLGQTKSLKQRQALLAGKVEDMINTVVRQIAFYSFERAIHTERRN-GELTA 509

Query: 509 HRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIY 568
            RI EIWL  Q ESLGPA D+    Y +FWM +PHFI S FYVYAYAFG+CLVNSLY +Y
Sbjct: 510 QRIGEIWLSVQGESLGPAIDIKP-GYENFWMYIPHFIHSPFYVYAYAFGDCLVNSLYAVY 568

Query: 569 KSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           + N  + F E+YL +L AG +KHYSELL P  ++  DP FW+ GL  +  MID++E M
Sbjct: 569 E-NAQEGFAERYLAMLSAGGTKHYSELLQPFGLDARDPTFWDGGLSVIAGMIDELEAM 625


>gi|240139505|ref|YP_002963980.1| putative oligoendopeptidase F [Methylobacterium extorquens AM1]
 gi|240009477|gb|ACS40703.1| putative oligoendopeptidase F [Methylobacterium extorquens AM1]
          Length = 625

 Score =  594 bits (1531), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 289/596 (48%), Positives = 384/596 (64%), Gaps = 6/596 (1%)

Query: 32  NLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS-LGAA 90
           +LG LP W+L DLYPS D+     D++  E ES AF  R+ G +A      +  S LG A
Sbjct: 32  DLGVLPEWDLTDLYPSMDAPAFREDLDRAEAESRAFAERYAGRIAEIAAGPDASSVLGEA 91

Query: 91  IAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLD 150
           +  +ERI +L+GR+ SYA L Y+ + +  T  KFY D   +L      L+FF LE+N ++
Sbjct: 92  VQTFERIEDLMGRLMSYAGLVYSGDTTDETRAKFYGDTRERLTTASGDLLFFGLELNRVE 151

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIE 210
           +A+L+ + A  PL   Y  WI+++R+ K H L +  E L  D S     A  R F E I 
Sbjct: 152 DAVLDAAMADGPLA-HYRPWIEDLRREKPHQLDDRTEKLFLDKSVTSNAAWDRLFNETIA 210

Query: 211 SLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
           SLRF +  +++ L        DSD  VR+ AA+AL  T   +  IF+ ITNTLAKD+EI 
Sbjct: 211 SLRFSVQGERLTLEPTLNKLVDSDGAVRQEAAQALGETLRANLRIFTLITNTLAKDKEIS 270

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
           DRWR ++ +AD+RHLSN VEP V+ A++++V+  YP+ SHRYY LK KW  ++ + +WDR
Sbjct: 271 DRWRGFKDVADARHLSNRVEPEVVAAMVEAVRAAYPRLSHRYYRLKAKWFGVEALPYWDR 330

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
            APLP   Q  IP+  ARD VL++Y  FSP M+ IA KFF   WIDAP   GK  GAFAH
Sbjct: 331 NAPLPKVEQRTIPWAQARDTVLEAYDAFSPDMAGIARKFFDGGWIDAPTRPGKAPGAFAH 390

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
            T+PS HPY+L+NY GKP+DVMTLAHELGHG+H VL++   G L   + LTLAETAS+FG
Sbjct: 391 PTVPSAHPYVLVNYQGKPRDVMTLAHELGHGVHQVLAA-PNGALMAPTPLTLAETASVFG 449

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E LTF  LL   +   +R+ +LA K+EDM+N++VRQI+FY FE K+H   R+ G++   +
Sbjct: 450 EMLTFQRLLGQTTDPTQRRAMLAAKVEDMINTVVRQIAFYSFERKVHLA-RAKGELTAEQ 508

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
           INE+W+  Q ESLGPA  L D  Y  FW  +PHFI S FYVYAYAFG+CLVNSLY +Y +
Sbjct: 509 INELWMSVQSESLGPAITL-DKGYEPFWAYIPHFIHSPFYVYAYAFGDCLVNSLYGVY-A 566

Query: 571 NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
                F E+Y  +L AG SK Y ELL P  ++ SDP FW+ GL  +E MI ++E M
Sbjct: 567 RAEPGFVERYFALLSAGGSKPYGELLKPFGLDASDPGFWQIGLGMIEGMIAELESM 622


>gi|163852173|ref|YP_001640216.1| pepF/M3 family oligoendopeptidase [Methylobacterium extorquens PA1]
 gi|163663778|gb|ABY31145.1| oligoendopeptidase, pepF/M3 family [Methylobacterium extorquens
           PA1]
          Length = 625

 Score =  593 bits (1529), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 289/596 (48%), Positives = 385/596 (64%), Gaps = 6/596 (1%)

Query: 32  NLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS-LGAA 90
           +LG LP W+L DLYPS D+     D++  E ES AF  R+ G +A      +  S LG A
Sbjct: 32  DLGVLPEWDLTDLYPSMDAPAFREDLDRAEAESRAFAERYAGRIAEIAAGPDASSVLGEA 91

Query: 91  IAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLD 150
           +  +ERI +L+GR+ SYA L Y+ + +  T  KFY D   +L      L+FF LE+N ++
Sbjct: 92  VQTFERIEDLMGRLMSYAGLVYSGDTTDETRAKFYGDTRERLTTASGDLLFFGLELNRVE 151

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIE 210
           +A+L+ + A  PL   Y  WI+++R+ K H L +  E L  D S     A  R F E I 
Sbjct: 152 DAVLDAAMADGPLA-HYRPWIEDLRREKPHQLDDRTEKLFLDKSVTSNAAWDRLFNETIA 210

Query: 211 SLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
           SLRF +  +++ L        DSD  VR+ AA+AL  T   +  IF+ ITNTLAKD+EI 
Sbjct: 211 SLRFSVQGERLTLEPTLNKLVDSDGAVRQEAAQALGETLRANLRIFTLITNTLAKDKEIS 270

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
           DRWR ++ +AD+RHLSN VEP V+ A++++V+  YP+ SHRYY LK KW  ++ + +WDR
Sbjct: 271 DRWRGFKDVADARHLSNRVEPEVVAAMVEAVRAAYPRLSHRYYRLKAKWFGVEALPYWDR 330

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
            APLP   Q  IP+  ARD VL++Y  FSP M+ IA+KFF   WIDAP   GK  GAFAH
Sbjct: 331 NAPLPKVEQRTIPWAQARDTVLEAYDAFSPDMAGIAKKFFDGGWIDAPTRPGKAPGAFAH 390

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
            T+PS HPY+L+NY GKP+DVMTLAHELGHG+H VL++   G L   + LTLAETAS+FG
Sbjct: 391 PTVPSAHPYVLVNYQGKPRDVMTLAHELGHGVHQVLAA-PNGALMAPTPLTLAETASVFG 449

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E LTF  LL   +   +R+ +LA K+EDM+N++VRQI+FY FE K+H   R+ G++   +
Sbjct: 450 EMLTFQRLLGQTTDPTQRRAMLAAKVEDMINTVVRQIAFYSFERKVHLA-RAKGELTAEQ 508

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
           INE+W+  Q ESLGPA  L D  Y  FW  +PHFI S FYVYAYAFG+CLVNSLY +Y +
Sbjct: 509 INELWMSVQSESLGPAITL-DKGYEPFWAYIPHFIHSPFYVYAYAFGDCLVNSLYGVY-A 566

Query: 571 NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
                F E+Y  +L AG SK Y ELL P  ++ SDP FW+ GL  +E MI ++E M
Sbjct: 567 RAEPGFVERYFALLSAGGSKPYGELLKPFGLDASDPGFWQIGLGMIEGMIAELEAM 622


>gi|27382240|ref|NP_773769.1| oligoendopeptidase F [Bradyrhizobium japonicum USDA 110]
 gi|27355411|dbj|BAC52394.1| oligoendopeptidase F [Bradyrhizobium japonicum USDA 110]
          Length = 655

 Score =  593 bits (1529), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 287/594 (48%), Positives = 396/594 (66%), Gaps = 6/594 (1%)

Query: 34  GNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHAT-NQKNCHSLGAAIA 92
           G LP WNL DLY   D+ E++ D+E ++ + +AF+T ++G LA  T N+     L  A+ 
Sbjct: 66  GRLPEWNLADLYSGIDAPEVARDLERMDADCVAFETDYKGKLATGTANEDGGKWLAEAVR 125

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
            YE I +L GR+ SYA L +  +   P I KFY D++ +L      L+FFALE+N +D+ 
Sbjct: 126 RYEAIDDLAGRLGSYAGLVHAGDSVDPKISKFYGDVSERLTAASTHLLFFALELNRVDDD 185

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
           +L ++  Q P    Y  WI+++RK K + L + +E L  + +Q G  A  R F + I  L
Sbjct: 186 ILTRAM-QAPELAHYRPWIEDLRKEKPYQLDDKLEQLFLEKAQTGYSAFNRLFDQTISGL 244

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           RFK+  +++ +        D D   RK+AA+AL+ TF  +   F+ ITNTLAKD++I DR
Sbjct: 245 RFKVGPKELAIEPTLNLLQDRDGAKRKTAAEALAKTFKANERTFALITNTLAKDKDISDR 304

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR ++ +ADSRHL+N VE  V++AL+ SV+  YPK SHRYY LK KW     + +WDR A
Sbjct: 305 WRGFKDVADSRHLNNRVEREVVDALVASVRAAYPKLSHRYYALKAKWFGKKRLAYWDRNA 364

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP  + D+I +  AR++VL +Y  FSP+M+ IAE+FFT  WIDAP   GK  GAF+H T
Sbjct: 365 PLPFAATDVIGWPDARNMVLTAYRGFSPKMADIAERFFTDRWIDAPVRPGKAPGAFSHPT 424

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
            PS HPY+L+NY GKP+DVMTLAHELGHG+H VL+++  G L   + LTLAETAS+FGE 
Sbjct: 425 TPSAHPYVLMNYQGKPRDVMTLAHELGHGVHQVLAAK-NGALMAPTPLTLAETASVFGEM 483

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF  LL    S  +R+ LLA K+EDM+N++VRQI+FY FE  +HTER++ G++   R+ 
Sbjct: 484 LTFRRLLAQTKSARQRQALLAGKVEDMINTVVRQIAFYSFERAVHTERKN-GELTATRLG 542

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
           EIWL  Q ESLGPA ++    Y ++WM +PHFI S FYVYAYAFG+CLVNSLY +Y+ N 
Sbjct: 543 EIWLSVQGESLGPAIEIK-AGYENYWMYIPHFIHSPFYVYAYAFGDCLVNSLYAVYE-NA 600

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + F E+YL++L AG +KHYSELL P  ++  DP FW+ GL  +  MID++E M
Sbjct: 601 AEGFAERYLDMLAAGGTKHYSELLRPFGLDAKDPKFWDGGLSVIAGMIDELEAM 654


>gi|218530931|ref|YP_002421747.1| oligoendopeptidase, pepF/M3 family [Methylobacterium
           chloromethanicum CM4]
 gi|218523234|gb|ACK83819.1| oligoendopeptidase, pepF/M3 family [Methylobacterium
           chloromethanicum CM4]
          Length = 625

 Score =  593 bits (1528), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 293/615 (47%), Positives = 392/615 (63%), Gaps = 15/615 (2%)

Query: 13  AFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWE 72
           A  R A++++D         LG LP W+L DLYPS D+     D++  E ES AF  R+ 
Sbjct: 22  AAVRGAIQAAD---------LGVLPEWDLTDLYPSMDAPAFREDLDRAEAESRAFAERYA 72

Query: 73  GNLAHATNQKNCHS-LGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAK 131
           G +A      +  S LG A+  +ERI +L+GR+ SYA L Y+ + +  T  KFY D   +
Sbjct: 73  GRIAEIAAGPDASSVLGEAVQTFERIEDLMGRLMSYAGLVYSGDTTDETRAKFYGDTRER 132

Query: 132 LADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLS 191
           L      L+FF LE+N +++A+L+ + A  PL   YS WI+++R+ K H L +  E L  
Sbjct: 133 LTTASGDLLFFGLELNRVEDAVLDAAMADGPLA-HYSPWIEDLRREKPHQLDDRTEKLFL 191

Query: 192 DTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNK 251
           D S     A  R F E I SLRF +  +++ L        DSD  VR+ AA+AL  T   
Sbjct: 192 DKSVTSNAAWDRLFNETIASLRFSVQGERLTLEPTLNKLVDSDGAVRQEAAQALGETLRA 251

Query: 252 SSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHR 311
           +  IF+ ITNTLAKD+EI DRWR ++ +AD+RHLSN VEP V+ A++++V+  YP+ SHR
Sbjct: 252 NLRIFTLITNTLAKDKEISDRWRGFKDVADARHLSNRVEPEVVAAMVEAVREAYPRLSHR 311

Query: 312 YYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFT 371
           YY LK KW  ++ + +WDR APLP   Q  I +  ARD VL++Y  FSP M+ IA+KFF 
Sbjct: 312 YYRLKAKWFGVEALPYWDRNAPLPKVEQRTISWAQARDTVLEAYDAFSPDMAGIAKKFFD 371

Query: 372 HNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQ 431
             WIDAP   GK  GAFAH T+PS HPY+L+NY GKP+DVMTLAHELGHG+H VL++   
Sbjct: 372 GGWIDAPTRPGKAPGAFAHPTVPSAHPYVLVNYQGKPRDVMTLAHELGHGVHQVLAA-PN 430

Query: 432 GILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYD 491
           G L   + LTLAETAS+FGE LTF  LL   +   +R+ +LA K+EDM+N++VRQI+FY 
Sbjct: 431 GALMAPTPLTLAETASVFGEMLTFQRLLGQTTDPTQRRAMLAAKVEDMINTVVRQIAFYS 490

Query: 492 FELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYV 551
           FE K+H   R+ G++   +INE+W+  Q ESLGPA  L D  Y  FW  +PHFI S FYV
Sbjct: 491 FERKVHLA-RAKGELTAEQINELWMSVQSESLGPAITL-DKGYEPFWAYIPHFIHSPFYV 548

Query: 552 YAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWER 611
           YAYAFG+CLVNSLY +Y +     F E+Y  +L AG SK Y ELL P  ++ SDP FW+ 
Sbjct: 549 YAYAFGDCLVNSLYGVY-ARAEPGFVERYFALLSAGGSKPYGELLKPFGLDASDPGFWQI 607

Query: 612 GLQTVEKMIDDVEKM 626
           GL  +E MI ++E M
Sbjct: 608 GLGMIEGMIAELEAM 622


>gi|328542492|ref|YP_004302601.1| Oligoendopeptidase, pepF/M3 family [polymorphum gilvum SL003B-26A1]
 gi|326412238|gb|ADZ69301.1| Oligoendopeptidase, pepF/M3 family [Polymorphum gilvum SL003B-26A1]
          Length = 604

 Score =  592 bits (1525), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 293/598 (48%), Positives = 407/598 (68%), Gaps = 5/598 (0%)

Query: 29  SQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG 88
           S   LG+LP W+L DLYP+ D+ E+  D+      S AF+T ++G LA   +      L 
Sbjct: 9   SAAALGSLPEWDLTDLYPAPDAPEVKADLAAALDRSKAFETAYKGTLADLASGDRA-GLL 67

Query: 89  AAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINT 148
           AA+  YE + +L+GR+ S+A L Y+   + P  +KFY D+  ++      L+FF LE+N+
Sbjct: 68  AAVKAYEALEDLLGRLISFAGLVYSGQTTDPARQKFYGDVQERITTAGSHLLFFTLELNS 127

Query: 149 LDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCEN 208
           +D+A+LE + A D     Y  W +++RK K + L + +E L  + S  GR A  R F E 
Sbjct: 128 IDDAVLEAALAADAGLAHYRPWFEDLRKEKPYQLEDRVEQLFHEKSVTGRGAWNRLFDET 187

Query: 209 IESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEE 268
           I SLRF ++ +++ +        D+D   RK+AA+AL+ TF  +  +F+ ITNTLAKD+E
Sbjct: 188 IASLRFSVDGRELAVEPTLNLLQDADPATRKAAAEALAATFRDNLRLFTLITNTLAKDKE 247

Query: 269 IQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFW 328
           I DRWRK+E IADSRHL+N VE  V++A++ +V+  YP+ SHRYY LK +WL ++ +  W
Sbjct: 248 ISDRWRKFEDIADSRHLANRVEREVVDAMVAAVREAYPRLSHRYYRLKARWLGMERLNHW 307

Query: 329 DRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAF 388
           DR APLP     +IP+E ARD VL +YA FSP+MS IA +FF  NWIDAP  DGK  GAF
Sbjct: 308 DRNAPLPKADTRVIPWEEARDTVLAAYAGFSPEMSEIAGRFFVRNWIDAPARDGKAPGAF 367

Query: 389 AHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASI 448
           AH T+PS HPY+L+NYLGK +DVMTLAHELGHG+H VL++   G L   + LTLAETAS+
Sbjct: 368 AHPTVPSAHPYVLVNYLGKTRDVMTLAHELGHGVHQVLAA-PNGPLMAPTPLTLAETASV 426

Query: 449 FGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPT 508
           FGE LTF +LL  A++   RK++LA K EDM+N++VRQI+FY FE K+H ERR  G++ +
Sbjct: 427 FGEMLTFRALLDKATTPAARKVMLAAKAEDMINTVVRQIAFYTFERKVHAERRD-GELTS 485

Query: 509 HRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIY 568
            RI EIWLE Q ESLGPA  L +  Y +FW  +PHFI S FYVYAYAFG+CLVNSLY +Y
Sbjct: 486 ERIGEIWLEVQAESLGPAIRLGE-GYETFWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVY 544

Query: 569 KSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           +    + F +KY  +L+AG ++H+SELL P  ++ +DP+FW++GL  +E++ID++E M
Sbjct: 545 Q-EAEEGFAKKYFALLKAGGTRHHSELLAPFGLDAADPDFWKKGLSVIERIIDELEAM 601


>gi|154246013|ref|YP_001416971.1| pepF/M3 family oligoendopeptidase [Xanthobacter autotrophicus Py2]
 gi|154160098|gb|ABS67314.1| oligoendopeptidase, pepF/M3 family [Xanthobacter autotrophicus Py2]
          Length = 634

 Score =  591 bits (1523), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 290/593 (48%), Positives = 389/593 (65%), Gaps = 6/593 (1%)

Query: 35  NLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN-QKNCHSLGAAIAE 93
            LP WNL DLYP+ DS E+  D++  +    AF+T ++G LA          +LGAA+  
Sbjct: 45  RLPEWNLTDLYPAMDSPELKADLDKADVACKAFETAFKGKLAALLALPDGGAALGAAVKS 104

Query: 94  YERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEAL 153
           YE + +L+GRIASY  L Y  + S P   KFY DI  +L D    L+FF LE+N LD+A 
Sbjct: 105 YEEVDDLLGRIASYGSLIYAGDTSDPARAKFYGDIQERLTDASTHLLFFTLEMNRLDDAA 164

Query: 154 LEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLR 213
           LE + A DP    Y  W++++RK K + L + +E L  + S   R A  R F E I SLR
Sbjct: 165 LEAAMA-DPALGYYRPWVEDLRKDKPYQLDDKIEQLFHEKSNPSRGAWSRLFDETISSLR 223

Query: 214 FKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRW 273
           F ++ Q + +        D   EVRKSA  AL+ TF K+  +F+ ITNTLAKD+EI DRW
Sbjct: 224 FTVDGQDLAIEPTLNLMQDPREEVRKSAGLALADTFGKNLRLFTLITNTLAKDKEISDRW 283

Query: 274 RKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAP 333
           R +E +A SRHL+N VE  V++A++++++  +P+ SHRYY LK +W   D + FWDR AP
Sbjct: 284 RGFEDVASSRHLANRVEKEVVDAMVEAIRVSFPRLSHRYYALKARWFGKDRLEFWDRNAP 343

Query: 334 LPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTI 393
           LP      I +  A+D VL +Y  FSP+M+ IA+ FF  +WIDAP   GK  GAFAH T+
Sbjct: 344 LPKVETRDIGWGEAKDTVLSAYGAFSPKMADIAKTFFEKSWIDAPVRPGKSPGAFAHPTV 403

Query: 394 PSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETL 453
           PS HPY+LLNY GKP+DVMTLAHELGHG+H VL++  QG L   + LTLAETAS+FGE L
Sbjct: 404 PSAHPYVLLNYQGKPRDVMTLAHELGHGVHQVLAAR-QGALMAPTPLTLAETASVFGEML 462

Query: 454 TFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINE 513
           TF  LL  A +   RKI+LA K+EDM+N++VRQ +FY FE  +H ERR  G++ + +I E
Sbjct: 463 TFRRLLDGAETPRARKIMLAQKVEDMINTVVRQTAFYTFERDVHIERRQ-GELTSEKIGE 521

Query: 514 IWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTV 573
           IW++ Q ESLGPA  L    Y +FW  +PHFI S FYVYAYAFG+CLVNSLY +Y+ N  
Sbjct: 522 IWMKVQGESLGPAIHLG-AGYETFWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVYE-NAA 579

Query: 574 DCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           D F ++YL +L AG +KH++ELL P  ++  DP FW+ GL  +++MI ++E M
Sbjct: 580 DGFADRYLEMLSAGGTKHHAELLAPFGLDARDPAFWQTGLSLIDRMISELESM 632


>gi|148258070|ref|YP_001242655.1| putative oligoendopeptidase F [Bradyrhizobium sp. BTAi1]
 gi|146410243|gb|ABQ38749.1| putative oligoendopeptidase F [Bradyrhizobium sp. BTAi1]
          Length = 664

 Score =  584 bits (1505), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 281/599 (46%), Positives = 398/599 (66%), Gaps = 6/599 (1%)

Query: 29  SQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLA-HATNQKNCHSL 87
           ++  +G LP WNL DLY   D+ EI++D+  ++ E +AF+T ++G LA H         L
Sbjct: 70  AKTGIGTLPEWNLGDLYMGIDAPEIAHDLAKMDAECVAFETDYKGKLAEHVARDDGGEWL 129

Query: 88  GAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEIN 147
            AA+  YE I +L GR+ S+A L++  +   P I KFY DI+ +L      L+FF LE+N
Sbjct: 130 AAAVRRYEAIDDLAGRLGSFAGLAHAGDSVDPAISKFYGDISERLTAASTHLLFFPLELN 189

Query: 148 TLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCE 207
            +D+A++E++  + P    Y  WI+++RK K + L + +E L  + SQ G  A  R F +
Sbjct: 190 RIDDAVIERAM-ETPALGHYRPWIEDLRKDKPYQLEDRVEQLFHEKSQTGYSAWNRLFDQ 248

Query: 208 NIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDE 267
            I  LRF++  +++ +        D D   RK+AA+AL+ TF  +   F+ ITNTLAKD+
Sbjct: 249 TIAGLRFQVGGKELAIEPTLNFLQDRDGAKRKAAAEALAKTFKANERTFALITNTLAKDK 308

Query: 268 EIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYF 327
           +I DRWR ++ +ADSRHL+N VE  V++AL+ SV+  YPK SHRYY+LK +W K   +  
Sbjct: 309 DISDRWRGFQDVADSRHLNNRVEREVVDALVASVRAAYPKLSHRYYQLKARWFKKKKLAH 368

Query: 328 WDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGA 387
           WDR APLP  +   I +  A+++VL +Y  FSP+M+ IA++FF  +WIDAP   GK  GA
Sbjct: 369 WDRNAPLPFAANATIAWPDAKNMVLTAYRGFSPEMADIAQRFFDQSWIDAPVRPGKAPGA 428

Query: 388 FAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETAS 447
           F+H T PS HPY+L+NY GKP+DVMTLAHELGHG+H VL++  QG L   + LTLAETAS
Sbjct: 429 FSHPTTPSAHPYVLMNYQGKPRDVMTLAHELGHGVHQVLAAR-QGALMAPTPLTLAETAS 487

Query: 448 IFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIP 507
           +FGE LTF  LL      ++R+ LLA K+EDM+N++VRQI+FY FE  +HTER++ G++ 
Sbjct: 488 VFGEMLTFKRLLSETRDAKQRQALLAGKVEDMINTVVRQIAFYSFERAVHTERKN-GELT 546

Query: 508 THRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDI 567
             R+ +IWL  Q ESLG A ++    Y +FWM +PHFI S FYVYAYAFG+CLVNSLY +
Sbjct: 547 AERLGQIWLSVQTESLGEAIEIKP-GYENFWMYIPHFIHSPFYVYAYAFGDCLVNSLYAV 605

Query: 568 YKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           Y+ +  + F E+YL +L AG +KHYSELL P  ++  DP FW+ GL  +  MID++E+M
Sbjct: 606 YE-HAAEGFAERYLAMLAAGGTKHYSELLAPFGLDAKDPKFWDGGLSVIAGMIDELERM 663


>gi|220920260|ref|YP_002495561.1| oligoendopeptidase, pepF/M3 family [Methylobacterium nodulans ORS
           2060]
 gi|219944866|gb|ACL55258.1| oligoendopeptidase, pepF/M3 family [Methylobacterium nodulans ORS
           2060]
          Length = 616

 Score =  583 bits (1504), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 284/606 (46%), Positives = 388/606 (64%), Gaps = 6/606 (0%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAH-ATN 80
           S    M    +LG LP W+L DLY   D    + D+   E E  AF   ++G +A  A  
Sbjct: 14  SAAQAMARAVDLGPLPEWDLSDLYAGLDDPAFARDLARAEAECRAFAEAYQGRIAALAAG 73

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
                 LG A+A YE + +L+GR+ S+A L Y+ + + P   KFY D   +L      L+
Sbjct: 74  DGASDRLGTAVAAYEALEDLMGRLLSFAGLVYSGDTTDPARAKFYGDTQERLTAASSDLL 133

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           FF LE+N + + +L+ + A  PL  +Y  WI++IR+ K H LS+++E LL + S  GR A
Sbjct: 134 FFTLELNRVPDEVLDAATALPPLA-RYRPWIEDIRREKPHQLSDELERLLLEKSVTGRAA 192

Query: 201 LKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFIT 260
             R F E + SLRF +  + + L        D+D  +R+ AA+ALS  F  +  +F+ IT
Sbjct: 193 WNRLFDETVASLRFPVRGELLTLEPTLNKLQDADEGLRRDAAEALSGVFRANLRLFTLIT 252

Query: 261 NTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWL 320
           NTLAKD+EI DRWR++  +ADSRHL+N VEP V+ AL+++V   YP+ SHRYY LK +W 
Sbjct: 253 NTLAKDKEIADRWRRFGDVADSRHLANRVEPEVVAALVEAVTAAYPRLSHRYYRLKARWF 312

Query: 321 KLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQY 380
             D++ +WDR APLP   Q  IP+  AR+ VL +Y  FSP+M+ IA  FF   WIDAP  
Sbjct: 313 GRDSLAYWDRNAPLPKVEQRTIPWAEARETVLSAYGAFSPRMAEIARTFFDGGWIDAPVR 372

Query: 381 DGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSL 440
            GK  GAFAH T+PS HPY+L+NY GKP+DVMTLAHELGHG+H VL++   G L   + L
Sbjct: 373 PGKAPGAFAHPTVPSSHPYVLVNYQGKPRDVMTLAHELGHGVHQVLAA-GNGALMAPTPL 431

Query: 441 TLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTER 500
           TLAETAS+FGE LTF  +L A + + +R+ LLA K+EDM+N++VRQI+FY FE +LH  R
Sbjct: 432 TLAETASVFGEMLTFRRVLDATTDRRQRRALLAAKVEDMINTVVRQIAFYVFERELHLAR 491

Query: 501 RSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCL 560
           R+ G++   +I  +W+  Q ESLGPA  L D  Y  FW  +PHFI S FYVYAYAFG+CL
Sbjct: 492 RA-GELTADQICALWMSVQAESLGPAIRL-DAGYEPFWAYIPHFIHSPFYVYAYAFGDCL 549

Query: 561 VNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMI 620
           VNSLY +Y+ N  + F ++Y  +L AG SK Y ELL P  ++  DP+FW+ GL  +E MI
Sbjct: 550 VNSLYGVYR-NAEEGFVDRYFALLSAGGSKPYGELLAPFGLDARDPSFWQIGLSMIEGMI 608

Query: 621 DDVEKM 626
            ++E+M
Sbjct: 609 AELEEM 614


>gi|39937245|ref|NP_949521.1| peptidase M3B oligoendopeptidase-like clade 3 [Rhodopseudomonas
           palustris CGA009]
 gi|39651103|emb|CAE29626.1| putative oligoendopeptidase F [Rhodopseudomonas palustris CGA009]
          Length = 638

 Score =  583 bits (1503), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 287/592 (48%), Positives = 391/592 (66%), Gaps = 6/592 (1%)

Query: 36  LPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS-LGAAIAEY 94
           LP WNL DLYP+  S E++ D++ ++ E  +F+  ++G LA  T +      L  A+  Y
Sbjct: 51  LPEWNLMDLYPAIGSPEVAADLDRLDAECASFEADFKGRLAEETAKDGGALWLAGAVKRY 110

Query: 95  ERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALL 154
           E I +L GR+ SYA L +  +   P   KFY D++ +L      L+FF LE+N +D+A+L
Sbjct: 111 EAIEDLAGRLGSYAGLVHAGDSVDPVKSKFYGDVSERLTAASVHLLFFTLELNRVDDAVL 170

Query: 155 EQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF 214
           E +  Q P    Y  WI+++RK K + L + +E L  + SQ G  A  R F + I SLRF
Sbjct: 171 ETAM-QTPELGHYRPWIEDLRKDKPYQLEDRIEQLFHEKSQTGYGAFNRLFDQTISSLRF 229

Query: 215 KINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWR 274
           ++  +++ +        D     RK AA+AL+ TF  +   F+ ITNTLAKD+EI DRWR
Sbjct: 230 RVGGKELAIEPTLNLMQDRAPAKRKVAAEALAKTFKANERTFALITNTLAKDKEISDRWR 289

Query: 275 KYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPL 334
            +E +ADSRHL+N VE  V++AL+ SV+  YPK SHRYY+LK  W K   + +WDR APL
Sbjct: 290 GFEDVADSRHLANRVEREVVDALVASVRAAYPKLSHRYYKLKAGWFKKKKLPYWDRNAPL 349

Query: 335 PGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIP 394
           P  +   I +  AR++VL +Y  FSP+M+ IAE+FFT  WIDAP   GK  GAF+H T P
Sbjct: 350 PFAATGSIAWPDARNMVLTAYKAFSPEMAQIAERFFTDRWIDAPVRPGKAPGAFSHPTTP 409

Query: 395 SVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLT 454
           S HPY+L+NY GKP+DVMTLAHELGHG+H VL+++  G L   + LTLAETAS+FGE LT
Sbjct: 410 SAHPYVLMNYQGKPRDVMTLAHELGHGVHQVLAAK-NGALMAPTPLTLAETASVFGEMLT 468

Query: 455 FDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEI 514
           F  LL     +++R+ LLA K+EDM+N++VRQI+FY FE  +HTERRS G++   RI EI
Sbjct: 469 FRRLLTQTKDRKQRQALLAGKVEDMINTVVRQIAFYSFERAVHTERRS-GELTAQRIGEI 527

Query: 515 WLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVD 574
           WL  Q ESLGPA ++    Y SFWM +PHFI S FYVYAYAFG+CLVNSLY +Y+ +  +
Sbjct: 528 WLSVQGESLGPAIEIKP-GYESFWMYIPHFIHSPFYVYAYAFGDCLVNSLYAVYE-HAQE 585

Query: 575 CFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            F E+YL +L AG +KHYSELL P  ++  +P+FW+ GL  +  MID++E M
Sbjct: 586 GFAERYLAMLAAGGTKHYSELLAPFGLDAKNPSFWDGGLSVIAGMIDELEAM 637


>gi|86748556|ref|YP_485052.1| peptidase M3B, oligoendopeptidase-like clade 3 [Rhodopseudomonas
           palustris HaA2]
 gi|86571584|gb|ABD06141.1| Peptidase M3B, oligoendopeptidase-related clade 3 [Rhodopseudomonas
           palustris HaA2]
          Length = 610

 Score =  582 bits (1501), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 286/593 (48%), Positives = 390/593 (65%), Gaps = 6/593 (1%)

Query: 35  NLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLA-HATNQKNCHSLGAAIAE 93
            LP WNL DLY + D+ +++ D++ ++ E  AF+  ++G LA  A        L  A+  
Sbjct: 22  KLPEWNLADLYSAIDAPQVAADLDRLDAECAAFEAEFKGKLAEQAAADGGGAWLAGAVKR 81

Query: 94  YERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEAL 153
           YE I +L GR+ SYA L +  +   P   KFY D++ +L      L+FF+LE+N +D+A+
Sbjct: 82  YEAIEDLAGRLGSYAGLVHAGDSVDPVKSKFYGDVSERLTAASVHLLFFSLELNRVDDAV 141

Query: 154 LEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLR 213
           LE++  Q P    Y  WI+++RK K + L + +E L  + SQ G  A  R F + I  LR
Sbjct: 142 LERAM-QAPELGHYRPWIEDLRKDKPYQLDDRVEQLFHEKSQTGYGAFNRLFDQTISGLR 200

Query: 214 FKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRW 273
           FK+  +++ +        D     RK+AA+AL+ TF  +   F+ ITNTLAKD+EI DRW
Sbjct: 201 FKLGGKELAIEPTLNLLQDRTPAKRKAAAEALAKTFKANERTFALITNTLAKDKEISDRW 260

Query: 274 RKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAP 333
           R +E +ADSRHL+N VE  V++AL+ SV+  YP+ SHRYY+LK  W     +  WDR AP
Sbjct: 261 RGFEDVADSRHLANRVEREVVDALVASVRAAYPRLSHRYYKLKAGWFGKKKLPHWDRNAP 320

Query: 334 LPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTI 393
           LP  +   I +  AR++VL +Y+ FSP+M+ IAE+FFT  WIDAP   GK  GAF+H T 
Sbjct: 321 LPFAATGSIAWPEAREMVLTAYSAFSPEMARIAERFFTDRWIDAPVRPGKAPGAFSHPTT 380

Query: 394 PSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETL 453
           PS HPY+L+NY GKP+DVMTLAHELGHG+H VL++   G L   + LTLAETAS+FGE L
Sbjct: 381 PSAHPYVLMNYQGKPRDVMTLAHELGHGVHQVLAA-GNGALMAPTPLTLAETASVFGEML 439

Query: 454 TFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINE 513
           TF  LL    S ++R+ LLA K+EDM+N++VRQI+FY FE  +HTERRS G++   RI E
Sbjct: 440 TFRRLLSQTKSAKQRQALLAGKVEDMINTVVRQIAFYSFERAIHTERRS-GELTAQRIGE 498

Query: 514 IWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTV 573
           IWL  Q ESLGPA ++    Y SFWM +PHFI S FYVYAYAFG+CLVNSLY +Y+ +  
Sbjct: 499 IWLGVQSESLGPAIEIKP-GYESFWMYIPHFIHSPFYVYAYAFGDCLVNSLYAVYE-HAQ 556

Query: 574 DCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           + F E+YL +L AG +KHYSELL P  ++  DP+FW+ GL  +  MID++E M
Sbjct: 557 EGFAERYLAMLSAGGTKHYSELLAPFGLDAKDPSFWDGGLSVIAGMIDELEAM 609


>gi|75675186|ref|YP_317607.1| peptidase M3B, oligoendopeptidase-related clade 3 [Nitrobacter
           winogradskyi Nb-255]
 gi|74420056|gb|ABA04255.1| peptidase M3B, oligoendopeptidase-related clade 3 [Nitrobacter
           winogradskyi Nb-255]
          Length = 625

 Score =  582 bits (1501), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 283/597 (47%), Positives = 394/597 (65%), Gaps = 6/597 (1%)

Query: 29  SQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS-L 87
           ++   G LP WNL DLY   D+ EI+ D++ I+ E  AF+  ++G LA  T+     + L
Sbjct: 31  AKSGAGRLPEWNLADLYAGIDAPEIARDLDRIDAECRAFEADYKGRLATETSGPEGGAWL 90

Query: 88  GAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEIN 147
             A+  YE I +L GR+AS+A L +  +   P I KFY D++ +L      L+FF LE+N
Sbjct: 91  AGAVRRYEAIDDLAGRLASFAGLIHAGDSVDPAISKFYGDVSERLTAASLHLLFFPLELN 150

Query: 148 TLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCE 207
            LD+ ++E++  Q P    Y  WI++ RK K + L + +E L  + SQ G  A  R F +
Sbjct: 151 RLDDDVIERAM-QTPELGHYRPWIEDSRKDKPYQLEDRLEQLFHEKSQTGYSAWNRLFDQ 209

Query: 208 NIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDE 267
            I  LRFK+  +++ +  A     D   E RK+A +AL+ TF  +   F+ ITNTLAKD+
Sbjct: 210 TIAGLRFKVGAKELAIEPALNLLQDRSPEKRKAAGQALAKTFKANERTFALITNTLAKDK 269

Query: 268 EIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYF 327
           +I DRWR ++ +ADSRHL+N VE  V++AL+ SV+  YP+ SHRYY LK +W K   +  
Sbjct: 270 DISDRWRGFQDVADSRHLNNRVEREVVDALVASVRAAYPRLSHRYYALKARWFKKKKLAH 329

Query: 328 WDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGA 387
           WDR APLP  +  +IP+  AR +VL +Y +FSP+M+ IAE+FFT  WIDAP   GK  GA
Sbjct: 330 WDRNAPLPFAATGVIPWGDARKMVLSAYGEFSPEMAGIAERFFTDRWIDAPVRPGKAPGA 389

Query: 388 FAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETAS 447
           F+H T PS HPY+L+NY GKP+DVMTLAHELGHG+H VL+++  G L   + LTLAETAS
Sbjct: 390 FSHPTTPSAHPYVLMNYQGKPRDVMTLAHELGHGVHQVLAAKN-GALMAPTPLTLAETAS 448

Query: 448 IFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIP 507
           +FGE LTF  LL    + ++R+ LLA K+EDM+N++VRQI+FY FE  +HTER+  G++ 
Sbjct: 449 VFGEMLTFKRLLAQTKNAKQRQALLAGKVEDMINTVVRQIAFYTFERAVHTERKD-GELT 507

Query: 508 THRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDI 567
             R+ ++WL  Q ESLGPA ++    Y +FWM +PHFI S FYVYAYAFG+CLVNSLY +
Sbjct: 508 AERLGQLWLSVQGESLGPAIEIKP-GYETFWMYIPHFIHSPFYVYAYAFGDCLVNSLYAV 566

Query: 568 YKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVE 624
           Y+ +  + F E+YL +L AG +KHYSELL P  ++  DP FW+ GL  +  MID++E
Sbjct: 567 YE-HASEGFAERYLAMLAAGGTKHYSELLKPFELDARDPKFWDGGLSVIAGMIDELE 622


>gi|296447486|ref|ZP_06889410.1| oligoendopeptidase, pepF/M3 family [Methylosinus trichosporium
           OB3b]
 gi|296255024|gb|EFH02127.1| oligoendopeptidase, pepF/M3 family [Methylosinus trichosporium
           OB3b]
          Length = 617

 Score =  580 bits (1495), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 284/594 (47%), Positives = 394/594 (66%), Gaps = 6/594 (1%)

Query: 34  GNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNL-AHATNQKNCHSLGAAIA 92
           G LP WNL DLYP+ DS  ++ D+   E ++ +F   + G L A A       +LG A+A
Sbjct: 26  GGLPEWNLADLYPAMDSPALTADLATAERDAASFAADYRGRLQALAEGAAANETLGEAVA 85

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
            YE + EL+GRI SYA L Y+ + S P   KFY D+  K+ D    L+FF LE+N LD+A
Sbjct: 86  RYEALQELLGRIMSYAGLVYSGDTSDPARAKFYGDMQGKITDISTQLLFFQLELNRLDDA 145

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
           LL+ +  + PL+ ++  W+++IRK K + LS+++E L  + S  GR A  R F E I SL
Sbjct: 146 LLDAAAEKAPLS-RWRPWLEDIRKEKPYELSDELERLFHEKSMTGRAAWNRLFDETIASL 204

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           RF++  +++ L  A     D+  ++R+ AA A+  T   +   F+ +TNTLAKD+EI DR
Sbjct: 205 RFQVGGKELTLEPALNLMQDTSEDIRREAALAVGATLKANLRTFALVTNTLAKDKEISDR 264

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR +  +AD+RHLSN VEP V+EAL+ SV   +PK SHRYY+LK KW   + + +WDR A
Sbjct: 265 WRGFHDVADARHLSNRVEPEVVEALVASVVAAHPKLSHRYYKLKAKWFGKEALDYWDRNA 324

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP     +  ++ ARD+VL +Y++F+P+M+ IA +FF  NWIDAP   GK  GAFAH T
Sbjct: 325 PLPQVPSHVYAWDEARDIVLSAYSRFAPRMAEIASRFFERNWIDAPVRPGKAPGAFAHPT 384

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +PSVHPY+L+N+ GK +DVMTLAHELGHG+H VL+   QG L   + LTLAETAS+FGE 
Sbjct: 385 VPSVHPYVLVNFQGKTRDVMTLAHELGHGVHQVLAG-AQGALMAPTPLTLAETASVFGEM 443

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF +LL   S  E+++ LLA K+EDMLN++VRQI+FY FE K+H  R+  G++   ++ 
Sbjct: 444 LTFRALLAGTSDPEKKRALLAAKVEDMLNTVVRQIAFYSFERKVHIARKE-GELTAEKLC 502

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
           E+W+  Q +SLGP+  LSD  Y SFW  +PHF+ S FYVYAYAFG+CLVNSLY +Y+   
Sbjct: 503 ELWMSVQADSLGPSIRLSD-GYESFWAYIPHFVHSPFYVYAYAFGDCLVNSLYGVYQKAE 561

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              F E+Y  +L AG +K Y ELL P  ++  DP FW  GL+ +E +I ++E M
Sbjct: 562 T-GFAERYFALLEAGGAKPYGELLAPFGLDARDPAFWGIGLEMIEGLIAELEAM 614


>gi|217978714|ref|YP_002362861.1| oligoendopeptidase, pepF/M3 family [Methylocella silvestris BL2]
 gi|217504090|gb|ACK51499.1| oligoendopeptidase, pepF/M3 family [Methylocella silvestris BL2]
          Length = 620

 Score =  580 bits (1494), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 284/595 (47%), Positives = 383/595 (64%), Gaps = 5/595 (0%)

Query: 32  NLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAI 91
           +LG+LP WNL  LYP+ DS E + D+     E  AF   ++G +A      +  SL AA+
Sbjct: 27  DLGDLPEWNLSALYPAPDSPEFAGDLARAATECKAFAEAFKGRIAELAADSSGASLTAAV 86

Query: 92  AEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDE 151
             YE + EL+GRI SYA L Y  + S P   KFY D   K+ +    L+FF LE+N LD+
Sbjct: 87  KHYEALDELLGRIMSYAGLIYAGDTSDPVRAKFYGDAQEKITNASSDLLFFELELNRLDD 146

Query: 152 ALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIES 211
             L+ + AQ+PL   Y  WI+++RK K + LS+++E L  + S     A  R F E I +
Sbjct: 147 GALDAALAQEPLA-HYRPWIEDVRKGKPYQLSDELEKLFHEKSSTSYSAWNRLFDETITA 205

Query: 212 LRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
           LRF ++ +++ +        D +   R+ AAK L      +   F+ ITNTLAKD+EI D
Sbjct: 206 LRFPLDGKELSIEPVLNLLQDPNEAAREKAAKILGSVLKDNLRQFALITNTLAKDKEISD 265

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRL 331
           RWR ++ +ADSRHLSN VE  V++AL+ +V+  YP+ SHRYY LK KW     + FWDR 
Sbjct: 266 RWRGFQDVADSRHLSNRVEREVVDALVGAVRAAYPRLSHRYYRLKAKWFGKPALKFWDRN 325

Query: 332 APLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHG 391
           APLP     +  ++ ARD VL +Y  FSP+M+ IA +FF   WIDAP   GK  GAFAH 
Sbjct: 326 APLPDAPARVYKWDAARDAVLGAYGDFSPKMADIARRFFDERWIDAPVRPGKSPGAFAHP 385

Query: 392 TIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE 451
           T+PS HP++LLNY GKP+DVMTLAHELGHG+H VL++   G L   + LTLAETAS+FGE
Sbjct: 386 TVPSAHPFVLLNYQGKPRDVMTLAHELGHGVHQVLAAHN-GALMAPTPLTLAETASVFGE 444

Query: 452 TLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRI 511
            LTF +LL  A +  ER+ +LA K+EDMLN++VRQI+FY FE K+HTERR  G++    +
Sbjct: 445 MLTFRALLARAGTLAERRAMLAGKVEDMLNTVVRQIAFYSFERKVHTERRK-GELTADNL 503

Query: 512 NEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSN 571
            + W+E Q ESLGPA + +D +Y S+W  +PHFI S FYVYAYAFG+CLVNSLY +Y+ N
Sbjct: 504 CDFWMEEQSESLGPAIEFTD-DYRSYWAYIPHFIHSPFYVYAYAFGDCLVNSLYGVYQ-N 561

Query: 572 TVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
             + F E+Y  +L AG SK Y ELL P  ++  DP FW+ GL  +E MI ++E +
Sbjct: 562 ASEGFAERYFALLSAGGSKPYGELLKPFGLDARDPAFWQIGLSMIEGMIAELEAL 616


>gi|91975890|ref|YP_568549.1| peptidase M3B, oligoendopeptidase-like clade 3 [Rhodopseudomonas
           palustris BisB5]
 gi|91682346|gb|ABE38648.1| Peptidase M3B, oligoendopeptidase-related clade 3 [Rhodopseudomonas
           palustris BisB5]
          Length = 632

 Score =  580 bits (1494), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 285/593 (48%), Positives = 387/593 (65%), Gaps = 6/593 (1%)

Query: 35  NLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAH-ATNQKNCHSLGAAIAE 93
            LP WNL DLYP+ D+ +++ D++ ++ +  +F+  ++G LA  A        L +A+  
Sbjct: 44  KLPEWNLADLYPAIDAPQVAADLDRLDADCASFEADFKGKLAEEAVKDGGGAWLASAVRR 103

Query: 94  YERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEAL 153
           YE I +L GR+ SYA L +  +   P   KFY D++ +L      L+FFALE+N +D+ +
Sbjct: 104 YEAIEDLAGRLGSYAGLVHAGDSVDPVKSKFYGDVSERLTAASVHLLFFALELNRVDDEV 163

Query: 154 LEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLR 213
           LE++  Q P    Y  WI+++RK K + L + +E L  + SQ G  A  R F + I SLR
Sbjct: 164 LERAM-QTPELGHYRPWIEDLRKDKPYQLEDRVEQLFHEKSQTGYGAFNRLFDQTISSLR 222

Query: 214 FKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRW 273
           FK+  ++  +        D     RK+AA AL+ TF  +   F+ ITNTLAKD+EI DRW
Sbjct: 223 FKVGGKEQAIEPTLNLLQDRTPAKRKAAADALAKTFKANERTFALITNTLAKDKEISDRW 282

Query: 274 RKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAP 333
           R +E +ADSRHL+N VE  V++AL+ SV+  YP+ SHRYY+LK  W     +  WDR AP
Sbjct: 283 RGFEDVADSRHLNNRVEREVVDALVASVRGAYPRLSHRYYKLKAGWFGKKKLPHWDRNAP 342

Query: 334 LPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTI 393
           LP  +   I +  AR++VL +Y  FSP+M+ IAE+FFT  WIDAP   GK  GAF+H T 
Sbjct: 343 LPFAATGSIAWPEARNMVLTAYNAFSPEMARIAERFFTDRWIDAPVRPGKAPGAFSHPTT 402

Query: 394 PSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETL 453
           PS HPY+L+NY GKP+DVMTLAHELGHG+H VL++   G L   + LTLAETAS+FGE L
Sbjct: 403 PSAHPYVLMNYQGKPRDVMTLAHELGHGVHQVLAA-GNGALMAPTPLTLAETASVFGEML 461

Query: 454 TFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINE 513
           TF  LL    S ++R+ LLA K+EDM+N++VRQI+FY FE  +HTERR  G++   RI E
Sbjct: 462 TFRRLLAQTKSAKQRQALLAGKVEDMINTVVRQIAFYSFERAIHTERRG-GELTAQRIGE 520

Query: 514 IWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTV 573
           IWL  Q ESLGPA D+    Y  FWM +PHFI S FYVYAYAFG+CLVNSLY +Y+ N  
Sbjct: 521 IWLSVQGESLGPAIDIRP-GYEHFWMYIPHFIHSPFYVYAYAFGDCLVNSLYAVYE-NAQ 578

Query: 574 DCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           + F ++YL +L AG +KHYSELL P  ++  DP FW+ GL  +  MID++E+M
Sbjct: 579 EGFADRYLAMLSAGGTKHYSELLAPFGLDAKDPTFWDGGLSVIAGMIDELEEM 631


>gi|92116784|ref|YP_576513.1| peptidase M3B, oligoendopeptidase-related clade 3 [Nitrobacter
           hamburgensis X14]
 gi|91799678|gb|ABE62053.1| Peptidase M3B, oligoendopeptidase-related clade 3 [Nitrobacter
           hamburgensis X14]
          Length = 626

 Score =  579 bits (1492), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 278/599 (46%), Positives = 396/599 (66%), Gaps = 6/599 (1%)

Query: 29  SQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS-L 87
           ++ + G LP WNL DLY   D+ E++ D++ ++ +  AF+  ++G LA  T + +  + L
Sbjct: 32  AKPDAGRLPEWNLADLYAGIDAPEVTRDLDKVDADCEAFEADYKGKLAEETAKPDGGAWL 91

Query: 88  GAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEIN 147
             A+  YE I +L GR+ SYA L +  +   P I KFY D++ +L      L+FFALE+N
Sbjct: 92  ADAVRRYEAIDDLAGRLGSYAGLIHAGDSVDPAISKFYGDVSERLTTASVHLLFFALELN 151

Query: 148 TLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCE 207
            +D+ ++E++  Q P    Y  WI++ RK K + L + +E L  + SQ G  A  R F +
Sbjct: 152 RIDDDVIERAM-QTPELGHYRPWIEDSRKDKPYQLEDRVERLFHEKSQTGYSAWNRLFDQ 210

Query: 208 NIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDE 267
            I  LRF++  +++ +        D   E RK+A +AL+ TF  +   F+ ITNTLAKD+
Sbjct: 211 TIAGLRFRVGTRELAIEPTLNLLQDRSPERRKAAGQALAKTFKANERTFALITNTLAKDK 270

Query: 268 EIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYF 327
           +I DRWR ++ +ADSRHL+N VE  V++AL+ SV+  YP+ SHRYY LK +W K   +  
Sbjct: 271 DISDRWRGFQDVADSRHLNNRVEREVVDALVASVRAAYPRLSHRYYALKARWFKKKKLAH 330

Query: 328 WDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGA 387
           WDR APLP  +  +IP+  AR +VL +Y  FSP+M+ IAE+FFT  WIDAP   GK  GA
Sbjct: 331 WDRNAPLPFAATGVIPWTDARKMVLTAYGDFSPKMAGIAEQFFTDRWIDAPVRPGKAPGA 390

Query: 388 FAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETAS 447
           F+H T PS HPY+L+NY GKP+DVMTLAHELGHG+H VL+++  G L   + LTLAETAS
Sbjct: 391 FSHPTTPSAHPYVLMNYQGKPRDVMTLAHELGHGVHQVLAAK-NGALMAPTPLTLAETAS 449

Query: 448 IFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIP 507
           +FGE LTF  LL    + ++R+ LLA K+EDM+N++VRQI+FY FE  +HTER++ G++ 
Sbjct: 450 VFGEMLTFKRLLAQTKNAKQRQALLAGKVEDMINTVVRQIAFYTFERAVHTERKN-GELT 508

Query: 508 THRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDI 567
             RI ++WL  Q ESLGPA ++    Y +FWM +PHFI S FYVYAYAFG+CLVNSLY +
Sbjct: 509 AERIGQLWLSVQGESLGPAIEIRP-GYETFWMYIPHFIHSPFYVYAYAFGDCLVNSLYAV 567

Query: 568 YKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           Y+ +  + F ++YL +L AG ++HYSELL P  ++  DP FW+ GL  +  MID++E M
Sbjct: 568 YE-HASEGFADRYLAMLAAGGTRHYSELLRPFGLDARDPKFWDGGLSVIAGMIDELETM 625


>gi|85716087|ref|ZP_01047063.1| peptidase M3B, oligoendopeptidase-related clade 3 [Nitrobacter sp.
           Nb-311A]
 gi|85697086|gb|EAQ34968.1| peptidase M3B, oligoendopeptidase-related clade 3 [Nitrobacter sp.
           Nb-311A]
          Length = 625

 Score =  578 bits (1491), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 286/616 (46%), Positives = 397/616 (64%), Gaps = 10/616 (1%)

Query: 12  NAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRW 71
           +AF RK  R +       +   G LP WNL DLY    + E+  D++ I+ E  AF+  +
Sbjct: 18  HAFRRKPARKAAAV----KSGAGGLPEWNLADLYAGIGAPEVVRDLDRIDAECKAFEADY 73

Query: 72  EGNLAHAT-NQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINA 130
           +G LA  T N +    L  A+  YE I +L GR+ SYA L++  +   P I KFY D++ 
Sbjct: 74  KGKLATETSNPEGGTWLAEAVRRYEAIDDLAGRLGSYAGLAHAGDSVDPAISKFYGDVSE 133

Query: 131 KLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLL 190
           +L      L+FF LE+N +D+ ++E++    P    Y  WI++ RK K + L + +E L 
Sbjct: 134 RLTAASLHLLFFPLELNRIDDEVIERAM-HAPELAHYRPWIEDSRKDKPYQLEDRLEQLF 192

Query: 191 SDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFN 250
            + SQ G  A  R F + I  LRFK+  +++ +        D   E RK+A +AL+ TF 
Sbjct: 193 HEKSQTGYSAWNRLFDQTIAGLRFKVGAKELAIEPTLNLLQDRSPEKRKAAGQALAKTFK 252

Query: 251 KSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSH 310
            +   F+ ITNTLAKD++I DRWR ++ +ADSRHL+N VE  V++AL+ SV+  YP+ SH
Sbjct: 253 ANERTFALITNTLAKDKDISDRWRGFQDVADSRHLNNRVEREVVDALVASVRAAYPRLSH 312

Query: 311 RYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFF 370
           RYY LK +W K   +  WDR APLP  +   I +  AR +VL +Y +FSP M+ IAE+FF
Sbjct: 313 RYYALKARWFKKKKLAHWDRNAPLPFAATGAISWNDARKMVLTAYDEFSPVMAGIAERFF 372

Query: 371 THNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSET 430
           T  WIDAP   GK  GAF+H T PS HPY+L+NY GKP+DVMTLAHELGHG+H VL+++ 
Sbjct: 373 TDRWIDAPVRPGKAPGAFSHPTTPSAHPYVLMNYQGKPRDVMTLAHELGHGVHQVLAAK- 431

Query: 431 QGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFY 490
           QG L   + LTLAETAS+FGE LTF  LL    S ++R+ LLA K+EDM+N++VRQI+FY
Sbjct: 432 QGALMAPTPLTLAETASVFGEMLTFKRLLAQTKSAKQRQALLAGKVEDMINTVVRQIAFY 491

Query: 491 DFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFY 550
            FE  +HTER++ G++   R+ ++WL  Q ESLGPA ++    Y +FWM +PHFI S FY
Sbjct: 492 TFERAVHTERKN-GELTAERLGQLWLSVQGESLGPAIEIKP-GYETFWMYIPHFIHSPFY 549

Query: 551 VYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWE 610
           VYAYAFG+CLVNSLY +Y+ +  + F E+YL +L AG +KHYSELL P  ++  DP FW+
Sbjct: 550 VYAYAFGDCLVNSLYAVYE-HAAEGFAERYLAMLAAGGTKHYSELLSPFGLDARDPKFWD 608

Query: 611 RGLQTVEKMIDDVEKM 626
            GL  +  MID++E+M
Sbjct: 609 GGLSVIAGMIDELERM 624


>gi|182677367|ref|YP_001831513.1| pepF/M3 family oligoendopeptidase [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182633250|gb|ACB94024.1| oligoendopeptidase, pepF/M3 family [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 622

 Score =  578 bits (1490), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 287/594 (48%), Positives = 385/594 (64%), Gaps = 5/594 (0%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           LG LP WNL DLYP+ DS   + D+     E+ AF   ++G L       +   L  A+ 
Sbjct: 31  LGTLPEWNLADLYPAPDSPLFARDLAHAVAEAKAFAEAYKGRLETLAMDPSSTGLIEAVR 90

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
            YE + EL+GR+ SYA L Y  + S     KFY D + ++      L+FF LE+N LD+A
Sbjct: 91  RYETVEELLGRLMSYAGLHYYGDTSDAARAKFYGDTHEEITKASSDLLFFELELNRLDDA 150

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
           L+E++    PL   Y  WI++IRK K H L + +E L  D S   R A  R F E I +L
Sbjct: 151 LIEKALKGTPLE-HYRPWIEDIRKEKPHQLDDRLEQLFLDKSVTCRSAWNRLFDETISAL 209

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           RFK++DQ++ L  A     D D +VR+  A A++ T   +   F+ I+NTLAKD+EI DR
Sbjct: 210 RFKVDDQELTLELALNLMQDEDTKVREKGANAIAETLKANLRTFTLISNTLAKDKEISDR 269

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR ++ IADSRHLSN VE  V++AL+ +V   YP+ SHRYY+LK KW  LD +  WDR A
Sbjct: 270 WRGFQDIADSRHLSNRVEREVVDALVAAVHAAYPRLSHRYYKLKAKWFGLDQLNHWDRNA 329

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP  +    P+  ARD VL +Y  FS  M+ IA++FF + WIDAP   GK  GAFAH T
Sbjct: 330 PLPNIAAKTYPWAEARDTVLDAYGAFSADMAGIAKRFFDNGWIDAPARPGKAPGAFAHPT 389

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +PS HPY+LLNYLGKP+DVMTLAHELGHG+H VL+    G L   + LTLAETAS+FGE 
Sbjct: 390 VPSAHPYVLLNYLGKPRDVMTLAHELGHGVHQVLAG-PNGALMAPTPLTLAETASVFGEM 448

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF +LL   ++  ER+ +LA K+EDM+N++VRQI+FY FE KLHT RR  G++   ++ 
Sbjct: 449 LTFRTLLARTTNVTERRAMLAAKVEDMINTVVRQIAFYTFERKLHTARRE-GELTAEQVC 507

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
           E+W+  Q ESLGP+  L    Y +FW  +PHFI S FYVYAYAFG+CLVNSLY +Y+ + 
Sbjct: 508 ELWMSVQAESLGPSIKLGP-GYETFWAYIPHFIHSPFYVYAYAFGDCLVNSLYGVYEKSR 566

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + F E+YL +L AG +KH++ELL P  ++  DP+FW+ GL  +E MI ++E +
Sbjct: 567 -EGFAERYLAMLSAGGTKHHAELLAPFGLDARDPSFWQIGLSMIEGMIGELESL 619


>gi|188582122|ref|YP_001925567.1| oligoendopeptidase, pepF/M3 family [Methylobacterium populi BJ001]
 gi|179345620|gb|ACB81032.1| oligoendopeptidase, pepF/M3 family [Methylobacterium populi BJ001]
          Length = 601

 Score =  578 bits (1489), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 288/613 (46%), Positives = 388/613 (63%), Gaps = 15/613 (2%)

Query: 15  FRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGN 74
            R AL+++D         LG LP W+L DLYPS D+    +D++  E ES  F  R+ G 
Sbjct: 1   MRGALQAAD---------LGALPEWDLTDLYPSMDAPAFRDDLDRAEAESRTFAERYAGR 51

Query: 75  LAHATNQKNCHS-LGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA 133
           +A      +  + LG A+  YERI +L+GR+ SYA L Y+ + +     KFY D   +L 
Sbjct: 52  IAGIAAAPDASTVLGEAVETYERIEDLMGRLMSYAGLVYSGDTTDEIRAKFYGDTRERLT 111

Query: 134 DFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDT 193
                L+FF LE+N +++A+L+ + A  PL  +Y  WI+++R+ K H L +  E L  + 
Sbjct: 112 TASGDLLFFGLELNRVEDAVLDAAMADGPLA-RYRPWIEDLRREKPHQLDDRTEKLFLEK 170

Query: 194 SQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSS 253
           S     A  R F E I SLRF +  +++ L        D D  VRK AA A+  T   + 
Sbjct: 171 SVTSSAAWDRLFNETIASLRFPVQGERLTLEPTLNKLQDPDGAVRKEAALAIGDTLQANL 230

Query: 254 HIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY 313
            IF+ ITNTLAKD+EI DRWR ++ +AD+RHLSN VEP V+ A++++V+  YP+ SHRYY
Sbjct: 231 RIFTLITNTLAKDKEISDRWRGFKDVADARHLSNRVEPEVVAAMVEAVRAAYPRLSHRYY 290

Query: 314 ELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHN 373
            LK KW  ++ + +WDR APLP   Q  IP+  ARD VL++Y  FSP M+ IA KFF   
Sbjct: 291 RLKAKWFGVEALPYWDRNAPLPKVEQRTIPWAQARDTVLEAYNAFSPDMAGIARKFFDGG 350

Query: 374 WIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGI 433
           WIDAP   GK  GAFAH T+PS HPY+L+NY GKP+DVMTLAHELGHG+H VL++ + G 
Sbjct: 351 WIDAPTRPGKAPGAFAHPTVPSAHPYVLVNYQGKPRDVMTLAHELGHGVHQVLAA-SNGA 409

Query: 434 LTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFE 493
           L   + LTLAETAS+FGE LTF  LL   +   +R+ +LA K+EDM+N++VRQI+FY FE
Sbjct: 410 LMAPTPLTLAETASVFGEMLTFRRLLGQTTDPTQRRAMLAAKVEDMINTVVRQIAFYSFE 469

Query: 494 LKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYA 553
            K+H   R+ G++   +INE+W+  Q ESLGPA  L D  Y  FW  +PHFI S FYVYA
Sbjct: 470 RKVHLA-RAQGELTAEQINELWMSVQAESLGPAITL-DKGYEPFWAYIPHFIHSPFYVYA 527

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YAFG+CLVNSLY +Y +     F E+Y  +L AG SK Y ELL P  ++  DP FW+ GL
Sbjct: 528 YAFGDCLVNSLYGVY-ARAEPGFVERYFALLSAGGSKPYGELLKPFGLDARDPGFWQIGL 586

Query: 614 QTVEKMIDDVEKM 626
             +E MI ++E M
Sbjct: 587 GMIEGMIAELEAM 599


>gi|304393276|ref|ZP_07375204.1| PepF/M3 family oligoendopeptidase [Ahrensia sp. R2A130]
 gi|303294283|gb|EFL88655.1| PepF/M3 family oligoendopeptidase [Ahrensia sp. R2A130]
          Length = 602

 Score =  578 bits (1489), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 284/606 (46%), Positives = 391/606 (64%), Gaps = 8/606 (1%)

Query: 21  SSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
           SS  T    +  LGNLP WNL DLYP   S E   D +    ++  F+ +++  LA  + 
Sbjct: 2   SSANTASSVKTELGNLPEWNLNDLYPGMQSVEFKLDFDAAVPDAQGFEAQYKDKLAALSG 61

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
            +    L  A+A YE++ E +GR+ SYA L Y  + S P   KFY D+  +L      L+
Sbjct: 62  DE----LAEALAAYEQLEERLGRVISYAGLIYAGDSSDPANAKFYGDVQERLTMAGGHLL 117

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           FF LE+N + EA +E++ A       Y  W+ ++R  K + L   +E L  + S  G  A
Sbjct: 118 FFGLELNAIKEAHMEKALAGSAALAHYRPWLTDLRLDKPYQLDAKLEQLFLEKSSTGAGA 177

Query: 201 LKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFIT 260
             R F E + +LRF +  +++ +        D D  +RK+A+ AL+ TF  +  +F+ IT
Sbjct: 178 FNRLFDETMSALRFDVKGEELAIEPTLNLLQDKDGTMRKAASDALAKTFGDNIRLFTLIT 237

Query: 261 NTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWL 320
           NTLAKD++I D WR +E +AD RHL+N VE  V+ AL+ +V++ +P+ SHRYY +K KW+
Sbjct: 238 NTLAKDKQIGDTWRGFEDVADGRHLANRVERQVVGALVDAVEDAFPRISHRYYAMKAKWM 297

Query: 321 KLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQY 380
            +D +  WDR APLP  S   I ++ ARD VL +Y  F+P+M+ IA  FF HNWIDAP  
Sbjct: 298 GMDQLNHWDRNAPLPIASTRSIKWDEARDTVLDAYRGFAPEMATIAADFFDHNWIDAPVR 357

Query: 381 DGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSL 440
            GK  GAFAH T+PS HPY+LLNY GKP+DVMTLAHELGHG+H VL+   QG L  ++ L
Sbjct: 358 PGKSPGAFAHPTVPSAHPYVLLNYQGKPRDVMTLAHELGHGVHQVLAGR-QGALMASTPL 416

Query: 441 TLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTER 500
           TLAETAS+FGE LTF SLL+ A S  ERK +LA K+EDM+N++VRQI+FY FE K+H ER
Sbjct: 417 TLAETASVFGEMLTFRSLLEQAKSPTERKAMLAAKVEDMINTVVRQIAFYMFERKVHEER 476

Query: 501 RSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCL 560
           R+ G++ T +IN  W+  Q+ SLGP+  L +  Y  FW  VPHFI S FYVYAYAFG+CL
Sbjct: 477 RN-GELTTDQINAAWMSVQESSLGPSVKLGE-GYERFWTYVPHFIHSPFYVYAYAFGDCL 534

Query: 561 VNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMI 620
           VNSLY +Y+ N  D F++KY  +L+AG +KH+SELL P  ++ SDP FW +GL  +E +I
Sbjct: 535 VNSLYAVYQ-NAEDGFQDKYFEMLKAGGTKHHSELLAPFGLDASDPAFWGKGLAVIEGLI 593

Query: 621 DDVEKM 626
           D++E +
Sbjct: 594 DELEAL 599


>gi|209965430|ref|YP_002298345.1| oligoendopeptidase, pe PF [Rhodospirillum centenum SW]
 gi|209958896|gb|ACI99532.1| oligoendopeptidase, pe PF [Rhodospirillum centenum SW]
          Length = 603

 Score =  577 bits (1488), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 280/598 (46%), Positives = 386/598 (64%), Gaps = 12/598 (2%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           LG LP W+L DLYP  DS +++ D+E  E E+ AF  R +G L+  T  +    LG A+A
Sbjct: 13  LGRLPTWDLTDLYPGPDSPDLTRDLERTEQEARAFAARCQGRLSSLTGAE----LGRAVA 68

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
           E+E + E + RI SYA L Y  + SSP I +FY  +  ++      L+FF LEIN L++A
Sbjct: 69  EFEALDERLARIMSYAGLLYAGDRSSPEIGRFYQSMQERVTAISVHLLFFTLEINRLEDA 128

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
            L       P   KY  W+++ R  + H LS++ E LL +    GR A  R F E +  L
Sbjct: 129 DLAAKLTA-PELAKYGPWLRDTRIFRPHQLSDEAERLLHEKYVAGRAAWVRLFDETLAGL 187

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           RF +  + +   +A     D D+ VR+ AA A+      +  +F+ ITNTLAKD+EI+DR
Sbjct: 188 RFPVGGRDLTAAEALNLLSDRDQSVRREAALAIGGVLRANLRLFTHITNTLAKDKEIEDR 247

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR Y +   +R+L+N VE  V+EAL+ +VK  YP  SHRYY LK +W   D + +WDR A
Sbjct: 248 WRSYAQPWSARNLANRVEDAVVEALVSAVKAAYPTLSHRYYALKARWFGQDRLDYWDRNA 307

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP     I+P+E AR++VL SYA+FSP+++ + ++FF   WIDAP   GK  GAFAH T
Sbjct: 308 PLPDDDDRIVPWEEAREIVLSSYARFSPELAAVGQRFFDKAWIDAPTRPGKDPGAFAHPT 367

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +P+ HPY+LLNYLG+ +DVMTLAHELGHG+H VL++  QG L  ++ LTLAETAS+FGE 
Sbjct: 368 VPAAHPYLLLNYLGRTRDVMTLAHELGHGVHQVLAA-GQGHLQADTPLTLAETASVFGEM 426

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF  LL   +   +RK LLA K+EDMLN++VRQI+FY+FE ++H ERR   ++   R+N
Sbjct: 427 LTFRGLLDRTTDPRKRKALLAGKVEDMLNTVVRQIAFYEFERRVHAERREA-ELSAERLN 485

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIY---- 568
            IW+E Q ESLGPAF   D  Y ++W  +PHF+ S FYVYAYAFG+CLVNSLY  Y    
Sbjct: 486 AIWMEVQTESLGPAFRF-DESYRTYWAYIPHFVHSPFYVYAYAFGDCLVNSLYAAYEEAA 544

Query: 569 KSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           + N  D F  +YL++L AG S+H+ ELL P  ++ +DP FW +GL  + + ID++E +
Sbjct: 545 RQNGSDAFARRYLDLLAAGGSRHHKELLAPFGLDATDPAFWGKGLDLLRRFIDELEAL 602


>gi|146338288|ref|YP_001203336.1| putative oligoendopeptidase F [Bradyrhizobium sp. ORS278]
 gi|146191094|emb|CAL75099.1| putative oligoendopeptidase F [Bradyrhizobium sp. ORS278]
          Length = 655

 Score =  576 bits (1485), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 277/603 (45%), Positives = 397/603 (65%), Gaps = 6/603 (0%)

Query: 25  TTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLA-HATNQKN 83
           T + ++  +G LP WNL DLY   D+ EI++D+  ++ E +AF+T ++G +A H   +  
Sbjct: 57  TVVAAKTGIGTLPEWNLGDLYSGIDAPEIAHDLAKMDAECVAFETDYKGKIAEHVAREDG 116

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
              L AA+  YE I +L GR+ S+A L++  +   P I KFY DI+ +L      L+FF 
Sbjct: 117 GEWLAAAVRRYEAIDDLAGRLGSFAGLAHAGDSVDPAISKFYGDISERLTTASTHLLFFP 176

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
           LE+N +D++++ ++  + P    Y  WI+++RK K + L + +E L  + SQ G  A  R
Sbjct: 177 LELNRIDDSVIARAM-ETPALGHYRPWIEDLRKDKPYQLEDRVEQLFHEKSQTGYSAWNR 235

Query: 204 FFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTL 263
            F + I  LRF+++ +++ +        D D   RK+AA+AL+ TF  +   F+ ITNTL
Sbjct: 236 LFDQTIAGLRFQVDGKELAIEPTLNFLQDRDGGKRKAAAEALAKTFKANERTFALITNTL 295

Query: 264 AKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLD 323
           AKD++I DRWR ++ +ADSRHL+N VE  V++AL+ SV+  YPK SHRYY LK +W K  
Sbjct: 296 AKDKDISDRWRGFQDVADSRHLNNRVEREVVDALVASVRAAYPKLSHRYYRLKARWFKKK 355

Query: 324 TMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGK 383
            +  WDR APLP  +   I +  A+++VL +Y  FSP+M+ IA++FF  +WIDAP   GK
Sbjct: 356 KLAHWDRNAPLPFAANATIAWPEAKNMVLTAYRGFSPEMADIAQRFFDQSWIDAPVRPGK 415

Query: 384 GSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLA 443
             GAF+H T PS HPY+L+NY GKP+DVMTLAHELGHG+H VL+++  G L   + LTLA
Sbjct: 416 APGAFSHPTTPSAHPYVLMNYQGKPRDVMTLAHELGHGVHQVLAAK-NGALMAPTPLTLA 474

Query: 444 ETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRST 503
           ETAS+FGE LTF  LL      ++R+ LLA K+EDM+N++VRQI+FY FE  +HTER+  
Sbjct: 475 ETASVFGEMLTFKRLLSQTKDAKQRQALLAGKVEDMINTVVRQIAFYSFERAVHTERKH- 533

Query: 504 GDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNS 563
           G++   R+ ++WL  Q ESLG A ++    Y +FW  +PHFI S FYVYAYAFG+CLVNS
Sbjct: 534 GELTAERLGQLWLSVQTESLGEAIEIKP-GYENFWTYIPHFIHSPFYVYAYAFGDCLVNS 592

Query: 564 LYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDV 623
           LY +Y+ +  D F E+YL +L AG +KHYSELL P  ++  DP FW+ GL  +  MID++
Sbjct: 593 LYAVYE-HAADGFAERYLAMLAAGGTKHYSELLKPFGLDAKDPRFWDGGLSVIAGMIDEL 651

Query: 624 EKM 626
           E M
Sbjct: 652 EAM 654


>gi|158422061|ref|YP_001523353.1| peptidase M3B protein [Azorhizobium caulinodans ORS 571]
 gi|158328950|dbj|BAF86435.1| peptidase M3B protein [Azorhizobium caulinodans ORS 571]
          Length = 634

 Score =  575 bits (1483), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 286/592 (48%), Positives = 391/592 (66%), Gaps = 6/592 (1%)

Query: 36  LPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAA-IAEY 94
           LP WNL DLY   D   I+ D+   +  S AF+  ++G LA      +  +   A +  Y
Sbjct: 45  LPEWNLADLYAGMDDPRIATDLAEADALSKAFEADYKGKLADIAAAADAGAQLGAAVKRY 104

Query: 95  ERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALL 154
           E I +L+GR+AS+  L Y  + + P   KF++DI  KL D    L+FF LE+N L++A +
Sbjct: 105 EAIDDLMGRVASFGSLVYAGDTADPARAKFFSDIQEKLTDSSTHLLFFTLEMNRLEDAQV 164

Query: 155 EQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF 214
           E +  +D     Y  W++++RK K + L + +E L  + S   R A  R F E + SLRF
Sbjct: 165 EAAL-KDAAFGHYRPWVEDLRKDKPYQLEDRVEQLFHEKSSPARGAWGRLFDETMSSLRF 223

Query: 215 KINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWR 274
            ++ +++ +        D +  VRK+A +AL+ TF+++  +FS ITNTLAKD+EI DRWR
Sbjct: 224 SVDGKELAIEPTLNLMQDPNEAVRKAAGQALAQTFSENLRLFSLITNTLAKDKEISDRWR 283

Query: 275 KYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPL 334
            +E +ADSRHL+N VE  V++A++ S++  +P+ SHRYY LK KW   + + FWDR APL
Sbjct: 284 GFEDVADSRHLANRVEREVVDAMVASIREAFPRLSHRYYALKAKWFGKEKLEFWDRNAPL 343

Query: 335 PGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIP 394
           P      I ++ ARD VL +Y+ FSP+M+ IA  FF  NWIDAP   GK  GAFAH T+P
Sbjct: 344 PKVDTRDIGWDEARDTVLGAYSTFSPRMADIARVFFDKNWIDAPVRPGKSPGAFAHPTVP 403

Query: 395 SVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLT 454
           S HPY+LLNY GKP+DVMTLAHELGHG+H VL+   QG L   + LTLAETAS+FGE LT
Sbjct: 404 SAHPYVLLNYQGKPRDVMTLAHELGHGVHQVLAGR-QGALMAPTPLTLAETASVFGEMLT 462

Query: 455 FDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEI 514
           F  LL AA + + RKI+LA K+EDM+N++VRQ +FY FE K+HTERR  G+I   RI E+
Sbjct: 463 FRRLLAAAETPQARKIMLAQKVEDMINTVVRQTAFYTFERKVHTERRQ-GEITAERIGEL 521

Query: 515 WLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVD 574
           W++ Q ESLGPA +LS   Y +FW  +PHFI S FYVYAYAFG+CLVNSLY +Y+  + D
Sbjct: 522 WMDVQTESLGPAINLS-AGYETFWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQKAS-D 579

Query: 575 CFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            F E+YL +L AG +KH+SELL P  ++  DP FW+ GL  +E MI ++E+M
Sbjct: 580 GFAERYLEMLAAGGTKHHSELLAPFGLDARDPAFWQTGLGLIESMITELEQM 631


>gi|163797405|ref|ZP_02191357.1| hypothetical protein BAL199_28785 [alpha proteobacterium BAL199]
 gi|159177324|gb|EDP61881.1| hypothetical protein BAL199_28785 [alpha proteobacterium BAL199]
          Length = 603

 Score =  573 bits (1476), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 277/597 (46%), Positives = 394/597 (65%), Gaps = 9/597 (1%)

Query: 28  DSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSL 87
           D+  +LG LP W+L DLYP  DS E++ D++  E ++ AF+ R+ G +A  +       L
Sbjct: 3   DTAADLGPLPSWDLADLYPGPDSPELARDLDRCEADAKAFRDRYAGKVAGLSGT----DL 58

Query: 88  GAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEIN 147
           G AIA YE + E++GR+ S+A L Y  ++S P + KFY  +  ++      L+FF LEIN
Sbjct: 59  GRAIATYEAMDEILGRVMSFAHLMYAGDMSDPNVGKFYQSMQERVNAISTELLFFTLEIN 118

Query: 148 TLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCE 207
            ++EA LE   A  P    +  W+++ R  ++H LS+D+E LL +    GR A  R F E
Sbjct: 119 RIEEADLEAKLAA-PELAHFRPWLRDTRAFREHQLSDDLEKLLHEKYVAGRAAWTRLFDE 177

Query: 208 NIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDE 267
            +  LRF ++ +++   +      + D  VR+ AA+ L     ++  +F+ ITNTLAKD+
Sbjct: 178 TMARLRFPMDGKELTTAEVLDRLSNRDGTVRRKAAQVLGEVLGRNVGLFALITNTLAKDK 237

Query: 268 EIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYF 327
           +I D+WR+Y K    R+L+N VE  V+EAL+ +V+  Y + SHRYY LK +W  ++T+ +
Sbjct: 238 QIDDKWRRYTKPISLRNLANQVEDEVVEALVTAVRGKYGRLSHRYYRLKARWFGVETLDY 297

Query: 328 WDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGA 387
           WDR APLP      IP+  ARD VL +YA FSP+++ + ++FF + WIDAP   GK SGA
Sbjct: 298 WDRNAPLPEDDDAQIPWSEARDTVLDAYAGFSPRLAEVGKQFFDNAWIDAPTRPGKASGA 357

Query: 388 FAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETAS 447
           FAH T+PS HPY+LLNY GK +DVMTLAHELGHG+H VL+   QG L  ++ LTLAETAS
Sbjct: 358 FAHPTVPSAHPYLLLNYQGKTRDVMTLAHELGHGVHQVLAGR-QGQLMCDTPLTLAETAS 416

Query: 448 IFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIP 507
           +FGE LTF +LL+  S    R+++LA+K+EDMLN++VRQI+F+ FE ++H ERRS G++ 
Sbjct: 417 VFGEMLTFQALLKKRSDPVGRRVMLASKVEDMLNTVVRQIAFHCFETRVHDERRS-GELT 475

Query: 508 THRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDI 567
             R+ EIW+E Q ESLGPAF   D  Y +FW  +PHF+ S FYVYAYAFG+CLVNSLY +
Sbjct: 476 PERLGEIWMEIQVESLGPAFRYDD-GYKAFWSYIPHFVHSPFYVYAYAFGDCLVNSLYAV 534

Query: 568 YKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVE 624
           ++      F +KYL +L AG +K + ELL P  ++ SDP FW++GL  VE MID++E
Sbjct: 535 FQGAEA-GFADKYLEMLSAGGTKRHKELLAPFGLDASDPAFWDKGLGLVESMIDELE 590


>gi|307944488|ref|ZP_07659828.1| oligoendopeptidase F [Roseibium sp. TrichSKD4]
 gi|307772237|gb|EFO31458.1| oligoendopeptidase F [Roseibium sp. TrichSKD4]
          Length = 590

 Score =  573 bits (1476), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 284/594 (47%), Positives = 396/594 (66%), Gaps = 6/594 (1%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           +G LP W+L DLYP+ DS E+ +D++  E ++  F+T ++G L       N   L  AI 
Sbjct: 1   MGELPNWDLTDLYPALDSPEVKDDLKGAEEKAKTFETAYKGRLEELATS-NVEGLVTAIR 59

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
            YE + + +GR+ SYA L Y  + + P ++KFY D+  ++      L+FF LE N + + 
Sbjct: 60  AYEALEDGLGRLISYAGLVYAGSTTDPQVQKFYGDVQERITAASTHLLFFTLEFNRISDE 119

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
            L+Q+   + L   Y  WI+++RK K + L + +E L  + S  GR A  R F E + SL
Sbjct: 120 TLDQAMKNEGLA-HYRPWIEDLRKDKPYQLEDRVEQLFHEKSITGRGAWNRLFDETMASL 178

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
            F++   +  L         S+ E R++A KAL+ TF ++   FS ITNTLAKD+EI DR
Sbjct: 179 SFEVEGNEQTLEPTLNLLQSSEPEKREAAFKALTTTFGENLRTFSLITNTLAKDKEISDR 238

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR +E IADSRHL+N VE  V++AL+ SV + YP+ SHRYY++K +WL  +T+  WDR A
Sbjct: 239 WRGFEDIADSRHLANRVERDVVDALVSSVHDAYPRLSHRYYKMKARWLGFETLNAWDRNA 298

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP +   II +E A+  VL++Y  FS  M+ IA +FF  NWIDAP   GK  GAFAH T
Sbjct: 299 PLPKSDNRIISWEDAKTTVLEAYGGFSGDMAEIAGRFFDKNWIDAPARPGKAPGAFAHPT 358

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +PS HPY+LLNY GK +DVMTLAHELGHG+H VL++E  G L   + LTLAETAS+FGE 
Sbjct: 359 VPSAHPYVLLNYQGKTRDVMTLAHELGHGVHQVLAAE-NGPLMAPTPLTLAETASVFGEM 417

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF +LL  A +   RKILLA+K EDM+N++VRQI+FY FE KLH ER+  G++ +++I 
Sbjct: 418 LTFKALLAKADTVNARKILLASKAEDMINTVVRQIAFYSFERKLHEERQK-GELTSNQIG 476

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
           ++W+  Q +SLGPA  L++  Y +FW  +PHFI S FYVYAYAFG+CLVNSLY +Y+   
Sbjct: 477 DLWMSVQADSLGPAIRLNE-GYETFWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVYE-EA 534

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              F+EKY ++LRAG +KH+SELL P  +N SDP FW++GL  +E++ID++E +
Sbjct: 535 ESGFQEKYFDLLRAGGTKHHSELLAPFGLNASDPAFWKKGLSVIERIIDELEDL 588


>gi|288958999|ref|YP_003449340.1| oligoendopeptidase F [Azospirillum sp. B510]
 gi|288911307|dbj|BAI72796.1| oligoendopeptidase F [Azospirillum sp. B510]
          Length = 604

 Score =  572 bits (1475), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 279/606 (46%), Positives = 388/606 (64%), Gaps = 8/606 (1%)

Query: 19  LRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHA 78
           + SS  T  +   +LG LP W+L DLYP  +S E+  D++ +E E  AF+ R  G L   
Sbjct: 1   MTSSAATAANDTPDLGALPTWDLSDLYPGTESPELKADLDRMEAECKAFRERHAGKLGTL 60

Query: 79  TNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKV 138
           T  +    L  AI +YE+I E + R+ SYA L YN ++  PT+ KFY     ++ D    
Sbjct: 61  TGDE----LATAIRQYEQIDETLSRVMSYAGLVYNGDMVDPTVAKFYQSAQERVNDISAH 116

Query: 139 LIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGR 198
           LIFF LEIN LDEA L           +Y  W++++R  + H LS+++E LL +   VGR
Sbjct: 117 LIFFTLEINRLDEADLTAKQVASAALRQYGPWLRDVRLYRDHQLSDEIERLLHEKHVVGR 176

Query: 199 EALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSF 258
            A  R F E I SLRF +  + +   +A     D +  VR+ A + +      ++ +F+ 
Sbjct: 177 AAWNRLFDETIASLRFPMGGKDLTCAEALNRLSDRNPAVRREAGEVVGKVLGDNARLFAL 236

Query: 259 ITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKK 318
           +TNTLAKD+EI+D WR Y     +R+LSN VE  V++AL+ +VK  YP  SHRYY +K K
Sbjct: 237 VTNTLAKDKEIEDDWRNYPMPTSARNLSNRVEDEVVDALVSAVKGAYPDLSHRYYAMKAK 296

Query: 319 WLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAP 378
           W   D + +WDR APLP  +   IP++ ARD+VL +Y +FSP ++ + ++FF + WIDAP
Sbjct: 297 WFGQDHLDYWDRNAPLPEDADRSIPWDEARDIVLGAYGRFSPDLASLGKRFFDNPWIDAP 356

Query: 379 QYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNS 438
              GK  GAFAH T+PSVHPY+L+NY GK +DVMTLAHELGHG+H +L+   QG   +++
Sbjct: 357 VRPGKAPGAFAHPTVPSVHPYLLVNYQGKTRDVMTLAHELGHGVHQILAGR-QGHFLSDT 415

Query: 439 SLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHT 498
            LTLAETAS+FGE LTF +LL A +  + R+I+LA K+EDMLN++VRQI+F+DFE ++HT
Sbjct: 416 PLTLAETASVFGEMLTFRALLAAETDPKRRRIMLAGKVEDMLNTVVRQIAFFDFERRVHT 475

Query: 499 ERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGN 558
           ERR  G++ + RI EIW+  Q ESLGPA    D  Y  +W  +PHFI S FYVYAYAFG+
Sbjct: 476 ERRE-GELTSDRIGEIWMAVQTESLGPALRF-DEGYRHYWSYIPHFIHSPFYVYAYAFGD 533

Query: 559 CLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
           CLVNSLY +Y+   +  F EKYL +L AG +  + ELL P  ++ SDP FW++GL  +  
Sbjct: 534 CLVNSLYAVYQDAEL-GFAEKYLAMLSAGGTLRHKELLAPFGLDASDPAFWQKGLGVIRG 592

Query: 619 MIDDVE 624
            ID++E
Sbjct: 593 FIDELE 598


>gi|316935699|ref|YP_004110681.1| oligoendopeptidase, pepF/M3 family [Rhodopseudomonas palustris
           DX-1]
 gi|315603413|gb|ADU45948.1| oligoendopeptidase, pepF/M3 family [Rhodopseudomonas palustris
           DX-1]
          Length = 639

 Score =  571 bits (1472), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 287/594 (48%), Positives = 392/594 (65%), Gaps = 6/594 (1%)

Query: 34  GNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS-LGAAIA 92
             LP WNL DLYP+ D+ E++ D++ ++ E  +F+  ++G LA  T +      L  A+ 
Sbjct: 50  AKLPEWNLTDLYPAIDAPEVAADLDRLDAECTSFEADFKGRLAEETAKDGGALWLAGAVK 109

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
            YE I +L GR+ SYA L +  +   P   KFY D++ +L      L+FF LE+N +D A
Sbjct: 110 RYEAIEDLAGRLGSYAGLVHAGDSVDPVKSKFYGDVSERLTAASVHLLFFTLELNRVDNA 169

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
           +LE++  Q P    Y  WI+++RK K + L + +E L  + SQ G  A  R F + I SL
Sbjct: 170 VLERAM-QTPELGHYRPWIEDLRKDKPYQLEDRIEQLFHEKSQTGYGAFNRLFDQTISSL 228

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           RFK+  +++ +        D     RK+AA+AL+ TF  +   F+ ITNTLAKD+EI DR
Sbjct: 229 RFKVGAKELAIEPTLNLMQDRAPAKRKAAAEALAKTFKANERTFALITNTLAKDKEISDR 288

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR +E +ADSRHL+N VE  V++AL+ SV+  YPK SHRYY+LK  W K   + +WDR A
Sbjct: 289 WRGFEDVADSRHLANRVEREVVDALVASVRAAYPKLSHRYYKLKAGWFKKKKLPYWDRNA 348

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP  +   I +  AR++VL +Y  FSP+M+ IAE+FF   WIDAP   GK  GAF+H T
Sbjct: 349 PLPFAATGTIAWPEARNMVLTAYKAFSPEMAQIAERFFNDRWIDAPVRPGKAPGAFSHPT 408

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
            PS HPY+L+NY GKP+DVMTLAHELGHG+H VL+++  G L   + LTLAETAS+FGE 
Sbjct: 409 TPSAHPYVLMNYQGKPRDVMTLAHELGHGVHQVLAAK-NGALMAPTPLTLAETASVFGEM 467

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF  LL     +++R+ LLA K+EDM+N++VRQI+FY FE  +HTERRS G++   RI 
Sbjct: 468 LTFRRLLAQTKDRKQRQALLAGKVEDMINTVVRQIAFYSFERAIHTERRS-GELTAQRIG 526

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
           EIWL  Q ESLGPA ++    Y SFWM +PHFI S FYVYAYAFG+CLVNSLY +Y+ + 
Sbjct: 527 EIWLSVQGESLGPAIEIKP-GYESFWMYIPHFIHSPFYVYAYAFGDCLVNSLYAVYE-HA 584

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + F E+YL +L AG +KHYSELL P  ++  +P+FW+ GL  +  MID++E M
Sbjct: 585 QEGFAERYLAMLAAGGTKHYSELLAPFGLDAKNPSFWDGGLSVIAGMIDELEAM 638


>gi|254504890|ref|ZP_05117041.1| oligoendopeptidase, pepF/M3 family [Labrenzia alexandrii DFL-11]
 gi|222440961|gb|EEE47640.1| oligoendopeptidase, pepF/M3 family [Labrenzia alexandrii DFL-11]
          Length = 606

 Score =  570 bits (1470), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 279/595 (46%), Positives = 398/595 (66%), Gaps = 8/595 (1%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAH-ATNQKNCHSLGAAI 91
           LG+LP W+L DLYPS D+ ++++D++     +  F+  ++G LA  A N  N  +L  AI
Sbjct: 18  LGDLPVWDLTDLYPSVDAPKVTSDLKEALDRAKTFEASYKGRLADLAAN--NVAALVTAI 75

Query: 92  AEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDE 151
             YE + +L+GR+ S+A L Y  N +    +KFY D+  ++      L+FF+LE+N +++
Sbjct: 76  RAYEDLEDLMGRLISFAGLVYAGNTTDAAAQKFYGDVQEQITTASSHLLFFSLELNRIED 135

Query: 152 ALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIES 211
           A+++ +  +D     Y  WI+++RK K + L + +E L  + S  G  A  R F E +  
Sbjct: 136 AVVDAAL-EDAHLAHYRPWIEDLRKDKPYQLEDRVEQLFHEKSVTGSSAWNRLFDETMAR 194

Query: 212 LRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
           L F ++ +++P+ +      D   E R+ A+KAL+ TF+K+   F+ ITNTL KD+EI D
Sbjct: 195 LTFTVSGEELPVEQTLNLLTDPSPEKREEASKALTETFSKNLSTFALITNTLTKDKEISD 254

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRL 331
           RWR +  IADSRHL+N VE  V++A++ +V+  YP+ SHRYY+LK KWL +D +  WDR 
Sbjct: 255 RWRNFSDIADSRHLANRVEREVVDAMVSAVREAYPRLSHRYYKLKAKWLGVDQLNTWDRN 314

Query: 332 APLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHG 391
           APLP     IIP+  A+D VL +Y  FSP M+ IA +FF   WIDAP   GK  GAFAH 
Sbjct: 315 APLPDADTRIIPWAEAKDTVLSAYNTFSPDMAEIASRFFDKGWIDAPARSGKAPGAFAHP 374

Query: 392 TIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE 451
           T+PS HPY+L+NY GK +DVMTLAHELGHG+H VL+    G L   + LTLAETAS+FGE
Sbjct: 375 TVPSAHPYVLVNYQGKVRDVMTLAHELGHGVHQVLAG-PNGPLMAPTPLTLAETASVFGE 433

Query: 452 TLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRI 511
            LTF SLL  A   + +K++LA+K EDM+N++VRQI+FY FE KLHTERR+ G++   +I
Sbjct: 434 MLTFKSLLAKAEDPKTKKVMLASKAEDMINTVVRQIAFYTFERKLHTERRN-GELTADKI 492

Query: 512 NEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSN 571
            E+WL  Q ESLGPA  L +  Y +FW  +PHFI S FYVYAYAFG+CLVNSLY +Y+  
Sbjct: 493 GELWLSVQGESLGPAIKL-NAGYETFWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVYEEA 551

Query: 572 TVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
               F+EKY  +L+AG +KH+SELL P  ++ +DP+FW++GL  +E++ID++E +
Sbjct: 552 ET-GFQEKYFELLKAGGTKHHSELLKPFGLDATDPDFWKKGLSVIERLIDELETL 605


>gi|298292669|ref|YP_003694608.1| oligoendopeptidase, pepF/M3 family [Starkeya novella DSM 506]
 gi|296929180|gb|ADH89989.1| oligoendopeptidase, pepF/M3 family [Starkeya novella DSM 506]
          Length = 614

 Score =  570 bits (1470), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 282/595 (47%), Positives = 391/595 (65%), Gaps = 6/595 (1%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS-LGAAI 91
           L NLP+W+L DLYP+ DS E+  D+  +  +   F+  ++G LA   +  +  S +   +
Sbjct: 22  LDNLPQWDLSDLYPAIDSPELQADLAEVASDCATFEEAYKGKLAGILDAADAGSQMALIV 81

Query: 92  AEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDE 151
           + YE+I + +GR+ SYA L Y+ + + P   KFY D+  KL D    L+FF LE+N LD+
Sbjct: 82  SRYEKIEDRLGRLYSYAGLVYSGDTTDPVRAKFYGDVQEKLTDASTHLLFFTLELNRLDD 141

Query: 152 ALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIES 211
           A +E + A  P   KY  WI ++R  K + L + +E L  +     R A  R F E I  
Sbjct: 142 AKMEAALAA-PEFGKYRPWIDDVRAEKPYQLEDRIEQLFHEKGVTSRSAWNRLFDETIAG 200

Query: 212 LRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
           LRF I+ Q +PL +A     +   E R++AA+AL+  F ++  +F+ +TNTLAKD+EI D
Sbjct: 201 LRFDIDGQNLPLEQALNLLQEPQEEKRRAAAEALAKVFGENLRLFTLVTNTLAKDKEISD 260

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRL 331
           RWR ++ IADSRHL+N VE  V++AL+ SV   YP+ +HRYY+LK KW   D + +WDR 
Sbjct: 261 RWRGFDDIADSRHLANRVEREVVDALVSSVHAAYPRLAHRYYKLKAKWFGKDKLEYWDRN 320

Query: 332 APLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHG 391
           APLP      I ++ ARD VL +Y+ FSP+M+ IA  FF  +WIDA    GK +GAFAH 
Sbjct: 321 APLPKVETRTIGWDEARDTVLGAYSTFSPRMADIARTFFDKSWIDAGVRPGKATGAFAHP 380

Query: 392 TIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE 451
           T+PS HPY+LLNYLGKP+DVMTLAHELGHG+H VL++   G L   + LTLAETAS+FGE
Sbjct: 381 TVPSAHPYVLLNYLGKPRDVMTLAHELGHGVHQVLAA-PNGALMAPTPLTLAETASVFGE 439

Query: 452 TLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRI 511
            LTF  LL  A     RK +LA K+EDM+N++VRQI+FY FE ++HTER++ G++   +I
Sbjct: 440 MLTFRRLLATAPDARTRKAMLAAKVEDMINTVVRQIAFYTFERRIHTERKN-GELTAEQI 498

Query: 512 NEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSN 571
            +IW+E Q ESLG A  L    Y ++W+ + HFI S FYVYAYAFG+CLVNSLY +Y+ N
Sbjct: 499 CKIWMEVQAESLGEAIHLGP-GYEAYWVYIGHFIHSPFYVYAYAFGDCLVNSLYAVYE-N 556

Query: 572 TVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
             + F E+YL +L AG +KH+SELL P  ++  DP FW+ GL  +E+MI ++E M
Sbjct: 557 ASEGFAERYLAMLAAGGTKHHSELLKPFGLDARDPAFWQTGLNLIERMIAELEAM 611


>gi|163795236|ref|ZP_02189204.1| hypothetical protein BAL199_06194 [alpha proteobacterium BAL199]
 gi|159179634|gb|EDP64163.1| hypothetical protein BAL199_06194 [alpha proteobacterium BAL199]
          Length = 595

 Score =  570 bits (1469), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 274/597 (45%), Positives = 395/597 (66%), Gaps = 9/597 (1%)

Query: 28  DSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSL 87
           D+  +LG+LP+W+L DLYP  DS E++ D+E  E ++ AF+ +  G +A  +       L
Sbjct: 3   DTAADLGSLPQWDLADLYPGPDSPELARDLERCEADAKAFRDKHAGAVASLSGT----DL 58

Query: 88  GAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEIN 147
           G A A YE + E++GR+ S+A L Y  N+S P + +FY  +  ++      L+FF LEIN
Sbjct: 59  GRATAAYEAMDEILGRVMSFANLMYAGNMSDPQVGRFYQSMQERVNAISTELLFFGLEIN 118

Query: 148 TLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCE 207
            ++EA L     + P    +  W+++ R  ++H LS+++E LL +    GR A  R F E
Sbjct: 119 RIEEADLTTKL-KAPELAHFQPWLRDTRAYREHQLSDELEKLLHEKYVAGRAAWTRLFDE 177

Query: 208 NIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDE 267
            +  LRF ++ +++   +        D  +R+ AA +L+    K+  +F+ +TNTLAKD+
Sbjct: 178 TMARLRFTLDGEELTTAQVLDRLSHRDAAMRRKAAHSLAEVLGKNVGLFALVTNTLAKDK 237

Query: 268 EIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYF 327
           +I+D+WR+Y K   SR+++N VE  V+EAL+ +V+  Y + SHRYY LK KW  +D + +
Sbjct: 238 QIEDKWRRYAKPISSRNIANQVEDDVVEALVTAVRGKYSRLSHRYYALKAKWFGVDQLDY 297

Query: 328 WDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGA 387
           WDR APLP      IP+  ARD VL++YA FSP+++ + +KFF + WIDAP   GK SGA
Sbjct: 298 WDRNAPLPEDDDAQIPWTEARDTVLKAYAGFSPKLAEVGQKFFDNAWIDAPTRPGKASGA 357

Query: 388 FAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETAS 447
           FAH T+PS HPY+LLNY GK +DVMTLAHELGHG+H VL+S   G L  ++ LTLAETAS
Sbjct: 358 FAHPTVPSAHPYLLLNYQGKTRDVMTLAHELGHGVHQVLASR-HGQLMCDTPLTLAETAS 416

Query: 448 IFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIP 507
           +FGE LTF +LLQ+ S    R+++LA+K+EDMLN++VRQI+F+ FE ++H ERRS G++ 
Sbjct: 417 VFGEMLTFQALLQSRSDPVGRRVMLASKVEDMLNTVVRQIAFHTFEARIHDERRS-GELT 475

Query: 508 THRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDI 567
             R+ EIW++ Q ESLGPA    D  Y SFW  +PHF+ S FYVYAYAFG+CLVNSLY +
Sbjct: 476 PDRLGEIWMDVQAESLGPAIRFDD-GYKSFWSYIPHFVHSPFYVYAYAFGDCLVNSLYAV 534

Query: 568 YKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVE 624
           ++      F +KYL +L AG +K + ELL P  ++ SDP FW++GL+ VE MID +E
Sbjct: 535 FQDAEA-GFADKYLEMLAAGGTKRHKELLAPFGLDASDPAFWDKGLELVETMIDQLE 590


>gi|192293026|ref|YP_001993631.1| oligoendopeptidase, pepF/M3 family [Rhodopseudomonas palustris
           TIE-1]
 gi|192286775|gb|ACF03156.1| oligoendopeptidase, pepF/M3 family [Rhodopseudomonas palustris
           TIE-1]
          Length = 638

 Score =  570 bits (1469), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 287/592 (48%), Positives = 392/592 (66%), Gaps = 6/592 (1%)

Query: 36  LPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS-LGAAIAEY 94
           LP WNL DLYP+  S E++ D++ ++ E  +F+  ++G LA  T +      L  A+  Y
Sbjct: 51  LPEWNLMDLYPAIGSPEVAADLDRLDAECASFEADFKGRLAEETAKDGGALWLAGAVKRY 110

Query: 95  ERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALL 154
           E I +L GR+ SYA L +  +   P   KFY D++ +L      L+FF LE+N +D+A+L
Sbjct: 111 EAIEDLAGRLGSYAGLVHAGDSVDPVKSKFYGDVSERLTAASVHLLFFTLELNRVDDAVL 170

Query: 155 EQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF 214
           E +  Q P    Y  WI+++RK K + L + +E L  + SQ G  A  R F + I SLRF
Sbjct: 171 ETAM-QTPELGHYRPWIEDLRKDKPYQLEDRIEQLFHEKSQTGYGAFNRLFDQTISSLRF 229

Query: 215 KINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWR 274
           ++  +++ +        D     RK+AA+AL+ TF  +   F+ ITNTLAKD+EI DRWR
Sbjct: 230 RVGGKELAIEPTLNLMQDRAPAKRKAAAEALAKTFKANERTFALITNTLAKDKEISDRWR 289

Query: 275 KYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPL 334
            +E +ADSRHL+N VE  V++AL+ SV+  YPK SHRYY+LK  W K   + +WDR APL
Sbjct: 290 GFEDVADSRHLANRVEREVVDALVASVRAAYPKLSHRYYKLKASWFKKKKLPYWDRNAPL 349

Query: 335 PGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIP 394
           P  +   I +  AR++VL +Y  FSP+M+ IAE+FFT  WIDAP   GK  GAF+H T P
Sbjct: 350 PFAATGSIAWPDARNMVLTAYKAFSPEMAQIAERFFTDRWIDAPVRPGKAPGAFSHPTTP 409

Query: 395 SVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLT 454
           S HPY+L+NY GKP+DVMTLAHELGHG+H VL+++  G L   + LTLAETAS+FGE LT
Sbjct: 410 SAHPYVLMNYQGKPRDVMTLAHELGHGVHQVLAAK-NGALMAPTPLTLAETASVFGEMLT 468

Query: 455 FDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEI 514
           F  LL     +++R+ LLA K+EDM+N++VRQI+FY FE  +HTERRS G++   RI EI
Sbjct: 469 FRRLLTQTKDRKQRQALLAGKVEDMINTVVRQIAFYSFERAVHTERRS-GELTAQRIGEI 527

Query: 515 WLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVD 574
           WL  Q ESLGPA ++    Y SFWM +PHFI S FYVYAYAFG+CLVNSLY +Y+ +  +
Sbjct: 528 WLSVQGESLGPAIEIKP-GYESFWMYIPHFIHSPFYVYAYAFGDCLVNSLYAVYE-HAQE 585

Query: 575 CFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            F E+YL +L AG +KHYSELL P  ++  +P+FW+ GL  +  MID++E M
Sbjct: 586 GFAERYLAMLAAGGTKHYSELLAPFGLDAKNPSFWDGGLSVIAGMIDELEAM 637


>gi|300024141|ref|YP_003756752.1| oligoendopeptidase, pepF/M3 family [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299525962|gb|ADJ24431.1| oligoendopeptidase, pepF/M3 family [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 615

 Score =  570 bits (1468), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 282/611 (46%), Positives = 399/611 (65%), Gaps = 10/611 (1%)

Query: 18  ALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAH 77
           ALR++   +  +   LG +P W+L DLY + D+ E+  D++    E+   KT ++G LA 
Sbjct: 12  ALRATTSRSTKTP-RLGAMPEWDLSDLYAAPDAPEVQRDLKAAAKEAARIKTAYQGRLAD 70

Query: 78  ATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEK 137
               K+   L  AI +YE++ +L+G++ SY+ L Y  + + P   KF  D++  L     
Sbjct: 71  LA--KDGGKLAGAIKDYEKLSDLVGKLGSYSGLYYVLDQTDPVRAKFNGDVSEALTKLYT 128

Query: 138 VLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVG 197
            LIFF LE+N +D+A ++ +     +  +Y  W++++RK K H L   +E L ++ SQ  
Sbjct: 129 DLIFFELELNQIDDATMDGALKHKDVK-RYKPWLEDLRKEKPHQLDEKLERLFTEKSQTS 187

Query: 198 REALKRFFCENIESLRFKINDQKIPLT-KAYKSFFDS-DREVRKSAAKALSHTFNKSSHI 255
           R A  R F E + +L+F +  +K PLT +   +F  S D + RK+A++ALS  F  +  +
Sbjct: 188 RSAWNRLFDETMSALKFDVKGEKTPLTLEPTLNFLSSPDEKKRKAASEALSKVFKANLPL 247

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+ ITNTLAKD+EI DRWR ++ +ADSR+L+N VE  V++AL+ SV+  YP+ SHRYY +
Sbjct: 248 FTLITNTLAKDKEISDRWRNFKDVADSRNLANRVEGPVVDALVTSVRAAYPQLSHRYYAM 307

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           K KWL    +  WDR APLP   +  I +  A  +VL++Y  F+P+M+ IA++FF  NWI
Sbjct: 308 KAKWLGKKKLASWDRNAPLPDKPERTITWAEAEKIVLKAYGNFAPEMATIAKQFFDKNWI 367

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           DA    GK  GAF+  T+PSVHPY+++NYLGKP+DVMTLAHELGHG+H  L +  QG L 
Sbjct: 368 DAAVKPGKAPGAFSASTVPSVHPYVMMNYLGKPRDVMTLAHELGHGVHQWL-ARAQGPLL 426

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
             + LTLAETAS+FGE LTF ++L     K ERK ++A K+EDMLN++VRQ++FY FE K
Sbjct: 427 APTPLTLAETASVFGEMLTFKAILAETKDKRERKAMIAGKVEDMLNTVVRQVAFYTFERK 486

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H ERR  G++ + RIN IWLE Q ESLGPA +L    Y  FW  VPHFI S FYVYAYA
Sbjct: 487 VHEERRQ-GELTSDRINAIWLEIQGESLGPAIELKP-GYEVFWTYVPHFIHSPFYVYAYA 544

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
           FG+CLVNSLY +Y +     F  KY ++L+AG SKH+SELL P  ++  DP FW +GL+ 
Sbjct: 545 FGDCLVNSLYGLY-AEAHPGFVAKYFDLLKAGGSKHHSELLAPFGLDARDPEFWNKGLKV 603

Query: 616 VEKMIDDVEKM 626
           +E MID++E M
Sbjct: 604 IEGMIDELETM 614


>gi|299132060|ref|ZP_07025255.1| oligoendopeptidase, pepF/M3 family [Afipia sp. 1NLS2]
 gi|298592197|gb|EFI52397.1| oligoendopeptidase, pepF/M3 family [Afipia sp. 1NLS2]
          Length = 623

 Score =  569 bits (1467), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 276/592 (46%), Positives = 390/592 (65%), Gaps = 6/592 (1%)

Query: 36  LPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS-LGAAIAEY 94
           LP WNL DLY S  + EI+ D++ ++ + +AF+  ++G +A A ++      L  A+  +
Sbjct: 36  LPEWNLGDLYSSITAPEIARDLDKLDADCVAFEAAYKGKIADALSKPGAGEWLAEAVKSF 95

Query: 95  ERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALL 154
           E I +L GR+ SYA L +  +   P I KFY D++ +L +    L+FF LE+N +D+ L+
Sbjct: 96  EAIDDLAGRLISYAGLIHAGDTVDPAITKFYGDVSERLTNASTHLLFFTLELNRIDDELI 155

Query: 155 EQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF 214
           E++  Q P    Y  W+++IRK K + L + +E L  + S     A  R F + I  LRF
Sbjct: 156 EKAM-QVPALGHYRPWLEDIRKDKPYQLEDRIEQLFHEKSTTSYGAFNRMFDQTIAGLRF 214

Query: 215 KINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWR 274
           K+  +++ +        D   E RK+AA+AL+ TF  +   F+ +TNTLAKD+EI DRWR
Sbjct: 215 KVGSKELAIEPTLNLLQDRAPEKRKAAAQALAKTFKANERTFALVTNTLAKDKEISDRWR 274

Query: 275 KYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPL 334
            +E +ADSRHL+N VE  V++AL+ SV+  YP+ SHRYY LK  W K   +  WDR APL
Sbjct: 275 GFEDVADSRHLANRVEREVVDALVASVRAAYPRISHRYYALKASWFKKKKLAHWDRNAPL 334

Query: 335 PGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIP 394
           P  +   I +  A+  +L++Y  FSP+M+ IA++FF   WIDAP   GK  GAF+H T P
Sbjct: 335 PFATTGQIEWNDAKSTILKAYGDFSPEMAGIAKRFFDDRWIDAPVRPGKAPGAFSHPTTP 394

Query: 395 SVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLT 454
           S HPY+L+NY GKP+DVMTLAHELGHG+H VL+++ QG L   + LTLAETAS+FGE LT
Sbjct: 395 SAHPYVLMNYQGKPRDVMTLAHELGHGVHQVLAAK-QGALMAPTPLTLAETASVFGEMLT 453

Query: 455 FDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEI 514
           F  LL    + ++R+ LLA K+EDM+N++VRQI+FY FE  +HTERR+ G++   R+ EI
Sbjct: 454 FKRLLAQTKNAKQRQALLAGKVEDMINTVVRQIAFYSFERAVHTERRN-GELTAERLGEI 512

Query: 515 WLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVD 574
           WL  Q ESLGPA ++    Y +FWM +PHFI S FYVYAYAFG+CLVNSLY +Y+ +  +
Sbjct: 513 WLSVQGESLGPAIEIKP-GYETFWMYIPHFIHSPFYVYAYAFGDCLVNSLYAVYE-HAAE 570

Query: 575 CFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            F ++YL++L AG +KHYSELL P  ++  DP FW+ GL  +E MI ++E M
Sbjct: 571 GFADRYLDMLAAGGTKHYSELLAPFGLDAKDPAFWDGGLSVIEGMIGELEAM 622


>gi|144898001|emb|CAM74865.1| Peptidase M3B, oligoendopeptidase F [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 594

 Score =  568 bits (1463), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 278/603 (46%), Positives = 388/603 (64%), Gaps = 9/603 (1%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           M+T ++  +LGNLP W+L DLYP+ DS E++ D++  E  + AF  R++G LA  +    
Sbjct: 1   MSTKNNAADLGNLPEWDLTDLYPAPDSAELAADLDKAEAVAKAFSQRYDGKLAAISGD-- 58

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
               G AIAEYER+ E++ R  SYA L Y  + + P   +F+  I+ ++ D     +FF 
Sbjct: 59  --DFGDAIAEYERLGEIMYRAMSYAQLYYAGDQTDPERGRFHQGIHERITDISSHTLFFT 116

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
           LEIN LD+A+LE    +   T  Y  W++++R  + H LS+++E LL D S  GR A  R
Sbjct: 117 LEINRLDDAVLEDKL-KAAKTAHYGPWLRDVRVFRPHQLSDEVERLLHDKSVAGRSAWNR 175

Query: 204 FFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTL 263
            F E +  LRF ++ + +   +A     D D   RK+AA+ L     +++ +F+ ITNTL
Sbjct: 176 LFDETMARLRFPLDGKMLTSAEALHLMSDRDPAKRKAAAETLGKVLTENTGLFALITNTL 235

Query: 264 AKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLD 323
            KD+EI+D+WRKY +    R+LSN VE  V++AL  +VK  Y + SHRYY LK KW  +D
Sbjct: 236 VKDKEIEDKWRKYARPQSYRNLSNQVEDEVVDALAAAVKGCYGQLSHRYYALKAKWFGVD 295

Query: 324 TMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGK 383
            + +WDR APLP  +     +E ARD VL +Y  FSP M+ + ++FF  NWIDAP   GK
Sbjct: 296 QLDYWDRNAPLPDVADRTYSWEQARDSVLDAYGAFSPDMAALGKRFFDGNWIDAPVRPGK 355

Query: 384 GSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLA 443
             GAFAH T+ + HPY+L+NY GK +D+MTLAHELGHG+H VL++  QG L  ++ LTLA
Sbjct: 356 SPGAFAHPTVTTAHPYLLVNYQGKVRDIMTLAHELGHGVHQVLAA-GQGGLMADTPLTLA 414

Query: 444 ETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRST 503
           ETAS+FGE LTF S+L   +    RK +LA K+EDMLN++VRQ++FY FE  +H ERR  
Sbjct: 415 ETASVFGEMLTFQSMLAKETEPARRKAMLAGKVEDMLNTVVRQVAFYQFECLVHDERRR- 473

Query: 504 GDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNS 563
           G++   RI E+W++ Q ESLGPA    D  Y SFW  +PHF+ + FYVYAYAFG+CLVNS
Sbjct: 474 GELSPDRIGELWMQVQVESLGPALRFDD-GYKSFWTYIPHFVHTPFYVYAYAFGDCLVNS 532

Query: 564 LYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDV 623
           LY +Y+ N    F EKYL++LRAG +K + +LL P  ++  DP FW +GL  V   ID++
Sbjct: 533 LYSVYR-NGAPHFAEKYLDMLRAGGTKRHQDLLAPFGLDAGDPAFWRQGLDVVVGFIDEL 591

Query: 624 EKM 626
           E M
Sbjct: 592 EAM 594


>gi|254441015|ref|ZP_05054508.1| oligoendopeptidase, pepF/M3 family [Octadecabacter antarcticus 307]
 gi|198251093|gb|EDY75408.1| oligoendopeptidase, pepF/M3 family [Octadecabacter antarcticus 307]
          Length = 612

 Score =  566 bits (1460), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 279/602 (46%), Positives = 390/602 (64%), Gaps = 8/602 (1%)

Query: 25  TTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC 84
           T        GNLP W+L DLYPS D++E+  D++ +E+   +F    EG LA      N 
Sbjct: 17  TAASGSTPFGNLPEWDLTDLYPSPDAKELKRDLDWLENACRSFAADHEGKLA----DLND 72

Query: 85  HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL 144
             L  A+  YE+I  + GRI S+A L Y  + + P   KF +D+  K+  +   L+F+ L
Sbjct: 73  EDLLDAVKRYEQIDIIAGRIMSFAGLRYYQHTTDPERSKFMSDMQDKITTYTTPLVFYGL 132

Query: 145 EINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRF 204
           E N +D+A ++   A +    +Y      +R +K + LS++ME  L D S VG  A  + 
Sbjct: 133 EFNRMDDAHVDGLLAANADLARYKPIFDRMRAMKPYQLSDEMEKFLHDQSVVGATAWNKL 192

Query: 205 FCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLA 264
           F E I +L+F ++ Q++ +        D DR  R+  ++ L+  F  +  +F+ + NTLA
Sbjct: 193 FDETIAALKFTVDGQEMNIEGTLNLLSDQDRATREKGSRELARVFGANVGLFARVHNTLA 252

Query: 265 KDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDT 324
           K++EI+DRWR        RHLSN+VEP V+EAL  +V + YP+ SHRYY LK KW+ LDT
Sbjct: 253 KEKEIEDRWRGMPSAQAGRHLSNHVEPEVVEALRNAVVDAYPRLSHRYYALKAKWMGLDT 312

Query: 325 MYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKG 384
           M  WDR APLP  +   + +  A   V+ +YA F P+M+ IA+ FFT  WIDA   DGK 
Sbjct: 313 MEVWDRNAPLPMETDRTVSWAEAEQTVMDAYAAFDPRMADIAKPFFTEGWIDAGVKDGKA 372

Query: 385 SGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAE 444
            GAFAH T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG L +++ LTLAE
Sbjct: 373 PGAFAHPTVTTVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGELLSSTPLTLAE 431

Query: 445 TASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTG 504
           TAS+FGE LTF  LL+ A++++ERKILLA K+EDM+N++VRQI+FYDFE KLH + RS G
Sbjct: 432 TASVFGEMLTFRKLLEQATTQQERKILLAGKVEDMINTVVRQIAFYDFECKLH-DARSNG 490

Query: 505 DIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSL 564
           ++    IN +W+  Q ESLGP F+  D  Y +FW  +PHF+ S FYVYAYAFG+ LVN+L
Sbjct: 491 ELTPDDINALWMSVQGESLGPVFNFMD-GYETFWAYIPHFVHSPFYVYAYAFGDGLVNAL 549

Query: 565 YDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVE 624
           Y +Y+    D FK+KY ++L+AG SKH+SELL P  ++ SDP FW +GL  +E MID++E
Sbjct: 550 YAVYEDMGED-FKDKYFDMLKAGGSKHHSELLAPFGLDASDPAFWAKGLGMIESMIDELE 608

Query: 625 KM 626
            M
Sbjct: 609 AM 610


>gi|209884233|ref|YP_002288090.1| oligoendopeptidase, PepF/M3 family [Oligotropha carboxidovorans
           OM5]
 gi|209872429|gb|ACI92225.1| oligoendopeptidase, PepF/M3 family [Oligotropha carboxidovorans
           OM5]
          Length = 630

 Score =  566 bits (1459), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 279/593 (47%), Positives = 385/593 (64%), Gaps = 6/593 (1%)

Query: 35  NLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS-LGAAIAE 93
            LP WNL DLY S  + EI+ D++ ++ + + F+  ++G +A   +Q      L  A+  
Sbjct: 42  KLPEWNLGDLYASITAPEIARDLDKLDADCVEFEAAYKGKIAARLSQPGAGEWLAEAVKA 101

Query: 94  YERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEAL 153
           YE I +L GR+ SYA L +  +   P I KFY D++ +L +    L+FF LE+N +D+ L
Sbjct: 102 YEAIDDLAGRLISYAGLVHAGDTVDPAISKFYGDVSERLTNASTHLLFFTLELNRIDDDL 161

Query: 154 LEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLR 213
           +EQ+  Q P    Y  W+++IRK K + L + +E L  + S     A  R F + I  LR
Sbjct: 162 IEQAM-QVPALGYYRPWLEDIRKDKPYQLEDRIEQLFHEKSTTSYGAWNRQFDQTIAGLR 220

Query: 214 FKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRW 273
           FK+  +++ +        D     RK+AA+AL+ TF  +   F+ ITNTLAKD+EI DRW
Sbjct: 221 FKVGAKELAIEPTLNFLQDRAPAKRKTAAQALAKTFKANERTFALITNTLAKDKEISDRW 280

Query: 274 RKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAP 333
           R ++ +ADSRHL+N VE  V++AL+ SV+  YP+ SHRYY LK  W K   +  WDR AP
Sbjct: 281 RGFQDVADSRHLANRVEREVVDALVASVRAAYPRISHRYYALKASWFKKKKLPHWDRNAP 340

Query: 334 LPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTI 393
           LP  +   I +  AR  VL++Y +FSP+M+ IA++FF   WIDAP   GK  GAF+H T 
Sbjct: 341 LPFAAAGNIAWGDARATVLKAYGEFSPEMASIAKRFFDDRWIDAPVRAGKAPGAFSHPTT 400

Query: 394 PSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETL 453
           PS HPY+L+NY GKP+DVMTLAHELGHG+H VL+++  G L   + LTLAETAS+FGE L
Sbjct: 401 PSAHPYVLMNYQGKPRDVMTLAHELGHGVHQVLAAK-NGALMAPTPLTLAETASVFGEML 459

Query: 454 TFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINE 513
           TF  LL    + ++R+ LLA K+EDM+N++VRQI+FY FE  +HTERR  G++   R+ E
Sbjct: 460 TFKRLLAQTKNAKQRQALLAGKVEDMINTVVRQIAFYTFERMVHTERRE-GELTAERLGE 518

Query: 514 IWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTV 573
           IWL  Q ESLGPA ++    Y +FWM +PHFI S FYVYAYAFG+CLVNSLY +Y+    
Sbjct: 519 IWLSVQGESLGPAIEIKP-GYETFWMYIPHFIHSPFYVYAYAFGDCLVNSLYAVYE-RAA 576

Query: 574 DCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           + F E+YL +L AG +KHYSELL P  ++  DP FW+ GL  +E MID++E M
Sbjct: 577 EGFAERYLAMLAAGGTKHYSELLAPFGLDAKDPTFWDGGLSVIEGMIDELETM 629


>gi|114771662|ref|ZP_01449066.1| Oligoendopeptidase F [alpha proteobacterium HTCC2255]
 gi|114547734|gb|EAU50624.1| Oligoendopeptidase F [alpha proteobacterium HTCC2255]
          Length = 609

 Score =  566 bits (1459), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 286/608 (47%), Positives = 395/608 (64%), Gaps = 16/608 (2%)

Query: 21  SSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
           S D  T D     G+LP W+L DLYPS D +EI+ D++ +E    +F + ++G L   T 
Sbjct: 14  SHDTVTGD----FGDLPNWDLNDLYPSPDGEEITKDLKALESNCSSFASEYQGQLDGLTA 69

Query: 81  QK--NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKV 138
           +   NC      I  YE I  + GR+ S+A LSY  N S     KF  D+ +K+ DF   
Sbjct: 70  EGLLNC------IERYEDIQNVAGRVMSFAGLSYYQNTSDANRSKFMADMQSKITDFTTP 123

Query: 139 LIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGR 198
           L+FF+LEIN +D+  ++     +    +Y   I N+RK+K H LS+++E  L D S VG 
Sbjct: 124 LVFFSLEINNIDDEHIQNLLNSNHKLSRYKPIIDNLRKMKPHQLSDELEQFLHDQSVVGT 183

Query: 199 EALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSF 258
            A  R F E + SL+F ++D+ + L        D +RE R+   +AL   F ++  +FS 
Sbjct: 184 AAWNRLFDETMASLKFNVDDELLSLEATLNLLSDKNRETREKGTRALIKVFGENISLFSR 243

Query: 259 ITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKK 318
           ITNTLAK++E++DRWRK      SRHL+N VEP V+EAL  +V   YPK SHRYY LK K
Sbjct: 244 ITNTLAKEKEVEDRWRKMPTPQFSRHLANQVEPEVVEALRNAVVTAYPKLSHRYYALKAK 303

Query: 319 WLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAP 378
           W+ LD++  WDR APL   +   I +E A+ +VL +Y+ FSP+M+ IAE FFT  WIDA 
Sbjct: 304 WMNLDSLEVWDRNAPLDSDNSSDIQWEDAKKIVLDAYSDFSPKMANIAEPFFTKGWIDAG 363

Query: 379 QYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNS 438
              GK  GAFAH T+ +VHPY++LNY+GK +DVMTLAHELGHG+H VL++ +QG L +++
Sbjct: 364 VKPGKAPGAFAHPTVTNVHPYVMLNYMGKQRDVMTLAHELGHGVHQVLAA-SQGELLSST 422

Query: 439 SLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHT 498
            LTLAETAS+FGE LTF  +L   +   +RK LLANK+EDM+N++VRQI+FYDFE KLH 
Sbjct: 423 PLTLAETASVFGEMLTFRKMLDKTTDPVKRKHLLANKVEDMINTVVRQIAFYDFECKLHA 482

Query: 499 ERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGN 558
             R+ G++   +INEIW+  Q ESLGP F+  +  Y +FW  +PHFI S FYVYAYAFG+
Sbjct: 483 A-RANGELTPDQINEIWMSIQAESLGPIFNFVE-GYETFWTYIPHFIHSPFYVYAYAFGD 540

Query: 559 CLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
            LVN+LY +Y+   +D F++KY ++L AG S H+ ELL P  ++ SDP FW++GL  +  
Sbjct: 541 GLVNALYAVYEEGNID-FQDKYFDMLSAGGSMHHKELLAPFGLDASDPKFWDKGLSLISS 599

Query: 619 MIDDVEKM 626
           MID++E M
Sbjct: 600 MIDELEAM 607


>gi|46202296|ref|ZP_00053453.2| COG1164: Oligoendopeptidase F [Magnetospirillum magnetotacticum
           MS-1]
          Length = 595

 Score =  565 bits (1457), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 271/603 (44%), Positives = 394/603 (65%), Gaps = 8/603 (1%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           MT +   ++LG LP W+L DLYP+ DS E+  D++  +  + AF+T + G LA     + 
Sbjct: 1   MTFVAPADDLGTLPEWDLSDLYPAPDSPELEADLQAADSAAQAFETTYAGRLAGLPGPE- 59

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
               GAAIAE+ERI ++I R  SYA L Y+ ++S     +FY  +  ++       +FF 
Sbjct: 60  ---FGAAIAEWERIGQIIYRAMSYAQLLYSGDVSDSERGRFYQGMQERVTGITSHTLFFT 116

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
           LEIN LD+A+L +   + P    Y++W+++ R  + H LS++ E +L +   VG  A  R
Sbjct: 117 LEINRLDDAVLAEKL-KAPAAAHYASWLRDTRMFRPHQLSDEAEKMLHELHVVGTAAWNR 175

Query: 204 FFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTL 263
            F E +  LRF ++ +++   +      D D   RK+AAK+L      ++ +F+ ITNTL
Sbjct: 176 LFDETMARLRFPLDGKEVTSAEVLNCLSDKDGARRKAAAKSLGKVLGDNAPLFALITNTL 235

Query: 264 AKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLD 323
           AK++EI+D+WR Y +    R+LSN VE  V++AL+++VK  +P+ SHRYY+LK KW  +D
Sbjct: 236 AKEKEIEDKWRNYARPQSFRNLSNQVEDGVVDALVEAVKGCFPQLSHRYYKLKAKWFGVD 295

Query: 324 TMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGK 383
            + +WDR APLP        +E ARD VL +Y  FSP M+ + ++FF +NWIDAP   GK
Sbjct: 296 VLDYWDRNAPLPDDDDRKYTWEQARDTVLGAYGAFSPDMAALGKRFFDNNWIDAPVRPGK 355

Query: 384 GSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLA 443
             GAFAH T+P+VHPY+L+N+LGK +DVMTLAHELGHG+H VL+S+ +G+L +++ LTLA
Sbjct: 356 SPGAFAHPTVPAVHPYLLVNFLGKSRDVMTLAHELGHGVHQVLASD-KGLLMSDTPLTLA 414

Query: 444 ETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRST 503
           ETAS+FGE LTF ++L   +S + R+I+LA+K+EDMLN++VRQ++FY FE  LH ERR  
Sbjct: 415 ETASVFGEMLTFRAMLARETSPKSRRIMLASKVEDMLNTVVRQVAFYQFESLLHDERRR- 473

Query: 504 GDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNS 563
           G++   RI E+W+  Q +SLGPA    D EY  FW  +PHF+ S FYVYAYAFG+CLVNS
Sbjct: 474 GELSPERIGELWMSVQADSLGPALRFDD-EYRHFWTYIPHFVHSPFYVYAYAFGDCLVNS 532

Query: 564 LYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDV 623
           LY ++    +  F  KYL++LRAG +  + +LL P  ++  DP FW +GL  V   ID++
Sbjct: 533 LYSVHAKGGIADFPAKYLDMLRAGGTLRHQDLLAPFGLDAGDPQFWRQGLDVVIGFIDEL 592

Query: 624 EKM 626
           E M
Sbjct: 593 EAM 595


>gi|114327031|ref|YP_744188.1| oligoendopeptidase F [Granulibacter bethesdensis CGDNIH1]
 gi|114315205|gb|ABI61265.1| oligoendopeptidase F [Granulibacter bethesdensis CGDNIH1]
          Length = 611

 Score =  565 bits (1456), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 272/602 (45%), Positives = 388/602 (64%), Gaps = 8/602 (1%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           +T     +  G LP W+L DLYP  DS  +  D+     +S+ F  R+ G LA      +
Sbjct: 16  VTAGSGSDAGGQLPAWDLSDLYPGPDSPALEADIAAATRDSVRFAERYAGQLAGL----D 71

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
              L  A+ +YERI E++GR+ SYA L ++ + S P I +FY  +N ++      LIFF 
Sbjct: 72  GAGLDEALRDYERIEEILGRLMSYAQLRFSEDSSDPEIGRFYQSMNERVTGISSHLIFFT 131

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
           LE+N LD+A LE+  A DP   ++  +++++R  + H LS+D+E  L +    G  A  R
Sbjct: 132 LELNRLDDATLERQLA-DPKAARWQPFLRDLRVFRPHQLSDDVEKALHEKDVTGHSAWTR 190

Query: 204 FFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTL 263
            F E I ++R  +  +++ ++ A       +R +R+ A KA+   F     +FSFITNTL
Sbjct: 191 LFDETIAAMRVTVGGEELTVSAALNRLSSGNRTMREEAGKAIGAAFGAQKRLFSFITNTL 250

Query: 264 AKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLD 323
           AKD+EI D  R YE+    R+ +N VE  V++AL+ +V+  Y + SHRYY LK KWL LD
Sbjct: 251 AKDKEIVDTLRHYERPGSYRNRANMVEDEVVDALVSAVRADYGRLSHRYYALKAKWLGLD 310

Query: 324 TMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGK 383
            +  WDR APLPG     IP+  A+  VL +Y  FSP+M+ I  +FF H WIDA    GK
Sbjct: 311 KLSHWDRNAPLPGDDDREIPWPEAKRRVLDAYGAFSPEMAEIGSRFFDHPWIDARLLPGK 370

Query: 384 GSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLA 443
             GAFAH T+PSVHPYILLNY G+ +DVMTLAHELGHG+H V++ + QG + +N+ LTLA
Sbjct: 371 SGGAFAHPTVPSVHPYILLNYHGRTRDVMTLAHELGHGVHQVVAGQAQGYMLSNTPLTLA 430

Query: 444 ETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRST 503
           ETAS+FGE LTF ++L+A +    R+++LA+K+EDMLN++VRQ +FY+FE ++H ERRS 
Sbjct: 431 ETASVFGEMLTFRAMLEAETDPVRRRLMLASKVEDMLNTVVRQTAFYEFETRVHNERRS- 489

Query: 504 GDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNS 563
           G+I   R+ EIW + Q ESLGP FD +  EY  FW  +PHFI + FYVYAYAFG+CLVN+
Sbjct: 490 GEILPERLGEIWRQVQVESLGPVFDFTP-EYDVFWAYIPHFIHTPFYVYAYAFGDCLVNA 548

Query: 564 LYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDV 623
           LY +++    D F++KY+++LRAG +K + ELL P  ++ SDP FW++GL  +   ID +
Sbjct: 549 LYAVFQDGHPD-FQQKYMDMLRAGGTKRHRELLAPFGLDASDPAFWKKGLDVIAGFIDAL 607

Query: 624 EK 625
           E+
Sbjct: 608 EE 609


>gi|260434071|ref|ZP_05788042.1| putative oligoendopeptidase F [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417899|gb|EEX11158.1| putative oligoendopeptidase F [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 606

 Score =  565 bits (1455), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 280/604 (46%), Positives = 385/604 (63%), Gaps = 9/604 (1%)

Query: 23  DMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           D       +NLGNLP WNL+DLY   D+ E++ D+E +E E   F   +EG LA    Q 
Sbjct: 10  DANAGGGADNLGNLPEWNLDDLYTGQDAPELTRDLEWLEQECAGFAADYEGKLADLDAQ- 68

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
               L   +   E+I  + GRI S+A L Y    +     KF +D+  K+  F   L+FF
Sbjct: 69  ---GLLTCVQRNEKINAVAGRIMSFAGLRYYQLTTDAERAKFLSDMQEKVTLFTTPLVFF 125

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
            LEIN +D+ +L   +  +    +Y    + IR +K + LS+++E  L D   VG +A +
Sbjct: 126 TLEINRIDDDVLAAHFKANADLARYEPVFRRIRAMKPYQLSDELEKFLHDLGVVG-DAWE 184

Query: 203 RFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNT 262
           R F E I  L F +N +++ +        + DR  R++AA+ L+  F  +  IF+ + NT
Sbjct: 185 RLFDETIAGLTFTVNGEELNIEGTLNLLTEQDRSKREAAARELARVFQDNIKIFARVHNT 244

Query: 263 LAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKL 322
            AK++EI DRWRK      +RHL+N+VEP V+EAL ++V   YPK SHRYYELK+KWL L
Sbjct: 245 QAKEKEIIDRWRKMPTPQTARHLANDVEPEVVEALREAVVAAYPKLSHRYYELKRKWLGL 304

Query: 323 DTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDG 382
           D M  WDR APLP      +P+E A   V+++YA F P+M+ IA  FF+  WIDA    G
Sbjct: 305 DVMQVWDRNAPLPMEDTRTVPWEDAEKTVMEAYAAFDPRMAEIAAPFFSKGWIDAAVKPG 364

Query: 383 KGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTL 442
           K  GAFAH T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG + +++ LTL
Sbjct: 365 KAPGAFAHPTVTDVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGEMLSSTPLTL 423

Query: 443 AETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRS 502
           AETAS+FGE LTF  +L  A + E+RK+LLA K+EDM+N++VRQI+FYDFE KLH  RR 
Sbjct: 424 AETASVFGEMLTFRKMLDQAETPEQRKVLLAGKVEDMINTVVRQIAFYDFECKLHAARRE 483

Query: 503 TGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVN 562
            G++    IN +W+  Q ESLGPAF+  D  Y +FW  +PHF+ S FYVYAYAFG+ LVN
Sbjct: 484 -GELTPDDINALWMSVQAESLGPAFEFMD-GYETFWAYIPHFVHSPFYVYAYAFGDGLVN 541

Query: 563 SLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
           +LY +Y+S   D F++KY  +LRAG SKH+ ELL P  ++ SDP FW++GL  +   ID+
Sbjct: 542 ALYSVYESGA-DGFEDKYFEMLRAGGSKHHKELLEPFGLDASDPKFWDKGLSMISGFIDE 600

Query: 623 VEKM 626
           +E M
Sbjct: 601 LEAM 604


>gi|83311927|ref|YP_422191.1| oligoendopeptidase F-like protein [Magnetospirillum magneticum
           AMB-1]
 gi|82946768|dbj|BAE51632.1| Oligoendopeptidase F homolog [Magnetospirillum magneticum AMB-1]
          Length = 878

 Score =  564 bits (1453), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 274/609 (44%), Positives = 396/609 (65%), Gaps = 8/609 (1%)

Query: 18  ALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAH 77
           A R   MT +   ++LG LP W+L DLYP+ DS E+  D++  +  + AF+T + G LA 
Sbjct: 278 ATRRQRMTFVAPADDLGTLPEWDLSDLYPAPDSPELEADLQAADAAAQAFETAYAGKLAE 337

Query: 78  ATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEK 137
               +     GAAIAE+ERI ++I R  SYA L Y+ ++S     +FY  +  ++     
Sbjct: 338 LPGAQ----FGAAIAEWERIGQIIYRAMSYAQLLYSGDVSDSERGRFYQGMQERVTGITT 393

Query: 138 VLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVG 197
             +FF LEIN LD+ +L +   + P T  Y++W+++ R  + H LS++ E +L +   VG
Sbjct: 394 RTLFFTLEINRLDDTVLAEKL-KSPETAHYASWLRDTRVFRPHQLSDEAEKMLHELHVVG 452

Query: 198 REALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
             A  R F E +  LRF ++ +++   +      D D   RK+AAK+L      ++ +F+
Sbjct: 453 TAAWNRLFDETMARLRFPLDGREVTSAEVLNCLSDKDGARRKAAAKSLGKVLGDNAPLFA 512

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
            ITNTLAK++EI+D+WR Y +    R+LSN VE  V++AL+++VK  +P+ SHRYY+LK 
Sbjct: 513 LITNTLAKEKEIEDKWRNYARPQSFRNLSNQVEDGVVDALVEAVKGCFPQLSHRYYKLKA 572

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           KW  +D M +WDR APLP        +E ARD VL +Y  FSP M+ + ++FF +NWIDA
Sbjct: 573 KWFGVDVMDYWDRNAPLPDDDDRKYTWEQARDTVLGAYGAFSPDMAEVGKRFFDNNWIDA 632

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
           P   GK  GAFAH T+P+VHPY+L+N+LGK +DVMTLAHELGHG+H VL+   QG+L ++
Sbjct: 633 PVRPGKSPGAFAHPTVPTVHPYLLVNFLGKSRDVMTLAHELGHGVHQVLAG-GQGLLMSD 691

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
           + LTLAETAS+FGE LTF ++L+  +S + R+I+LA+K+EDM+N++VRQ++FY FE  LH
Sbjct: 692 TPLTLAETASVFGEMLTFRAMLERETSPKSRRIMLASKVEDMINTVVRQVAFYQFESLLH 751

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
            ERR  G++   RI E+W+  Q +SLGPAF   D EY  FW  +PHF+ S FYVYAYAFG
Sbjct: 752 DERRR-GELSPERIGELWMSVQADSLGPAFRFDD-EYRHFWTYIPHFVHSPFYVYAYAFG 809

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
           +CLVNSLY ++    +  F  KYL++LRAG +  + +LL P  ++  DP FW +GL  V 
Sbjct: 810 DCLVNSLYSVHAKGGLADFPAKYLDMLRAGGTLRHQDLLAPFGLDAGDPQFWRQGLDVVI 869

Query: 618 KMIDDVEKM 626
             ID++E M
Sbjct: 870 GFIDELEAM 878


>gi|170741333|ref|YP_001769988.1| pepF/M3 family oligoendopeptidase [Methylobacterium sp. 4-46]
 gi|168195607|gb|ACA17554.1| oligoendopeptidase, pepF/M3 family [Methylobacterium sp. 4-46]
          Length = 616

 Score =  563 bits (1452), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 279/596 (46%), Positives = 379/596 (63%), Gaps = 6/596 (1%)

Query: 32  NLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCH-SLGAA 90
           +LG LP W+L DLY   D    + D+   E E  +F   + G +A     +     LG A
Sbjct: 24  DLGPLPEWDLSDLYAGLDDPAFARDLARAEAECRSFAETYRGRVAALAGGEGAADQLGTA 83

Query: 91  IAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLD 150
           +A YE I +L+GR+ S+A L Y+ N + P   KFY D   +L      L+FF LE+N + 
Sbjct: 84  VAAYEAIEDLMGRLMSFAGLVYSGNTTDPVRAKFYGDTQERLTAASSDLLFFTLELNRVP 143

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIE 210
           +A ++ + A      +Y  W+++IR+ K H LS+D+E LL + S  GR A  R F E I 
Sbjct: 144 DADIDAAAALP-PLARYRPWLEDIRREKPHQLSDDLEKLLLEKSVTGRSAWNRLFDETIA 202

Query: 211 SLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
           SLRF +  +++ L        D+D  +R+ AA+ALS  F  +  +F+ ITNTLAKD+EI 
Sbjct: 203 SLRFPLRGEQLTLEPTLNKLQDADEGLRRDAAEALSGVFRANLRVFTLITNTLAKDKEIS 262

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
           DRWR++  +ADSRHL+N VEP V+ AL+++V   YP+ SHRYY LK +W + D++ +WDR
Sbjct: 263 DRWRRFGDVADSRHLANRVEPEVVAALVEAVTAAYPRLSHRYYRLKARWFQRDSLAYWDR 322

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
            APLP   Q  IP+  AR+ VL +Y  FSP+M+ IA  FF   WIDAP   GK  GAFAH
Sbjct: 323 NAPLPKVEQRTIPWAEARETVLSAYGAFSPRMAEIARTFFEGGWIDAPVRPGKAPGAFAH 382

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
            T+PS HPY+L+NY GKP+DVMTLAHELGHG+H VL++   G L   + LTLAETAS+FG
Sbjct: 383 PTVPSAHPYVLVNYQGKPRDVMTLAHELGHGVHQVLAA-GNGALMAPTPLTLAETASVFG 441

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E LTF  +L A     +R+ LLA K+EDM+N++VRQI+FY FE +LH  RR  G++   +
Sbjct: 442 EMLTFRRVLDATREPHQRRALLAAKVEDMINTVVRQIAFYVFERRLHLARRD-GELTAEQ 500

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
           I  +W+  Q ESLGPA  L D  Y  FW  +PHFI S FYVYAYAFG+CLVNSLY +Y+ 
Sbjct: 501 ICALWMSVQAESLGPAIRL-DEGYEPFWAYIPHFIHSPFYVYAYAFGDCLVNSLYGVYQ- 558

Query: 571 NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              + F  +Y  +L AG +K Y ELL P  ++  DP+FW+ GL  +E MI ++E M
Sbjct: 559 RAEEGFVARYFALLSAGGTKPYGELLAPFGLDARDPSFWQIGLSMIEGMIAELEAM 614


>gi|254473018|ref|ZP_05086416.1| oligoendopeptidase, PepF/M3 family [Pseudovibrio sp. JE062]
 gi|211957739|gb|EEA92941.1| oligoendopeptidase, PepF/M3 family [Pseudovibrio sp. JE062]
          Length = 596

 Score =  563 bits (1451), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 276/595 (46%), Positives = 396/595 (66%), Gaps = 6/595 (1%)

Query: 32  NLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAI 91
           +LG+LP W+L   Y S +   I  DME  +  +  F+   +G LA     ++   +   +
Sbjct: 5   SLGDLPEWDLSVFYSSIEDPAIDQDMERAKELAEQFEADCKGKLAEIA-ARSGDEMAEIV 63

Query: 92  AEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDE 151
             YE + +L+GRI SYA LSY  + + P  +KFY D+  KL      ++FF+LE+N +DE
Sbjct: 64  RRYEELEDLMGRIGSYAGLSYAGDTTDPARQKFYGDVQEKLTTASLHMLFFSLEMNKIDE 123

Query: 152 ALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIES 211
           A+LE++   + L   Y  W++++RK + H  S ++E L  +    G  A  R F E I  
Sbjct: 124 AVLEEALKSEKLAY-YRPWLEDLRKERPHERSEEIEQLFHEKHVTGAAAWNRLFDETISG 182

Query: 212 LRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
            R++I+ +++ + +       +D E+RK AA ALS TF K+  IF+ ITNTLAKD++  D
Sbjct: 183 SRYEIDGEELSIEQTLNLLQGADAELRKKAAGALSKTFAKNLSIFTLITNTLAKDKDTYD 242

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRL 331
           RW  +E IADSRHLSN VE  V++AL+ SV+  YP+ SHRYY +K KWL ++ M+FWDR 
Sbjct: 243 RWHNFEDIADSRHLSNRVEREVVDALVDSVRAAYPRLSHRYYAMKAKWLGVEKMHFWDRN 302

Query: 332 APLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHG 391
           APLP      IP++ A+  VL +Y+KFSP++S IAE+FF  NWID     GK  GAF+H 
Sbjct: 303 APLPQADTRDIPWDEAKTTVLDAYSKFSPELSSIAEEFFDKNWIDGAARPGKSPGAFSHP 362

Query: 392 TIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE 451
           T+PS HP++L+NY GK +DVMTLAHELGHG+H VL++   G L   + LTLAETAS+FGE
Sbjct: 363 TVPSAHPFVLINYQGKIRDVMTLAHELGHGVHQVLAA-PNGALMAPTPLTLAETASVFGE 421

Query: 452 TLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRI 511
            LTF  LL  A + E+R+I+LA K+EDMLN++VRQI+FY FE ++H E R  G++ + +I
Sbjct: 422 MLTFKDLLAKAETPEKRQIMLAGKVEDMLNTVVRQIAFYTFERQVH-ELRKEGELTSEQI 480

Query: 512 NEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSN 571
           + IW+  Q+ESLG A DL    Y ++W  +PHFI S FYVYAYAFG+CLVNSLY +Y+  
Sbjct: 481 SAIWMSVQEESLGEAIDLEG-GYENYWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVYE-E 538

Query: 572 TVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
             + F++KY ++L+AG +KH+SELL P  ++ +DP FW++GL  +E+ ID++E+M
Sbjct: 539 AEEGFQQKYFDLLKAGGTKHHSELLAPFGLDATDPAFWQKGLAVIERFIDELEEM 593


>gi|84515397|ref|ZP_01002759.1| Oligoendopeptidase F [Loktanella vestfoldensis SKA53]
 gi|84510680|gb|EAQ07135.1| Oligoendopeptidase F [Loktanella vestfoldensis SKA53]
          Length = 601

 Score =  563 bits (1451), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 281/598 (46%), Positives = 378/598 (63%), Gaps = 8/598 (1%)

Query: 29  SQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG 88
            + + G+LP W+L DLYPS DS EI+ DM  +E E  AF   +EG LA      +   L 
Sbjct: 12  GKNSFGDLPEWDLTDLYPSPDSPEITRDMAWLETECAAFAADYEGKLA----SLDAAGLL 67

Query: 89  AAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINT 148
            A+  YE+I  + GRI S+A L Y    +     KF  D   ++  F   L+F+ LE N 
Sbjct: 68  GAVQRYEQIDVIAGRIMSFAGLRYYQITTDSDRAKFMADCQDRITRFTTPLVFYGLEFNR 127

Query: 149 LDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCEN 208
           LD+  L    A +    +Y      +R +K H LS+++E  L D S VG  A  R F E 
Sbjct: 128 LDDTHLAGLLAANADLARYKPVFDRMRAMKPHQLSDELEKFLHDQSTVGAAAWNRLFDET 187

Query: 209 IESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEE 268
           +  L F ++   + L        D DR  R++A  AL+  F ++  IF+ + NTLAK++E
Sbjct: 188 MAGLEFVVDGDVLSLEGTLNLLTDPDRAKREAATHALTAVFRENIKIFARVHNTLAKEKE 247

Query: 269 IQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFW 328
           I DRWRK      +RHL+N+VEP V+EAL  +V   YP+ SHRYY LK KWL LD M  W
Sbjct: 248 IHDRWRKMPSPQAARHLANHVEPEVVEALRNAVVAAYPRLSHRYYALKAKWLGLDRMQVW 307

Query: 329 DRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAF 388
           DR APLP     +I +E ARD VL +YA F P+M+ IA +FF   WIDA    GK  GAF
Sbjct: 308 DRNAPLPMDQTRVIGWEEARDTVLTAYAGFDPRMAEIAGRFFDKGWIDAATKPGKAPGAF 367

Query: 389 AHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASI 448
           AH T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL++E QG L +++ LTLAETAS+
Sbjct: 368 AHPTVTPVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAE-QGELLSSTPLTLAETASV 426

Query: 449 FGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPT 508
           FGE LTF  L   A + ++RK+LLA K+EDM+N++VRQI+FYDFE KLH   R+ G++  
Sbjct: 427 FGEMLTFRQLRDTAKTPQDRKVLLAGKVEDMINTVVRQIAFYDFECKLHAA-RAEGELTP 485

Query: 509 HRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIY 568
             IN +W+  Q ESLGP FD +D  Y +FW  +PHF+ S FYVYAYAFG+ LVN+LY ++
Sbjct: 486 EDINALWMSVQAESLGPVFDFAD-GYETFWAYIPHFVHSPFYVYAYAFGDGLVNALYAVF 544

Query: 569 KSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           +    D F++KY  +LRAG SKH+ +LL P  ++ SDP FW++GL  +E MID++E +
Sbjct: 545 EEGDAD-FRDKYFAMLRAGGSKHHKDLLAPFGLDASDPAFWDKGLALIESMIDELEAL 601


>gi|170749210|ref|YP_001755470.1| pepF/M3 family oligoendopeptidase [Methylobacterium radiotolerans
           JCM 2831]
 gi|170655732|gb|ACB24787.1| oligoendopeptidase, pepF/M3 family [Methylobacterium radiotolerans
           JCM 2831]
          Length = 623

 Score =  562 bits (1448), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 283/596 (47%), Positives = 373/596 (62%), Gaps = 6/596 (1%)

Query: 32  NLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAH-ATNQKNCHSLGAA 90
           +LG+LP W+L DLY   D    S DM   E E   F   + G +A  A        L  A
Sbjct: 29  DLGHLPEWDLTDLYSGLDDPNFSGDMTRAEEECRRFSETYAGRIAELAAGPDASARLAEA 88

Query: 91  IAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLD 150
           +  YE I +L+G++ S+A L Y+ + +     KFY D   +L      L+FFALE+N +D
Sbjct: 89  VRTYEGIEDLLGKLMSFAGLVYSGDTTDEARAKFYGDTRERLTGASADLLFFALELNRVD 148

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIE 210
           +A +  + A  PL   Y+ WI+++R+ K H L +  E L  + S     A  R F E I 
Sbjct: 149 DAAMNAAMAGGPLA-HYAPWIEDLRREKPHQLDDRTEKLFLEKSVTSNAAWDRLFNETIA 207

Query: 211 SLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
           SLRF +  +++PL        D D  VRK AA A+S        +F+ ITNTLAKD+EI 
Sbjct: 208 SLRFTVQGEEMPLEPTLNKLQDPDGAVRKEAAGAISAVLRGQLRVFTLITNTLAKDKEIS 267

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
           DRWR ++ +AD+RHLSN VEP V+EAL+ +V+  YP+ SHRYY LK KW   + + +WDR
Sbjct: 268 DRWRGFKDVADARHLSNRVEPEVVEALVDAVRAAYPRLSHRYYTLKAKWFGQEALPYWDR 327

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
            APLP   Q  IP+  ARD VL +Y  FSP+M+ IA +FF   WIDAP   GK  GAFAH
Sbjct: 328 NAPLPRVEQRTIPWTEARDTVLSAYDAFSPKMAGIARRFFDERWIDAPTRPGKAPGAFAH 387

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
            T+PSVHPY+L+NY GKP+DVMTLAHELGHG+H VL+    G L   + LTLAETAS+FG
Sbjct: 388 PTVPSVHPYVLVNYQGKPRDVMTLAHELGHGVHQVLAG-PNGALMAPTPLTLAETASVFG 446

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E LTF  LL A +   +R+ +LA K+EDM+N++VRQI+FY FE K+H   R+ G++ T +
Sbjct: 447 EMLTFRRLLAATTDTTQRRAMLAAKVEDMINTVVRQIAFYSFERKVHLA-RAKGELTTDQ 505

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
           IN +WL  Q ESLGPA  L D  Y  FW  +PHFI S FYVYAYAFG+CLVNSLY +Y +
Sbjct: 506 INALWLSVQAESLGPAITL-DSGYEPFWAYIPHFIHSPFYVYAYAFGDCLVNSLYGVY-A 563

Query: 571 NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              + F ++Y  +L AG SK Y ELL P  ++  DP FW+ GL  +E MI ++E M
Sbjct: 564 RAEEGFVDRYFALLSAGGSKPYGELLAPFGLDAKDPGFWQIGLGMIESMIVELESM 619


>gi|154252499|ref|YP_001413323.1| pepF/M3 family oligoendopeptidase [Parvibaculum lavamentivorans
           DS-1]
 gi|154156449|gb|ABS63666.1| oligoendopeptidase, pepF/M3 family [Parvibaculum lavamentivorans
           DS-1]
          Length = 614

 Score =  561 bits (1445), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 275/607 (45%), Positives = 394/607 (64%), Gaps = 6/607 (0%)

Query: 21  SSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNL-AHAT 79
           SS     D QE LG LP WNL DLY + D+ E+  D+      + AF   ++G + A A 
Sbjct: 12  SSVSNAKDQQELLGELPVWNLGDLYSAPDAPEVKADLRWAAEAAAAFNKLYKGRIGALAA 71

Query: 80  NQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVL 139
             +    + AA+  YE I + +GR+ S+A L Y  +  +P   KFY D+  ++      L
Sbjct: 72  APEGGKEIAAALKAYEEIEDKLGRLISFAGLLYAQDSVNPAYAKFYGDMQGQITTISTDL 131

Query: 140 IFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGRE 199
           +FFALE+N +++ +L ++  +DP    Y+ W++++R ++ + LS+++E LL + S  G  
Sbjct: 132 LFFALELNRVEDDVLAKAL-EDPALGHYAPWLRDLRAMRPYQLSDELETLLHEKSLTGHA 190

Query: 200 ALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFI 259
           A  R F E +  L F+++ + + +  A     D D   R+ AA AL+ TF  ++ +F+ I
Sbjct: 191 AWNRLFDETMARLTFEVDSETLTVEGALHLLSDHDAAKREVAAHALAKTFKANTPLFTLI 250

Query: 260 TNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKW 319
           TNTLAKD+EI+DR R ++ IA SRH++N VEP V+EAL+ +V+  YP  SHRYY +K KW
Sbjct: 251 TNTLAKDKEIEDRLRGFDDIAQSRHIANRVEPEVVEALVDAVRRAYPDLSHRYYAMKAKW 310

Query: 320 LKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQ 379
           L LD + +WDR APLP +   +IP+  ARD VL +Y  F+P M+ IA +FF   WIDAP 
Sbjct: 311 LGLDRLEYWDRNAPLPHSDDAVIPWNQARDTVLDAYRGFTPDMAKIAGQFFDKGWIDAPM 370

Query: 380 YDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSS 439
             GK +GAFAH T+PS HPY+L+NY GK +DVMTLAHELGHG+H VL+++ QG L  ++ 
Sbjct: 371 RAGKATGAFAHPTVPSAHPYVLVNYQGKTRDVMTLAHELGHGVHQVLAAK-QGPLMADTP 429

Query: 440 LTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTE 499
           LTLAETAS+FGE LTF  LL  A +KE RK +LA+K+EDMLN++VRQ +FY FE ++HT 
Sbjct: 430 LTLAETASVFGEMLTFRKLLAGAQTKERRKAMLASKVEDMLNTVVRQTAFYTFERRVHTA 489

Query: 500 RRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNC 559
           RR  G++ +  I  IWL+ Q ESLGPA  L +  Y ++W  + HFI + FYVYAYAFG+C
Sbjct: 490 RRE-GELTSEDIGRIWLDVQGESLGPAIHLGE-GYETYWCYISHFIHAPFYVYAYAFGDC 547

Query: 560 LVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKM 619
           LVNSLY +Y+    + F E+Y  +L AG +  + ELL P  ++ SDP FW++GL  +   
Sbjct: 548 LVNSLYAVYE-QAQEGFAERYFEMLSAGGTLRHKELLAPFGLDASDPAFWDKGLSMIRGF 606

Query: 620 IDDVEKM 626
           ID++E M
Sbjct: 607 IDELEAM 613


>gi|126733176|ref|ZP_01748923.1| Oligoendopeptidase F [Roseobacter sp. CCS2]
 gi|126716042|gb|EBA12906.1| Oligoendopeptidase F [Roseobacter sp. CCS2]
          Length = 605

 Score =  560 bits (1442), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 286/602 (47%), Positives = 378/602 (62%), Gaps = 8/602 (1%)

Query: 25  TTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC 84
           T     ++LGNLP W+L DLYP  DS E+  DM  +E E  AF   +EG LA      + 
Sbjct: 10  TNTSGGKDLGNLPEWDLSDLYPGTDSPELERDMAWLEKECAAFAVDFEGKLA----DLDA 65

Query: 85  HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL 144
             L  A+  YE+I  + GRI S+A L Y    +     KF  D   K+  +   L+F+ L
Sbjct: 66  PGLLGAVQRYEQIDVIAGRIMSFAGLRYYQCTTDSDRAKFMADCQDKITTYTTPLVFYGL 125

Query: 145 EINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRF 204
           E N LD+  L    A +    +Y      +R +K H LS+++E  L D S VG  A  R 
Sbjct: 126 EFNRLDDDHLADLLAANADLARYRPVFDRMRAMKPHQLSDELEKFLHDQSTVGAAAWNRL 185

Query: 205 FCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLA 264
           F E +  L+F ++ + + L        + DR  R +A  AL+  F  +  IFS + NTLA
Sbjct: 186 FDETMAGLKFTVDGETLSLEATLNLLTEQDRNKRAAATHALAEVFQDNIKIFSRVHNTLA 245

Query: 265 KDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDT 324
           K++EI DRWRK       RHLSN+VE  V+EAL  +V   YP+ SHRYY LK KWL LD 
Sbjct: 246 KEKEIDDRWRKMPTPQTGRHLSNHVEAEVVEALRNAVVAAYPRLSHRYYALKAKWLGLDR 305

Query: 325 MYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKG 384
           M  WDR APLP  S  I+ ++ A + V+ +YA F P+M+ IA+ FFT  WIDA    GK 
Sbjct: 306 MQVWDRNAPLPMESDKIVDWDEATNTVMDAYAGFDPKMAEIAKPFFTDGWIDAAVKPGKA 365

Query: 385 SGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAE 444
            GAFAH T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL++E QG L +++ LTLAE
Sbjct: 366 PGAFAHPTVTPVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAE-QGELLSSTPLTLAE 424

Query: 445 TASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTG 504
           TAS+FGE LTF  +L  A +KEERKILLA K+EDM+N++VRQI+FYDFE KLH   R+ G
Sbjct: 425 TASVFGEMLTFQKMLDGAQTKEERKILLAGKVEDMINTVVRQIAFYDFECKLHAA-RAEG 483

Query: 505 DIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSL 564
           ++    IN +W+  Q ESLGP FD ++  Y +FW  +PHF+ S FYVYAYAFG+ LVN+L
Sbjct: 484 ELTPDDINALWMSVQAESLGPVFDFAE-GYETFWAYIPHFVHSPFYVYAYAFGDGLVNAL 542

Query: 565 YDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVE 624
           Y +Y     D F+EKY ++LRAG SKH+ ELL P  ++ SDP FW++GL  +  MID++E
Sbjct: 543 YAVYAEGDPD-FREKYFDMLRAGGSKHHKELLAPFGLDASDPKFWDKGLAMISGMIDELE 601

Query: 625 KM 626
            M
Sbjct: 602 AM 603


>gi|323137997|ref|ZP_08073071.1| oligoendopeptidase, pepF/M3 family [Methylocystis sp. ATCC 49242]
 gi|322396716|gb|EFX99243.1| oligoendopeptidase, pepF/M3 family [Methylocystis sp. ATCC 49242]
          Length = 611

 Score =  559 bits (1441), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 276/592 (46%), Positives = 383/592 (64%), Gaps = 6/592 (1%)

Query: 36  LPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAH-ATNQKNCHSLGAAIAEY 94
           LP WNL DLYP  DS ++ +D+     E   F   + G LA  AT      +LG A+A Y
Sbjct: 22  LPEWNLADLYPGTDSPQLKSDLARAATEVAQFGKDYRGRLAEMATGADASVALGKALARY 81

Query: 95  ERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALL 154
           E + +L+GR+ S+A L Y+ + + P   KFY D+  K+ +    L+FF LE+N LD+  L
Sbjct: 82  EALQDLLGRLMSFAGLLYSGDTTDPARAKFYGDVQEKVTNASAQLLFFQLELNRLDDETL 141

Query: 155 EQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF 214
             +  ++PL L++  W+++IRK K + L + +E L  +    G  A  R F E I SLRF
Sbjct: 142 MAAAGKEPL-LRWRPWLEDIRKEKPYELEDKLEELFHEKYISGAAAWNRLFDETIASLRF 200

Query: 215 KINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWR 274
           K+  +++ +        D +   RK AA A+  T   +  +FS ITNTLAKD+EI DRWR
Sbjct: 201 KVGGEELAIEPVLNLMQDPNEAKRKEAALAIGATLKANQRVFSLITNTLAKDKEISDRWR 260

Query: 275 KYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPL 334
            +E +ADSRHLSN VE  V+EAL ++V++ +P+ SHRYY LK KW   D + +WDR APL
Sbjct: 261 GFEDVADSRHLSNRVEREVVEALAKAVEDAHPRLSHRYYRLKAKWFGKDALDYWDRSAPL 320

Query: 335 PGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIP 394
           P T   +  +  AR +VL +Y  F+P+M+ IA  FF   WIDAP   GK  GAF+H T+P
Sbjct: 321 PATPSKLYTWPEARAIVLGAYKGFAPRMAQIAGDFFDKKWIDAPVRPGKAPGAFSHPTVP 380

Query: 395 SVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLT 454
           S HPY+LLN+ GK +DVMTLAHELGHG+H VL++  QG L   + LTLAETAS+FGE LT
Sbjct: 381 SAHPYVLLNFQGKTRDVMTLAHELGHGVHQVLAAR-QGALMAPTPLTLAETASVFGEMLT 439

Query: 455 FDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEI 514
           F +LL  A+ K +R+ LLA+K+EDM+N++VRQ++FY FE K+HTERR+ G++   +I ++
Sbjct: 440 FRALLAQATDKNQRRALLASKVEDMINTVVRQMAFYAFERKVHTERRN-GELTADQICDL 498

Query: 515 WLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVD 574
           W+  Q ESLGP+  L    Y  FW  +PHFI S FYVYAYAFG+CLVNSLY +Y+    +
Sbjct: 499 WMSVQAESLGPSIRLGP-GYECFWAYIPHFIHSPFYVYAYAFGDCLVNSLYGVYQ-KAHE 556

Query: 575 CFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            F E+Y  +L AG +K Y+ELL P  ++  DP FW  GL+ +E +I ++E M
Sbjct: 557 GFAERYFALLEAGGAKPYNELLKPFGLDARDPAFWNIGLEMIEGLIAELEAM 608


>gi|126727495|ref|ZP_01743329.1| Peptidase M3B, oligoendopeptidase-related clade 3 [Rhodobacterales
           bacterium HTCC2150]
 gi|126703275|gb|EBA02374.1| Peptidase M3B, oligoendopeptidase-related clade 3 [Rhodobacterales
           bacterium HTCC2150]
          Length = 612

 Score =  559 bits (1441), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 274/604 (45%), Positives = 384/604 (63%), Gaps = 8/604 (1%)

Query: 23  DMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           D  T       G+LP WNL+DLY   ++ E++ DM  +E+    F   +EGNLA      
Sbjct: 15  DAATSGGTNEFGDLPEWNLDDLYKGEEASELTRDMAWLENACADFAKTYEGNLAGL---- 70

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
           N  ++   I  YE+I    GRI S+A L Y  N +     KF +D    +  F   L+FF
Sbjct: 71  NADAMLECILAYEKIDSTAGRIMSFAGLRYYQNTTDADRAKFMSDCQENITVFTTPLVFF 130

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
           +LE N +++A  E   A +    +Y   +  +R +K + LS+++E  L D S VG  A  
Sbjct: 131 SLEFNRIEDADYEAIIAANADLARYRPVLDRMRAMKPYQLSDELEKFLHDQSTVGSAAWN 190

Query: 203 RFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNT 262
           R F E++  L F+++ + +PL        D DR  R+  A+A++     +  +++ I NT
Sbjct: 191 RLFDESMAGLEFEVDGEMLPLEATLNLMSDQDRATREKGARAVAAVLQDNVKLYARIHNT 250

Query: 263 LAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKL 322
           LAK++EI+DRWR        RHLSN+VEP V+EAL  +V   YPK SHRYY LK KW+ L
Sbjct: 251 LAKEKEIEDRWRGLPTPQTGRHLSNHVEPEVVEALRNAVVAAYPKLSHRYYALKAKWMGL 310

Query: 323 DTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDG 382
           D M  WDR APLP   +  +P++ A DLV+++Y  F+P+M+ +A+ FFT  WIDA    G
Sbjct: 311 DEMQVWDRNAPLPSEIKRTVPWDEAEDLVMKAYGDFAPEMAELAKPFFTDGWIDAAVKPG 370

Query: 383 KGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTL 442
           K  GAFAH T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL++E QG + +++ LTL
Sbjct: 371 KAPGAFAHPTVTDVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAE-QGEMLSSTPLTL 429

Query: 443 AETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRS 502
           AETAS+FGE LTF  +L+ A  + ERKILLA K+EDM+N++VRQI+FYDFE KLH   R+
Sbjct: 430 AETASVFGEMLTFRKMLEGAKDQSERKILLAGKVEDMINTVVRQIAFYDFECKLHAA-RA 488

Query: 503 TGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVN 562
            G++    IN +W+  Q ESLGP F+  +  Y +FW  +PHF+ S FYVYAYAFG+ LVN
Sbjct: 489 DGELTPDDINALWMSVQAESLGPVFEYME-GYETFWAYIPHFVHSPFYVYAYAFGDGLVN 547

Query: 563 SLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
           +LY +Y+  T   F+EKY ++L+AG SKH+ ELL P  ++ SDP FW++GL  +  MID+
Sbjct: 548 ALYAVYEEGT-PGFQEKYFDMLKAGGSKHHKELLAPFGLDASDPAFWDKGLSMISGMIDE 606

Query: 623 VEKM 626
           +E M
Sbjct: 607 LEAM 610


>gi|254452846|ref|ZP_05066283.1| oligoendopeptidase F [Octadecabacter antarcticus 238]
 gi|198267252|gb|EDY91522.1| oligoendopeptidase F [Octadecabacter antarcticus 238]
          Length = 611

 Score =  557 bits (1436), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 274/594 (46%), Positives = 387/594 (65%), Gaps = 8/594 (1%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
            G+LP W+L DLYPS D++E+  DM+ +E+   +F    EG LA      +   L  A+ 
Sbjct: 24  FGDLPEWDLTDLYPSPDAKELKRDMDWLENACRSFAADHEGKLA----DLDAEELLDAVK 79

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
            +E+I  + GRI S+A L Y  + + P   KF + +  K+  +   L+F+ LE N +D+A
Sbjct: 80  RFEQIDIIAGRIMSFAGLRYYQHTTDPERGKFMSVMQDKITTYTTPLVFYGLEFNRMDDA 139

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
            ++   A +    +Y      +R +K H LS++ME  L D S VG  A  + F E I +L
Sbjct: 140 HVDGLLAANADLARYKPIFDRMRAMKPHQLSDEMEKFLHDQSVVGATAWNKLFHETIAAL 199

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           +F ++ +++ +        D DR  R+  ++ L+  F  +  +F+ + NTLAK++EI+DR
Sbjct: 200 KFTVDGKEMNIEGTLNLLSDQDRATREKGSRELARVFGANVGLFARVHNTLAKEKEIEDR 259

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR        RHL+N+VEP V+EAL  +V + YP+ SHRYY LK KW+ L+TM  WDR A
Sbjct: 260 WRGMPSPQAGRHLANHVEPEVVEALRNAVVDAYPRLSHRYYALKAKWMGLETMEVWDRNA 319

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP  S   + +  A   V+ +YA F P+M+ IA+ FFT  WIDA   DGK  GAFAH T
Sbjct: 320 PLPMESNRTVSWAEAEKTVMDAYAAFDPRMADIAKPFFTDGWIDAGVKDGKAPGAFAHPT 379

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           + +VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG L +++ LTLAETAS+FGE 
Sbjct: 380 VTTVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGELLSSTPLTLAETASVFGEM 438

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF  LL+ A ++EERK+LLA K+EDM+N++VRQI+FYDFE KLH + RS G++    IN
Sbjct: 439 LTFRKLLEQAITQEERKVLLAGKVEDMINTVVRQIAFYDFECKLH-DARSNGELTPDDIN 497

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
            +W+  Q ESLGP F+  D  Y +FW  +PHF+ S FYVYAYAFG+ LVN+LY +Y+   
Sbjct: 498 ALWMSVQGESLGPVFNFID-GYETFWAYIPHFVHSPFYVYAYAFGDGLVNALYAVYEDMG 556

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            D FK+KY ++L+AG SKH+SELL P  ++ SDP FW +GL  +E MID++E M
Sbjct: 557 ED-FKDKYFDMLKAGGSKHHSELLAPFGLDASDPAFWAKGLGMIESMIDELEAM 609


>gi|110679110|ref|YP_682117.1| oligoendopeptidase F, putative [Roseobacter denitrificans OCh 114]
 gi|109455226|gb|ABG31431.1| oligoendopeptidase F, putative [Roseobacter denitrificans OCh 114]
          Length = 606

 Score =  557 bits (1435), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 278/613 (45%), Positives = 382/613 (62%), Gaps = 9/613 (1%)

Query: 14  FFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEG 73
            F+      D     + + LG+LP WNL+DLY   D+ E+  D++ +E    +F T +EG
Sbjct: 1   MFQLPFPVRDANASGAADPLGDLPEWNLDDLYTGEDAPELKRDLDWLEQACASFATDYEG 60

Query: 74  NLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA 133
           NL       +       +   E+I ++ GRI SYA L Y    +     KF +D+  K+ 
Sbjct: 61  NL----ETLDAAGFLECVLRNEKISQIAGRIMSYAGLRYYQLTTDAGRAKFMSDLQEKIT 116

Query: 134 DFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDT 193
           +F   L+FF LEIN L +  L+  YA +    +Y      IR +K + LS+++E  L D 
Sbjct: 117 NFTTPLVFFTLEINRLADDHLDGLYAHNGDLARYKPIFDRIRAMKPYQLSDELEKFLHDL 176

Query: 194 SQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSS 253
             VG +A +R F E I  L F ++ + + +  A     D DR  R++AA+ L+  F  + 
Sbjct: 177 GVVG-DAWERLFDETIAGLEFDVDGETLNIEGALNLLTDPDRTKREAAARELADVFGANV 235

Query: 254 HIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY 313
             F+ + NT AK++EI DRWR  E     RHLSN VEP V+EAL  +V   YPK SHRYY
Sbjct: 236 KTFARVHNTQAKEKEIADRWRGMESPQQGRHLSNQVEPEVVEALRNAVVKSYPKLSHRYY 295

Query: 314 ELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHN 373
           ELK+KWL LD M  WDR APLP     I+ ++ A+D+V+++Y  F P+M  IA  FF+  
Sbjct: 296 ELKRKWLGLDKMQVWDRNAPLPLEDNRIVGWDQAQDMVMEAYTAFDPRMGEIAAPFFSKG 355

Query: 374 WIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGI 433
           WIDA    GK  GAFAH T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG 
Sbjct: 356 WIDAGVKPGKAPGAFAHPTVTDVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGE 414

Query: 434 LTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFE 493
           + +++ LTLAETAS+FGE LTF  +L  A    ERK+LLA K+EDM+N++VRQI+FYDFE
Sbjct: 415 MLSSTPLTLAETASVFGEMLTFRKMLDGAKDNAERKVLLAGKVEDMINTVVRQIAFYDFE 474

Query: 494 LKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYA 553
            KLH  RR  G++    IN +W+  Q ESLGPAF+  D  Y +FW  +PHF+ S FYVYA
Sbjct: 475 CKLHDARRG-GELTPDDINALWMSVQAESLGPAFEFMD-GYETFWAYIPHFVHSPFYVYA 532

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YAFG+ LVN+LY +Y   T + F+EKY ++L+AG SKH+ ELL P  ++ SDP FW++GL
Sbjct: 533 YAFGDGLVNALYSVYAEGT-EGFEEKYFDMLKAGGSKHHKELLAPFGLDASDPAFWDKGL 591

Query: 614 QTVEKMIDDVEKM 626
             +   ID++E M
Sbjct: 592 SMISGFIDELEAM 604


>gi|83308660|emb|CAJ01568.1| oligoendopeptidase F [uncultured bacterium]
          Length = 633

 Score =  556 bits (1434), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 279/614 (45%), Positives = 381/614 (62%), Gaps = 9/614 (1%)

Query: 13  AFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWE 72
             FRKA  S+     D   +LG LP+WNL DLYPS DS    +D+     E   F   ++
Sbjct: 25  GIFRKAQTSAKPRQTD---DLGALPQWNLADLYPSMDSPAFESDLAKAAAECKGFDAAYK 81

Query: 73  GNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKL 132
           G L       +   L  AI  YE + EL+G I +YA L Y  + + P   KFY D   K+
Sbjct: 82  GKLEALAKNASGAGLLEAIQRYEAVEELLGHIMAYAGLVYAEDTTDPARMKFYGDAQEKV 141

Query: 133 ADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSD 192
            D    ++FF LE+N LD+AL  +  A   L   Y  W+++IRK K + L + +E L  +
Sbjct: 142 TDASSDILFFELELNRLDDALAAKVAAG--LLKHYKPWLEDIRKGKPYQLEDKLEKLFHE 199

Query: 193 TSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKS 252
            S  G  A  R F E I  +RF ++ +++ +        D D + R+ AA A      ++
Sbjct: 200 KSITGYGAWNRLFDETIAGMRFNVDGKQLAIEPVLNLMQDPDEKTREKAAIAFGAGLKEN 259

Query: 253 SHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRY 312
              F+ ITNTL+KD+EI DRWR +  +AD+RHL+N VE  V++AL+ +V+  YP+ SHRY
Sbjct: 260 LRTFALITNTLSKDKEISDRWRGFSDVADARHLANRVEREVVDALVAAVRAAYPRLSHRY 319

Query: 313 YELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTH 372
           Y LK KW     +  WDR APLP       P++ ARD+VL +Y  FSP+M+ IA++FF  
Sbjct: 320 YRLKAKWFGKPALKHWDRNAPLPQVPAKTYPWDDARDIVLDAYDAFSPKMADIAKRFFDE 379

Query: 373 NWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQG 432
            WIDAP   GK  GAFAH T+PS HPY+L+NY GKP+DVMTLAHELGHG+H VL+    G
Sbjct: 380 RWIDAPVRPGKQPGAFAHPTVPSAHPYVLMNYQGKPRDVMTLAHELGHGVHQVLAG-PNG 438

Query: 433 ILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDF 492
            L   + LTLAETAS+FGE LTF +LL   +S  +R+ +LA K+EDMLN++VRQI+FY F
Sbjct: 439 ALMAPTPLTLAETASVFGEMLTFRALLLRTTSAAKRRAMLAAKVEDMLNTVVRQIAFYSF 498

Query: 493 ELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVY 552
           E KLH ERR+ G++   +I  +W+  Q ESLGP  +L    Y S+W  +PHF+ S FYVY
Sbjct: 499 ERKLHIERRN-GELTAAQICGLWMSEQAESLGPGIELG-TGYESYWAYIPHFVHSPFYVY 556

Query: 553 AYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERG 612
           AYAFG+CLVNSLY +Y+    + F E+YL +L AG +KH+SELL P  ++  DP+FW+ G
Sbjct: 557 AYAFGDCLVNSLYGVYQ-GAREGFAERYLAMLSAGGTKHHSELLAPFGLDARDPSFWQIG 615

Query: 613 LQTVEKMIDDVEKM 626
           L+ +E MI D+E +
Sbjct: 616 LKMIEGMIADLESL 629


>gi|163747414|ref|ZP_02154766.1| oligoendopeptidase F, putative [Oceanibulbus indolifex HEL-45]
 gi|161379267|gb|EDQ03684.1| oligoendopeptidase F, putative [Oceanibulbus indolifex HEL-45]
          Length = 605

 Score =  552 bits (1422), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 272/604 (45%), Positives = 382/604 (63%), Gaps = 9/604 (1%)

Query: 23  DMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           D       ++LGNLP W+L DLY S D+ E+  D++ +E    +F   +EG LA    + 
Sbjct: 10  DANASAGGKDLGNLPEWDLSDLYTSEDAAELKRDLDWLEEACASFAADYEGKLA----EL 65

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
           +   L   +   E+I ++ GRI SYA L Y    +     KF +D+  K+ D+   L+FF
Sbjct: 66  DAKGLLDCVLRNEKINQVAGRIMSYAGLRYYQQTTDSGRAKFMSDMQEKITDYTTPLVFF 125

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
            LE+N L +  L     QDP   +Y      IR +K + LS++ME  L D   VG +A +
Sbjct: 126 TLELNKLPDDHLADLLNQDPDLARYKPVFDRIRAMKPYQLSDEMEKFLHDLGVVG-DAWE 184

Query: 203 RFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNT 262
           R F E I  L F+++ + + +        D DR  R++ A+ L+     +   F+ + NT
Sbjct: 185 RMFDETIAGLEFEVDGETLTIEGTLNLLTDPDRAKREAGARELAEVLGANIRTFARVHNT 244

Query: 263 LAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKL 322
             K++E+ DRWR  E     RHLSN+VEP V+EAL  +V N YPK SHRYYELK+KWL L
Sbjct: 245 QVKEKEVMDRWRGMETPQTGRHLSNHVEPEVVEALRNAVVNAYPKLSHRYYELKRKWLGL 304

Query: 323 DTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDG 382
           D M  WDR APLP     ++ +  A + V+++Y  F P+M  +A+ FFT  WIDA    G
Sbjct: 305 DVMQVWDRNAPLPMEDPKVVNWAQAEETVMEAYTAFDPRMGELAKPFFTDGWIDAGVKPG 364

Query: 383 KGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTL 442
           K  GAFAH T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H VL+++ QG + +++ LTL
Sbjct: 365 KAPGAFAHPTVTNVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAD-QGEMLSSTPLTL 423

Query: 443 AETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRS 502
           AETAS+FGE LTF  +L  A ++ ERK+LLA K+EDM+N++VRQI+FYDFE KLH  RR 
Sbjct: 424 AETASVFGEMLTFRKMLDKAKTQAERKVLLAGKVEDMINTVVRQIAFYDFECKLHEARRG 483

Query: 503 TGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVN 562
            G++    IN +W+  Q ESLGPAF+  D  Y +FW  +PHF+ S FYVYAYAFG+ LVN
Sbjct: 484 -GELTPDDINALWMSVQAESLGPAFEYMD-GYETFWAYIPHFVHSPFYVYAYAFGDGLVN 541

Query: 563 SLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
           +LY +Y +   + F++KY ++L+AG SKH+ ELL P  ++ SDP FW++GL  +  MID+
Sbjct: 542 ALYAVYAAGE-EGFEDKYFDMLKAGGSKHHRELLAPFGLDASDPAFWDKGLSMISDMIDE 600

Query: 623 VEKM 626
           +E M
Sbjct: 601 LEAM 604


>gi|254477078|ref|ZP_05090464.1| oligoendopeptidase F [Ruegeria sp. R11]
 gi|214031321|gb|EEB72156.1| oligoendopeptidase F [Ruegeria sp. R11]
          Length = 614

 Score =  551 bits (1420), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 275/596 (46%), Positives = 385/596 (64%), Gaps = 9/596 (1%)

Query: 31  ENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAA 90
           + LGNLP W+L DLY S D+ E+  D+  +E E  AF   +EG LA    + +   L + 
Sbjct: 26  DGLGNLPEWDLSDLYTSEDAAELVRDLAWLEKECAAFAADYEGKLA----ELDADGLLSC 81

Query: 91  IAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLD 150
           +   E+I  + GRI S+A L Y    +     KF +D+  K+  F   L+FF LEIN ++
Sbjct: 82  VLRNEKINAIAGRIMSFAGLRYYQLTTDAGRAKFMSDMQEKITIFTTPLVFFTLEINRIE 141

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIE 210
           +  LE  +A +    +Y      IR +K + LS+++E  L D   VG +A +R F E I 
Sbjct: 142 DNQLEAHFAANSDLARYKPVFDRIRAMKPYQLSDELEKFLHDLGVVG-DAWERLFDETIA 200

Query: 211 SLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
            L F ++ +++ +        + DR  R++AA+ L+H F  +  IF+ + NT AK++EI 
Sbjct: 201 GLSFTVDGEELNIEGTLNLLTEQDRSKREAAARELAHVFADNIKIFARVHNTQAKEKEIL 260

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
           DRWR        RHLSN+VEP V+EAL ++V   YPK SHRYYELK+KWL LD M  WDR
Sbjct: 261 DRWRGMPSPQMGRHLSNHVEPEVVEALREAVVAAYPKLSHRYYELKRKWLGLDRMQVWDR 320

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
            APLP  +  ++ +  ARD+V+++Y  F P+M  IA+ FF   WIDA    GK  GAFAH
Sbjct: 321 NAPLPMETSRVVNWTEARDIVMEAYNAFDPRMGEIADPFFNKGWIDAGVKPGKAPGAFAH 380

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
            T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL++E QG + +++ LTLAETAS+FG
Sbjct: 381 PTVTDVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAE-QGEMLSSTPLTLAETASVFG 439

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E LTF  +L+ A  + ERKILLA K+EDM+N++VRQI+FYDFE KLH   R+ G++    
Sbjct: 440 EMLTFRKMLEKAKDQNERKILLAGKVEDMINTVVRQIAFYDFECKLHAA-RAEGELTPDD 498

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
           IN +W+  Q ESLG AFD  +  Y +FW  +PHF+ S FYVYAYAFG+ LVN+LY +Y +
Sbjct: 499 INALWMSVQAESLGEAFDFME-GYETFWAYIPHFVHSPFYVYAYAFGDGLVNALYSVY-A 556

Query: 571 NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              + F++KY ++L+AG SKH+ ELL P  ++ SDP FW++GL  +  MID++E M
Sbjct: 557 EGAEGFEDKYFDMLKAGGSKHHKELLAPFGLDASDPTFWDKGLSMISDMIDELEAM 612


>gi|255262015|ref|ZP_05341357.1| oligoendopeptidase, PepF/M3 family [Thalassiobium sp. R2A62]
 gi|255104350|gb|EET47024.1| oligoendopeptidase, PepF/M3 family [Thalassiobium sp. R2A62]
          Length = 603

 Score =  550 bits (1416), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 274/607 (45%), Positives = 383/607 (63%), Gaps = 8/607 (1%)

Query: 20  RSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHAT 79
           R+ D+   +  +NLGNLP W+L  LYPS DS E++ D+  +E     F + +EG LA   
Sbjct: 3   RTFDINASNGTDNLGNLPEWDLTHLYPSQDSPELTRDLGWLEEACTNFASDYEGKLA--- 59

Query: 80  NQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVL 139
              +   L   +  YE+I  + GRI SYA L Y    +     KF  D+  K+  F   L
Sbjct: 60  -DLDAAGLLDCVLRYEKIDIIAGRIMSYAGLRYYQITTDDDRAKFMADMQDKITTFTTPL 118

Query: 140 IFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGRE 199
           +F+ LE+N L++A L     ++    +Y      +R  K + LS+++E  L D S VG  
Sbjct: 119 VFYTLELNRLEDASLAAMLTENANLARYKPVFDRLRASKPYQLSDELEKFLHDQSTVGAS 178

Query: 200 ALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFI 259
           A  R F E I  L F +N  ++ +        +  R++R++AA+ L+  F  +  +F+ +
Sbjct: 179 AWNRLFDETIAGLTFFVNGDELNIEGTLNLLTEQSRDMREAAARELASVFEDNVKLFARV 238

Query: 260 TNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKW 319
            NTLAK++EI+DRWR        RHLSN+VEP V+EAL  +V   YPK SHRYY LK KW
Sbjct: 239 HNTLAKEKEIEDRWRGMPTPQTGRHLSNHVEPEVVEALRNAVVAAYPKLSHRYYALKAKW 298

Query: 320 LKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQ 379
           L LDTM  WDR APLP     I+ ++ A   V+ +YA+F P+M+ IA+ FF   WIDA  
Sbjct: 299 LGLDTMQVWDRNAPLPMEDSKIVDWDQAEKTVMDAYAEFDPRMAEIAKPFFKDGWIDAAV 358

Query: 380 YDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSS 439
             GK  GAFAH T+   HPY++LNYLGKP+DVMTLAHELGHG+H VL+++ QG L +++ 
Sbjct: 359 KPGKAPGAFAHPTVTEAHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAD-QGELLSSTP 417

Query: 440 LTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTE 499
           LTLAETAS+FGE LTF  +L  A ++ ERK++LA K+EDM+N++VRQI+FYDFE KLH  
Sbjct: 418 LTLAETASVFGEMLTFRKMLSGAKTQAERKVMLAGKVEDMINTVVRQIAFYDFECKLHAA 477

Query: 500 RRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNC 559
            R+ G++    IN +W+  Q ESLGP F+     Y +FW  VPHF+ S FYVYAYAFG+ 
Sbjct: 478 -RANGELTPDDINALWMSVQAESLGPVFEFMP-GYKTFWAYVPHFVHSPFYVYAYAFGDG 535

Query: 560 LVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKM 619
           LVN+LY +++ +  D F++KY ++LRAG SKH+ ELL P  ++ SDP FW++GL  +  M
Sbjct: 536 LVNALYAVFEEDG-DDFQDKYFDMLRAGGSKHHKELLAPFGLDASDPKFWDKGLSLIASM 594

Query: 620 IDDVEKM 626
           ID++E M
Sbjct: 595 IDELEAM 601


>gi|149916585|ref|ZP_01905099.1| hypothetical protein RAZWK3B_08211 [Roseobacter sp. AzwK-3b]
 gi|149809512|gb|EDM69372.1| hypothetical protein RAZWK3B_08211 [Roseobacter sp. AzwK-3b]
          Length = 606

 Score =  549 bits (1415), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 275/615 (44%), Positives = 386/615 (62%), Gaps = 13/615 (2%)

Query: 14  FFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEG 73
            F   L + D       +NLG LP W+L DLY S D+  +  D++ +E     F   +EG
Sbjct: 1   MFHLPLPAHDANAGSGDKNLGRLPEWDLTDLYESPDAPALKRDLDWLEKACADFAADYEG 60

Query: 74  NLAH--ATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAK 131
            LA   A    +C      +   E+I  + GRI S+A+L Y    +     KF +D   K
Sbjct: 61  KLADLDAAGMLDC------LKRDEKISNIAGRIMSFAVLRYQQQTTDGDRAKFLSDCQEK 114

Query: 132 LADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLS 191
           +  +   L+FF LE+N L+E  L   Y       +Y   +  IR +K + LS+++E  L 
Sbjct: 115 VTTYTTPLVFFTLELNRLEEDALNALYDASAELARYKPVLDRIRAMKPYQLSDELEKFLH 174

Query: 192 DTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNK 251
           D   VG +A +R F E I  L F ++ +++ +        D DR  R++AA+ L+  F  
Sbjct: 175 DMGVVG-DAWERLFDETISGLSFIVDGEELGIESTLNLLTDQDRSQREAAARELARVFGA 233

Query: 252 SSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHR 311
           +   F+ + NT AK++E+ DRWR       SRHLSN+VEP V+EAL  +V N YPK SHR
Sbjct: 234 NIRTFARVHNTSAKEKEVIDRWRGMPTPQTSRHLSNDVEPEVVEALRNAVVNAYPKLSHR 293

Query: 312 YYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFT 371
           YYELK+KWL LD M  WDR APLP   + I+ +  ARD+V+++Y+ F P+M  +AE FF+
Sbjct: 294 YYELKRKWLGLDVMQVWDRNAPLPIEDKKIMDWTSARDIVMEAYSAFDPRMGELAEPFFS 353

Query: 372 HNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQ 431
             WIDA    GK  GAFAH T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  Q
Sbjct: 354 KGWIDAGVKPGKAPGAFAHPTVTDVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQ 412

Query: 432 GILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYD 491
           G L  N+ LTLAETAS+FGE LTF  +L+ A++  ERK+LLA K+EDM+N+++RQI+FYD
Sbjct: 413 GELLANTPLTLAETASVFGEMLTFRKMLEKAATDTERKVLLAGKVEDMINTVMRQIAFYD 472

Query: 492 FELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYV 551
           FE KLH  RR  G++  + IN +W+  Q ESLGPAF+  D  Y +FW  +PHF+ S FYV
Sbjct: 473 FECKLHDARRG-GELTPNDINALWMSVQAESLGPAFEFMD-GYETFWAYIPHFVHSPFYV 530

Query: 552 YAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWER 611
           YAYAFG+ LVN+LY +Y+ +  + F++KY  +L+AG SKH+  LL P  ++ SDP FW++
Sbjct: 531 YAYAFGDGLVNALYAVYEESP-EGFEDKYFEMLKAGGSKHHKALLEPFGLDASDPAFWDK 589

Query: 612 GLQTVEKMIDDVEKM 626
           GL  + ++ID++E M
Sbjct: 590 GLSMISRLIDELEAM 604


>gi|332557845|ref|ZP_08412167.1| oligoendopeptidase F [Rhodobacter sphaeroides WS8N]
 gi|332275557|gb|EGJ20872.1| oligoendopeptidase F [Rhodobacter sphaeroides WS8N]
          Length = 606

 Score =  549 bits (1415), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 276/598 (46%), Positives = 374/598 (62%), Gaps = 8/598 (1%)

Query: 29  SQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG 88
           S   LGNLP W+L DLYP+ D  E  +DM  ++     F   +EG LA      +   L 
Sbjct: 15  SAGGLGNLPDWDLRDLYPTPDGPEFRDDMAWLKEACAGFAASYEGKLA----SLDAAGLL 70

Query: 89  AAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINT 148
           A I  YE+I  + GR+ SYA L Y  N       KF  D   K+ D+   L+FF+LE N 
Sbjct: 71  ACIEAYEKIDIVAGRLMSYAGLRYYQNTMDSERAKFMADAQDKVTDYTTALVFFSLEFNR 130

Query: 149 LDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCEN 208
           L++A LE    +     +Y      +R ++ H LS+++E  L D S VG  A  R F E 
Sbjct: 131 LEDAHLEARLTESAALARYKPVFDRMRAMRPHQLSDELERFLHDESTVGAAAWNRLFDET 190

Query: 209 IESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEE 268
           +  L F +  +++ L        D +R  R++AA AL+  F ++  +F+ + NTLAK++E
Sbjct: 191 MAGLTFTLEGEELNLESTLNLLTDPERPRREAAAHALAEVFGRNIKLFARVHNTLAKEKE 250

Query: 269 IQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFW 328
           I DRWRK       RHL+N+VEP V+EAL  +V   YPK SHRYY LK KWL L+ +  W
Sbjct: 251 IHDRWRKMPTPQYGRHLANHVEPEVVEALRNAVVAAYPKLSHRYYRLKAKWLGLEKLQVW 310

Query: 329 DRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAF 388
           DR APLP  +  ++ ++ A+  V+++Y+ F P+M+ IA+ FF   WIDA    GK  GAF
Sbjct: 311 DRNAPLPTETPRLVGWDEAQSTVMEAYSAFDPRMAEIAKPFFEKGWIDAGVKPGKAPGAF 370

Query: 389 AHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASI 448
           AH T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG L +++ LTLAETAS+
Sbjct: 371 AHPTVTTVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGELLSSTPLTLAETASV 429

Query: 449 FGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPT 508
           FGE LTF  LL AA +  ERK LLA K+EDM+N++VRQI+FYDFE KLH  RR  G++  
Sbjct: 430 FGEMLTFRKLLDAARTPAERKTLLAGKVEDMINTVVRQIAFYDFECKLHEARRQ-GELTP 488

Query: 509 HRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIY 568
             IN +W+  Q ESLG AF+  +  Y +FW  VPHF+ S FYVYAYAFG+ LVN+LY +Y
Sbjct: 489 EDINALWMSVQAESLGDAFEFME-GYETFWSYVPHFVHSPFYVYAYAFGDGLVNALYAVY 547

Query: 569 KSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              T   F+EKY  +L AG SKH+ ELL P  ++ SDP FW++GL  +   ID++E M
Sbjct: 548 AEGT-PGFQEKYFEMLSAGGSKHHKELLAPFGLDASDPTFWDKGLSMIAGFIDELEAM 604


>gi|56696297|ref|YP_166654.1| oligoendopeptidase F [Ruegeria pomeroyi DSS-3]
 gi|56678034|gb|AAV94700.1| oligoendopeptidase F [Ruegeria pomeroyi DSS-3]
          Length = 606

 Score =  549 bits (1415), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 272/604 (45%), Positives = 383/604 (63%), Gaps = 9/604 (1%)

Query: 23  DMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           D       + LGNLP W+L DLY   D+ E+++D++ +E E  AF   +EG LA      
Sbjct: 10  DANAGSGSKELGNLPEWDLSDLYSGEDAPELAHDLDWLETECAAFAADYEGKLAELDAAA 69

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
                   +   E+I  + GRI S+A L Y          KF +D   K+ +F   L+FF
Sbjct: 70  LL----TCVQRNEKISAIAGRIMSFAGLRYYQLTIDAGRAKFMSDCQEKITNFTTPLVFF 125

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
            LE+N +++  L   +A++    +Y+   + IR +K + LS+++E  L D   VG +A +
Sbjct: 126 TLELNRIEDDALTARFAENADLARYAPVFRRIRAMKPYQLSDELEKFLHDLGVVG-DAWE 184

Query: 203 RFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNT 262
           R F E I  L F I+ +++ +        + DR  R++AA  L+  F ++   F+ + NT
Sbjct: 185 RLFDETIAGLTFDIDGEELNIEGTLNLLTEQDRSKREAAAHELARVFGENIKTFARVHNT 244

Query: 263 LAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKL 322
            AK++E+ DRWRK       RHLSN+VEP V+EAL ++V   YPK SHRYYELK+KWL L
Sbjct: 245 AAKEKEVIDRWRKMPSAQTGRHLSNDVEPEVVEALREAVVAAYPKLSHRYYELKRKWLGL 304

Query: 323 DTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDG 382
           D M  WDR APLP      IP+  A  +V+++Y  F P+M  IA  FF+  WIDA    G
Sbjct: 305 DRMQVWDRNAPLPMEDTRTIPWAQAERMVMEAYEAFDPRMGEIAAPFFSKGWIDAAVKPG 364

Query: 383 KGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTL 442
           K  GAFAH T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG + +++ LTL
Sbjct: 365 KAPGAFAHPTVTEVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGEMLSSTPLTL 423

Query: 443 AETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRS 502
           AETAS+FGE LTF  +L+ A ++E+RK+LLA K+EDM+N++VRQI+FYDFE KLH  RR 
Sbjct: 424 AETASVFGEMLTFRKMLEKAETQEQRKVLLAGKVEDMINTVVRQIAFYDFECKLHAARRQ 483

Query: 503 TGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVN 562
            G++    I ++W+  Q ESLGPAFD  +  Y SFW  +PHF+ S FYVYAYAFG+ LVN
Sbjct: 484 -GELTPENIGDLWMSVQGESLGPAFDFME-GYESFWAYIPHFVHSPFYVYAYAFGDGLVN 541

Query: 563 SLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
           +LY +Y +   + F+EKY ++L+AG SKH+ ELL P  ++ SDP FW++GL  +  MID+
Sbjct: 542 ALYSVY-AEGAEGFEEKYFDMLKAGGSKHHKELLAPFGLDASDPKFWDKGLSMISDMIDE 600

Query: 623 VEKM 626
           +E M
Sbjct: 601 LEAM 604


>gi|149202310|ref|ZP_01879283.1| Peptidase M3B, oligoendopeptidase-related clade 3 [Roseovarius sp.
           TM1035]
 gi|149144408|gb|EDM32439.1| Peptidase M3B, oligoendopeptidase-related clade 3 [Roseovarius sp.
           TM1035]
          Length = 631

 Score =  548 bits (1412), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 276/604 (45%), Positives = 379/604 (62%), Gaps = 9/604 (1%)

Query: 23  DMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           D        NLG LP W+L DLY S  + E+  D++ +      F T +EG LA      
Sbjct: 35  DANASSGNRNLGQLPEWDLSDLYTSEKAPELKRDLDWLHSACAEFATDYEGKLA----TL 90

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
           +   L   I   E I    GRI SYA L Y    +     KF +D   K+ +    L+FF
Sbjct: 91  DAAGLLECIRRDEAISTTAGRIMSYAGLRYYQLTTDGGRAKFMSDCQEKVTNSTTPLVFF 150

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
           +LE+N LDE  L   YA++    +Y   +  IR +K + LS+++E  L D   VG +A +
Sbjct: 151 SLELNRLDEGALTAMYAENADLARYKPVLDRIRAMKPYQLSDELEKFLHDLGVVG-DAWE 209

Query: 203 RFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNT 262
           R F E I  L F ++   + +        + DR  R+SAA+ L+  F ++   F+ + NT
Sbjct: 210 RLFDETIAGLTFTVDGDDLTIEGTLNLLTEQDRSKRESAARELARVFGENIRTFARVHNT 269

Query: 263 LAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKL 322
            AK++E+ DRWRK       RHLSN+VEP V+EAL  +V   YPK SHRYYELK+KWL L
Sbjct: 270 QAKEKEVIDRWRKMPTAQTGRHLSNDVEPEVVEALRNAVVAAYPKLSHRYYELKRKWLGL 329

Query: 323 DTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDG 382
           + M  WDR APLP  +  ++ ++ ARD V+ +YA F P+M+ +A+ FF   WIDA    G
Sbjct: 330 ERMQVWDRNAPLPMEATRLVDWDEARDTVMGAYAAFDPRMADLAQPFFERGWIDAGVKPG 389

Query: 383 KGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTL 442
           K  GAFAH T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H  L+++ QG L +++ LTL
Sbjct: 390 KAPGAFAHPTVTTVHPYVMLNYLGKPRDVMTLAHELGHGVHQRLAAD-QGELLSSTPLTL 448

Query: 443 AETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRS 502
           AETAS+FGE LTF  +L  A ++ ERK+LLA K+EDM+N++VRQI+FYDFE KLH  RR 
Sbjct: 449 AETASVFGEMLTFRRMLAGAQTQAERKVLLAGKVEDMINTVVRQIAFYDFECKLHAARRE 508

Query: 503 TGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVN 562
            G++    IN +W+  Q +SLG AFD  D  Y +FW  +PHFI S FYVYAYAFG+ LVN
Sbjct: 509 -GELTPDDINALWMSVQAQSLGEAFDFMD-GYETFWAYIPHFIHSPFYVYAYAFGDGLVN 566

Query: 563 SLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
           +LY +Y+ N  D F++KY ++L+AG SKH+ ELL P  ++ SDP FW++GL  +  MID+
Sbjct: 567 ALYAVYEENP-DGFQDKYFDLLKAGGSKHHKELLAPFGLDASDPAFWDKGLSMISGMIDE 625

Query: 623 VEKM 626
           +E M
Sbjct: 626 LEAM 629


>gi|254486948|ref|ZP_05100153.1| oligoendopeptidase F [Roseobacter sp. GAI101]
 gi|214043817|gb|EEB84455.1| oligoendopeptidase F [Roseobacter sp. GAI101]
          Length = 610

 Score =  548 bits (1412), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 274/596 (45%), Positives = 384/596 (64%), Gaps = 13/596 (2%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAH--ATNQKNCHSLGAA 90
           LGNLP WNL+DLY   D+ E+  D++ +E    +F T +EGNLA+  A    +C      
Sbjct: 24  LGNLPEWNLDDLYTGEDATELKRDLDWLEEACRSFATDFEGNLANLDAAGFLDC------ 77

Query: 91  IAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLD 150
           +   E+I ++ GRI S+A L Y    +     KF +D+  K+ +F   L+FF LE+N L+
Sbjct: 78  VLRNEKINQVAGRIMSFAGLRYYQQTTDAGRTKFMSDVQEKITNFTTPLVFFTLELNRLE 137

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIE 210
           +  L +   Q+    +Y      IR +K + LS+++E  L D   VG +A +R F E I 
Sbjct: 138 DDHLGKLLVQNADLARYKPVFDRIRAMKDYQLSDELEKFLHDLGVVG-DAWERLFDETIA 196

Query: 211 SLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
           +L F ++ +++ +        D +R++R+SAA+ L+  F  +   F+ + NT AK++E+ 
Sbjct: 197 ALEFVVDGEQLNIEGVLNLLTDPNRDLRESAARELADVFRSNIKTFARVHNTQAKEKEVI 256

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
           DRWR        RHLSN+VEP V+EAL  +V N YPK SHRYYELK+KWL LD M  WDR
Sbjct: 257 DRWRGMPTPQTGRHLSNHVEPEVVEALRNAVVNAYPKLSHRYYELKRKWLGLDVMQVWDR 316

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
            APLP     +I ++ A  +V+ +Y  F P+M  IA+ FFT  WIDA    GK  GAFAH
Sbjct: 317 NAPLPMEDPKLIGWDRAEHMVMDAYNAFDPRMGEIAKPFFTDGWIDAGVKPGKAPGAFAH 376

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
            T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG + +++ LTLAETAS+FG
Sbjct: 377 PTVTNVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGEMLSSTPLTLAETASVFG 435

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E LTF  +L  A +  ERK+LLA K+EDM+N++VRQI+FYDFE KLH  RR  G++    
Sbjct: 436 EMLTFRKMLDNAKTNAERKVLLAGKVEDMINTVVRQIAFYDFECKLHDARRG-GELTPDD 494

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
           IN +W+  Q ESLGPAF+  D  Y +FW  +PHF+ S FYVYAYAFG+ LVN+LY +Y  
Sbjct: 495 INALWMSVQAESLGPAFEFMD-GYETFWAYIPHFVHSPFYVYAYAFGDGLVNALYAVYDE 553

Query: 571 NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            T   F++KY ++L+AG SKH+ ELL P  ++ SDP FW++GL  +   ID++E M
Sbjct: 554 GT-PGFEDKYFDMLKAGGSKHHKELLAPFGLDASDPAFWDKGLSMISGFIDELEAM 608


>gi|163738506|ref|ZP_02145921.1| Peptidase M3B, oligoendopeptidase-related clade 3 [Phaeobacter
           gallaeciensis BS107]
 gi|161388427|gb|EDQ12781.1| Peptidase M3B, oligoendopeptidase-related clade 3 [Phaeobacter
           gallaeciensis BS107]
          Length = 614

 Score =  548 bits (1412), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 274/596 (45%), Positives = 384/596 (64%), Gaps = 9/596 (1%)

Query: 31  ENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAA 90
           + LGNLP W+L DLY S ++ E+  D+  ++ E  +F   +EG LA      +   L   
Sbjct: 26  DGLGNLPEWDLSDLYTSENASELERDLAWLDGECASFAADYEGKLA----DLDADGLLTC 81

Query: 91  IAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLD 150
           +   E+I  + GRI S+A L Y    +     KF +D+  K+  F   L+FF LEIN L+
Sbjct: 82  VLRNEKINAIAGRIMSFAGLRYYQLTTDAGRAKFMSDMQEKITIFTTPLVFFTLEINRLE 141

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIE 210
           +A+LE  +A +    +Y      IR +K + LS+++E  L D   VG +A +R F E I 
Sbjct: 142 DAVLESHFAANSDLARYKPIFDRIRAMKPYQLSDELEKFLHDLGVVG-DAWERLFDETIA 200

Query: 211 SLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
            L F ++ +++ +        + DR  R++AA+ L+  F+ +  IF+ + NT AK++EI 
Sbjct: 201 GLTFTVDGEELNIEGTLNLLTEQDRSKREAAARELARVFSDNIKIFARVHNTQAKEKEIL 260

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
           DRWR        RHLSN+VEP V+EAL ++V + YPK SHRYYELK+KWL LD M  WDR
Sbjct: 261 DRWRGMPSPQMGRHLSNHVEPEVVEALREAVVSAYPKLSHRYYELKRKWLGLDRMQVWDR 320

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
            APLP  +   + ++ AR +V+ +Y+ F P+M  +AE FF   WIDA    GK  GAFAH
Sbjct: 321 NAPLPMETSRTVNWDEARKMVMDAYSAFDPRMGDLAEPFFDKGWIDAAVKPGKAPGAFAH 380

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
            T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL+++ QG + +++ LTLAETAS+FG
Sbjct: 381 PTVTDVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAD-QGEMLSSTPLTLAETASVFG 439

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E LTF  +L+ A  K ERKILLA K+EDM+N++VRQI+FYDFE KLH   R+ G++    
Sbjct: 440 EMLTFRKMLENAKDKTERKILLAGKVEDMINTVVRQIAFYDFECKLHAA-RAEGELTPDD 498

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
           IN +W+  Q ESLG AFD  D  Y +FW  VPHF+ S FYVYAYAFG+ LVN+LY +Y +
Sbjct: 499 INALWMSVQAESLGEAFDFMD-GYETFWTYVPHFVHSPFYVYAYAFGDGLVNALYSVY-A 556

Query: 571 NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              + F++KY  +L+AG SKH+ ELL P  ++ SDP FW++GL  +  MID++E M
Sbjct: 557 EGAEGFEDKYFEMLKAGGSKHHKELLAPFGLDASDPTFWDKGLSMISDMIDELEAM 612


>gi|126738727|ref|ZP_01754423.1| oligoendopeptidase F [Roseobacter sp. SK209-2-6]
 gi|126719908|gb|EBA16615.1| oligoendopeptidase F [Roseobacter sp. SK209-2-6]
          Length = 606

 Score =  548 bits (1411), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 275/606 (45%), Positives = 383/606 (63%), Gaps = 13/606 (2%)

Query: 23  DMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAH--ATN 80
           D       E LGNLP W+L DLY   D+ E+S D++ +E E  AF   +EG LA   A  
Sbjct: 10  DANAASGSEELGNLPEWDLSDLYKGEDAAELSRDLDWLEQECSAFAADYEGKLAGLDAAG 69

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
             +C      +   E+I  + GRI SYA L Y    +     KF +D+  K+  F   L+
Sbjct: 70  LLDC------VLRNEKINAIAGRIMSYAGLRYYQLTTDADRAKFMSDMQEKITIFTTPLV 123

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           FF LEIN +D+ +L   +A +    +Y      IR +K + LS+++E  L D   VG +A
Sbjct: 124 FFTLEINRIDDDVLAGHFAANADLARYQPIFDRIRAMKPYQLSDELEKFLHDLGVVG-DA 182

Query: 201 LKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFIT 260
            +R F E I  L+F I+ +++ +        + DR  R++A++ L+  F ++   F+ + 
Sbjct: 183 WERLFDETIAGLKFTIDGEELNIEGTLNFLTEQDRSKREAASRELARVFAENVKTFARVH 242

Query: 261 NTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWL 320
           NT AK++EI DRWR        RHLSN+VEP V+EAL ++V   YPK SHRYYELK+KWL
Sbjct: 243 NTQAKEKEIVDRWRGMPTPQTGRHLSNHVEPEVVEALREAVVAAYPKLSHRYYELKRKWL 302

Query: 321 KLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQY 380
            LD M  WDR APLP     ++ ++ A   V+++Y  F P+M  IA  FF+  WIDA   
Sbjct: 303 GLDRMQVWDRNAPLPMEDSRVVNWDEAEQTVMEAYNAFDPRMGEIAAPFFSDGWIDAGVK 362

Query: 381 DGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSL 440
            GK  GAFAH T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL++E QG + +++ L
Sbjct: 363 PGKAPGAFAHPTVTEVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAE-QGEMLSSTPL 421

Query: 441 TLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTER 500
           TLAETAS+FGE LTF  +L  A +KE+RK+LLA K+EDM+N++VRQI+FYDFE KLH   
Sbjct: 422 TLAETASVFGEMLTFRKMLDKAETKEQRKVLLAGKVEDMINTVVRQIAFYDFECKLHAA- 480

Query: 501 RSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCL 560
           R+ G++    IN +W+  Q ESLG AFD  +  Y +FW  +PHF+ S FYVYAYAFG+ L
Sbjct: 481 RAEGELTPDDINALWMSVQAESLGDAFDFME-GYETFWCYIPHFVHSPFYVYAYAFGDGL 539

Query: 561 VNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMI 620
           VN+LY +Y     + F++KY ++L+AG SKH+ ELL P  ++ SDP FW++GL  +  MI
Sbjct: 540 VNALYSVYAEGG-EGFEDKYFDMLKAGGSKHHKELLAPFGLDASDPKFWDKGLAMISGMI 598

Query: 621 DDVEKM 626
           D++E M
Sbjct: 599 DELEAM 604


>gi|163743584|ref|ZP_02150961.1| oligoendopeptidase F [Phaeobacter gallaeciensis 2.10]
 gi|161383169|gb|EDQ07561.1| oligoendopeptidase F [Phaeobacter gallaeciensis 2.10]
          Length = 614

 Score =  546 bits (1408), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 274/596 (45%), Positives = 383/596 (64%), Gaps = 9/596 (1%)

Query: 31  ENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAA 90
           + LGNLP W+L DLY S ++ E+  D+  ++ E  +F   +EG LA      +   L   
Sbjct: 26  DGLGNLPEWDLSDLYTSENASELERDLAWLDGECASFAADYEGKLA----DLDADGLLTC 81

Query: 91  IAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLD 150
           +   E+I  + GRI S+A L Y    +     KF +D+  K+  F   L+FF LEIN L+
Sbjct: 82  VLRNEKINAIAGRIMSFAGLRYYQLTTDAGRAKFMSDMQEKITIFTTPLVFFTLEINRLE 141

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIE 210
           +A+LE  +A +    +Y      IR +K + LS+++E  L D   VG +A +R F E I 
Sbjct: 142 DAVLESHFAANSDLARYKPIFDRIRAMKPYQLSDELEKFLHDLGVVG-DAWERLFDETIA 200

Query: 211 SLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
            L F ++ +++ +        + DR  R++AA+ L+  F+ +  IF+ + NT AK++EI 
Sbjct: 201 GLTFTVDGEELNIEGTLNLLTEQDRSKREAAARELARVFSDNIKIFARVHNTQAKEKEIL 260

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
           DRWR        RHLSN+VEP V+EAL ++V   YPK SHRYYELK+KWL LD M  WDR
Sbjct: 261 DRWRGMPSPQMGRHLSNHVEPEVVEALREAVVAAYPKLSHRYYELKRKWLGLDRMQVWDR 320

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
            APLP  +   + ++ AR +V+ +Y+ F P+M  +AE FF   WIDA    GK  GAFAH
Sbjct: 321 NAPLPMETSRTVNWDEARKMVMDAYSAFDPRMGDLAEPFFDKGWIDAAVKPGKAPGAFAH 380

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
            T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL+++ QG + +++ LTLAETAS+FG
Sbjct: 381 PTVTDVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAD-QGEMLSSTPLTLAETASVFG 439

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E LTF  +L+ A  K ERKILLA K+EDM+N++VRQI+FYDFE KLH   R+ G++    
Sbjct: 440 EMLTFRKMLENAKDKTERKILLAGKVEDMINTVVRQIAFYDFECKLHAA-RAEGELTPDD 498

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
           IN +W+  Q ESLG AFD  +  Y +FW  VPHF+ S FYVYAYAFG+ LVN+LY +Y +
Sbjct: 499 INALWMSVQAESLGEAFDFME-GYETFWTYVPHFVHSPFYVYAYAFGDGLVNALYSVY-A 556

Query: 571 NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              + FK+KY  +L+AG SKH+ ELL P  ++ SDP FW++GL  +  MID++E M
Sbjct: 557 EGAEGFKDKYFEMLKAGGSKHHKELLAPFGLDASDPTFWDKGLSMISDMIDELEAM 612


>gi|83593527|ref|YP_427279.1| peptidase M3B, oligoendopeptidase-related clade 3 [Rhodospirillum
           rubrum ATCC 11170]
 gi|83576441|gb|ABC22992.1| Peptidase M3B, oligoendopeptidase-related clade 3 [Rhodospirillum
           rubrum ATCC 11170]
          Length = 597

 Score =  546 bits (1408), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 267/604 (44%), Positives = 394/604 (65%), Gaps = 9/604 (1%)

Query: 24  MTTMDSQEN-LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           MT + +Q N +  LP W+L DLY   DS  +  D+   E  + AF+  + G +A      
Sbjct: 1   MTHVAAQANAVSPLPVWDLGDLYDGPDSAALKTDLAETESGAKAFRDTYAGKVAGL---- 56

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
           +  +LG AI  +ER+ E + RI SY+ L    +++   I +F+  +  K       ++FF
Sbjct: 57  DGAALGEAIVAFERLSETLYRILSYSQLLQAGDVTDVAIGQFHQAMMEKGTAISSQMLFF 116

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
            LEIN +D+  L +   ++PL  +Y+ WI+++R  +KH LS+DME LL++    G  A  
Sbjct: 117 TLEINLIDDDALAEKL-KNPLAGRYAPWIRDLRAFRKHQLSDDMERLLNEKDVAGSSAWM 175

Query: 203 RFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNT 262
           R F E +  LRF I+++ +  T+A+    D   E RK+AAKA+      +  +FS ITNT
Sbjct: 176 RLFDETVAHLRFPIDNETLTSTEAFDRLSDPQPERRKAAAKAIGGVLEDNLRLFSRITNT 235

Query: 263 LAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKL 322
           LAKD++I D WR Y     +R+L N VE  V++AL+ +V+  Y   SHRYY++K KW   
Sbjct: 236 LAKDKQIDDSWRGYAHPMAARNLGNQVEDAVVDALVSAVRGSYGDLSHRYYQMKAKWFGR 295

Query: 323 DTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDG 382
           DT+ +WDR APLP        ++ ARD VL +Y  FSP+++ + ++FF + WID P   G
Sbjct: 296 DTLDYWDRNAPLPEADDSRFTWDQARDTVLGAYGAFSPELAAVGKRFFDNPWIDVPARPG 355

Query: 383 KGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTL 442
           K SGAFAH T+PS HPY+LLN++G+ +DVMTLAHELGHG+H VL++  QG L +++ LTL
Sbjct: 356 KASGAFAHPTVPSAHPYLLLNFMGRTRDVMTLAHELGHGVHQVLAAR-QGPLLSDTPLTL 414

Query: 443 AETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRS 502
           AETAS+FGE LTF ++L +A   + R+I+LA+K+EDM+N++VRQI+F+ FE K+H+ER  
Sbjct: 415 AETASVFGEMLTFRAMLDSAGDAKRRRIMLASKVEDMINTVVRQIAFHTFEHKVHSERLQ 474

Query: 503 TGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVN 562
            G++   R+ EIW+E Q ESLGPAF   D EY ++W  +PHFI S FYVYAYAFG+CLVN
Sbjct: 475 -GELSPDRLCEIWMEVQTESLGPAFRF-DAEYRTYWTYIPHFIHSPFYVYAYAFGDCLVN 532

Query: 563 SLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
           SLY +Y+  +V  F+ KYL++L AG +  + ELL P  ++ S+P+FW+RGL  ++  ID+
Sbjct: 533 SLYAVYQEGSVPDFQAKYLDMLGAGGTLRHKELLAPFGLDASNPDFWKRGLGVLKGFIDE 592

Query: 623 VEKM 626
           +E++
Sbjct: 593 LEEV 596


>gi|84688082|ref|ZP_01015940.1| Oligoendopeptidase F [Maritimibacter alkaliphilus HTCC2654]
 gi|84663910|gb|EAQ10416.1| Oligoendopeptidase F [Rhodobacterales bacterium HTCC2654]
          Length = 614

 Score =  545 bits (1403), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 272/600 (45%), Positives = 382/600 (63%), Gaps = 9/600 (1%)

Query: 29  SQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG 88
           S ++LGNLP W+L DLY + D+ E++ D++ ++     F  R+EG LA    Q     + 
Sbjct: 20  SGKDLGNLPDWDLSDLYAAPDAPEVTRDLDRLKTLCADFAERYEGKLADLDAQ----GML 75

Query: 89  AAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINT 148
             +  +E I  + GR+ SYA L Y    +     +F  +   KL D+   L+FF+LEIN 
Sbjct: 76  TCVTAHEEIDRIAGRLMSYAGLRYYQVTTDGERAQFLQNCQEKLTDYTTPLVFFSLEINR 135

Query: 149 LDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCEN 208
           + +  L+  +  +    +Y      +R ++ + LS+++E  L D S VG  A  + F E 
Sbjct: 136 IPDDKLDALFEANADLARYKPIFDRLRAMRPYQLSDELEKFLHDQSAVGSAAWNKLFDET 195

Query: 209 IESLRF--KINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKD 266
           +  L F  +  D+ + L        +  R  R++ A+ L+  F ++  +F+ + NTLAK+
Sbjct: 196 MARLTFSPEGEDEDLSLEATLNLLSEQKRSRREAGARELARVFGENLPLFARVHNTLAKE 255

Query: 267 EEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMY 326
           +EI+DRWRK      +RHLSN+VEP V+EAL  +V + YPK SHRYY LK KWL L+TM 
Sbjct: 256 KEIEDRWRKMPSAQTARHLSNHVEPEVVEALRNAVVDAYPKLSHRYYALKAKWLGLETME 315

Query: 327 FWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSG 386
            WDR APLP   + +I +  AR++VL +YA F P+M+ IAE FF   WIDA    GK  G
Sbjct: 316 VWDRNAPLPMEEERVIDWPKAREMVLSAYAGFDPEMAAIAEPFFDRGWIDAGVKPGKAPG 375

Query: 387 AFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETA 446
           AFAH T+   HPY+LLNYLGKP+DVMTLAHELGHG+H VL++  QG L  ++ LTLAETA
Sbjct: 376 AFAHPTVTDAHPYVLLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGELLADTPLTLAETA 434

Query: 447 SIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDI 506
           S+FGE LTF  LL  A    ++K+LLA K+EDM+N++VRQI+FYDFE KLH  RR+ G++
Sbjct: 435 SVFGEMLTFRKLLAEAPDAAQKKVLLAGKVEDMINTVVRQIAFYDFECKLHEARRTRGEL 494

Query: 507 PTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYD 566
            T +INE+W+  Q ESLGPAF   D  Y +FW  +PHF+ S FYVYAYAFG+ LVN+LY 
Sbjct: 495 TTSQINELWMSVQGESLGPAFTFMD-GYETFWSYIPHFVHSPFYVYAYAFGDGLVNALYA 553

Query: 567 IYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           +Y+    D F++KY  +L+AG SKH+SELL P  ++ SDP FW++GL  +   ID++E M
Sbjct: 554 VYEEGDPD-FQKKYFEMLKAGGSKHHSELLKPFGLDASDPKFWDKGLSMISGFIDELEAM 612


>gi|85704963|ref|ZP_01036063.1| oligoendopeptidase F [Roseovarius sp. 217]
 gi|85670285|gb|EAQ25146.1| oligoendopeptidase F [Roseovarius sp. 217]
          Length = 606

 Score =  543 bits (1400), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 273/604 (45%), Positives = 379/604 (62%), Gaps = 9/604 (1%)

Query: 23  DMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           D        NLGNLP W+L DLY S  + E+  D+E ++     F   +EG LA      
Sbjct: 10  DANATSGNRNLGNLPEWDLSDLYTSETAPELKRDLEWLQSACAEFAADYEGKLA----TL 65

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
           +   L   I   E I  + GRI SYA L Y    +     KF +D   K+ +    L+FF
Sbjct: 66  DAKGLVDCIQRDEAISNIAGRIMSYAGLRYYQLTTDGGRAKFMSDCQEKVTNSTTPLVFF 125

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
           +LE+N LDE  L   Y+++    +Y   +  IR +K + LS+++E  L D   VG +A +
Sbjct: 126 SLELNRLDETALTAMYSENNDLARYKPVLDRIRAMKPYQLSDELEKFLHDLGVVG-DAWE 184

Query: 203 RFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNT 262
           R F E I  L F ++   + +        + DR  R++AA+ L+  F ++   F+ + NT
Sbjct: 185 RLFDETIAGLTFTVDGDDLSIEGTLNLLTEQDRSKREAAARELARVFGENIRTFARVHNT 244

Query: 263 LAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKL 322
            AK++E+ DRWRK       RHLSN+VEP V+EAL  +V   YPK SHRYYELK+KWL L
Sbjct: 245 QAKEKEVIDRWRKMPSAQTGRHLSNDVEPEVVEALRNAVVAAYPKLSHRYYELKRKWLGL 304

Query: 323 DTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDG 382
           D M  WDR APLP  +  I+ ++ AR+ V+ +Y  F P+M+ +A+ FF   WIDA    G
Sbjct: 305 DRMQVWDRNAPLPMDATRIVDWDEARETVMTAYGAFDPRMADLAQPFFEQGWIDAGVKPG 364

Query: 383 KGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTL 442
           K  GAFAH T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H  L+++ QG L +++ LTL
Sbjct: 365 KAPGAFAHPTVTNVHPYVMLNYLGKPRDVMTLAHELGHGVHQRLAAD-QGELLSSTPLTL 423

Query: 443 AETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRS 502
           AETAS+FGE LTF  +L  A ++ ERK+LLA K+EDM+N++VRQI+FYDFE KLH  RR 
Sbjct: 424 AETASVFGEMLTFQRMLDGAKTQAERKVLLAGKVEDMINTVVRQIAFYDFECKLHAARRD 483

Query: 503 TGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVN 562
            G++    IN +W+  Q +SLG AFD  D  Y +FW  +PHFI S FYVYAYAFG+ LVN
Sbjct: 484 -GELTPDDINLLWMSVQAQSLGEAFDFMD-GYETFWAYIPHFIHSPFYVYAYAFGDGLVN 541

Query: 563 SLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
           +LY +Y+ N  + F++KY  +L+AG SKH+ +LL P  ++ SDP FW++GL  +  MID+
Sbjct: 542 ALYAVYEENP-EGFQDKYFEMLKAGGSKHHKDLLAPFGLDASDPAFWDKGLSMISGMIDE 600

Query: 623 VEKM 626
           +E M
Sbjct: 601 LEAM 604


>gi|83941132|ref|ZP_00953594.1| oligoendopeptidase F [Sulfitobacter sp. EE-36]
 gi|83846952|gb|EAP84827.1| oligoendopeptidase F [Sulfitobacter sp. EE-36]
          Length = 606

 Score =  543 bits (1399), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 272/594 (45%), Positives = 374/594 (62%), Gaps = 9/594 (1%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
            G LP WNL+DLY   D+ E+  D++ +E    +F   +EG LA    + + + L   + 
Sbjct: 20  FGKLPEWNLDDLYTGEDAPELKRDLDWLEEACRSFAEDYEGKLA----ELDANELLDCVL 75

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
             E+I ++ GRI SYA L Y    +     KF +D   K+ +F   L+FF LE+N L++ 
Sbjct: 76  RNEKINQIAGRIMSYAGLRYYQLTTDSGRAKFMSDAQEKITNFTTPLVFFTLELNRLEDD 135

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
            L    +Q     +Y      IR +K + LS++ME  L D   VG +A +R F E I  L
Sbjct: 136 HLANLLSQKADLARYKPVFDRIRAMKDYQLSDEMEKFLHDLGVVG-DAWERLFDETIAGL 194

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
            F++ND+ + +        D  R++R++AA+ L+  F  +   F+ + NT AK++E+ DR
Sbjct: 195 EFEVNDEPLNIEGVLNLLTDPSRDLREAAARELADVFQANIRTFARVHNTQAKEKEVIDR 254

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR        RHLSN+VEP V+EAL  +V N YPK SHRYYELK+KWL LDTM  WDR A
Sbjct: 255 WRGMPTPQTGRHLSNHVEPEVVEALRDAVVNAYPKLSHRYYELKRKWLGLDTMQVWDRNA 314

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP      + +E A   V+ +Y  F P+M  IA  FFT  WIDA    GK  GAFAH T
Sbjct: 315 PLPMEDPKTVSWEQAEKTVMDAYNAFDPRMGEIAAPFFTEGWIDAGVKPGKAPGAFAHPT 374

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +  VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG + +++ LTLAETAS+FGE 
Sbjct: 375 VTDVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGEMLSSTPLTLAETASVFGEM 433

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF  +L  A +  ERK+LLA K+EDM+N++VRQI+FYDFE KLH  RR  G++    IN
Sbjct: 434 LTFRKMLDGAKTNAERKVLLAGKVEDMINTVVRQIAFYDFECKLHDARRG-GELTPDDIN 492

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
            +W+  Q ESLGPAF+  D  Y +FW  +PHF+ S FYVYAYAFG+ LVN+LY +Y+   
Sbjct: 493 ALWMSVQGESLGPAFEFMD-GYETFWAYIPHFVHSPFYVYAYAFGDGLVNALYAVYEEGE 551

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              F++KY ++L+AG SKH+ ELL P  ++ SDP FW++GL  +   ID++E M
Sbjct: 552 -PGFEDKYFDMLKAGGSKHHKELLAPFGLDASDPAFWDKGLSMISGFIDELEAM 604


>gi|259417190|ref|ZP_05741109.1| putative oligoendopeptidase F [Silicibacter sp. TrichCH4B]
 gi|259346096|gb|EEW57910.1| putative oligoendopeptidase F [Silicibacter sp. TrichCH4B]
          Length = 606

 Score =  543 bits (1399), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 269/604 (44%), Positives = 385/604 (63%), Gaps = 9/604 (1%)

Query: 23  DMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           D        +LG LP W+L DLY   D+ E+S D++ ++ E   F   +EG LA      
Sbjct: 10  DANASSGSGDLGKLPEWDLSDLYAGEDAPELSRDLDWLQKECAGFAADYEGKLA----DL 65

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
           +   L   +   E+I  + GRI SYA L Y    +     KF +D+  K+  F   L+FF
Sbjct: 66  DADGLLTCVHRNEKINNIAGRIMSYAGLRYYQLTTDADRAKFLSDVQEKVTIFTTPLVFF 125

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
            LEIN +++A L+  +A +    +Y      IR +K + LS+++E  + D   VG +A +
Sbjct: 126 TLEINRIEDATLDALFAANADLARYKPVFDRIRAMKPYQLSDELERFMHDLGIVG-DAWE 184

Query: 203 RFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNT 262
           + F E I  L F+I+ +++ +        + DR  R++AA+ L+  F  +  IF+ + NT
Sbjct: 185 KLFDETIAGLTFEIDGEELGIEATLNFLTEQDRSKREAAARELARVFADNIKIFARVHNT 244

Query: 263 LAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKL 322
            AK++EI DRWR        RHLSN+VEP V+EAL ++V   YPK SHRYYELK+KWL L
Sbjct: 245 QAKEKEIIDRWRGMPSPQMGRHLSNDVEPEVVEALREAVVAAYPKLSHRYYELKRKWLGL 304

Query: 323 DTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDG 382
           D M  WDR APLP  +  I+ ++ AR  V+++Y  F P+M  +A+ FF   WIDA    G
Sbjct: 305 DRMQVWDRNAPLPMETTRIVDWDEARATVMEAYEAFDPRMGELAQPFFDKGWIDAGVKPG 364

Query: 383 KGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTL 442
           K  GAFAH T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H VL+++ QG + +++ LTL
Sbjct: 365 KAPGAFAHPTVTNVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAD-QGEMLSSTPLTL 423

Query: 443 AETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRS 502
           AETAS+FGE LTF  +L+ A +KEERK+LLA K+EDM+N++VRQI+FYDFE KLH   R+
Sbjct: 424 AETASVFGEMLTFRKMLEKAKTKEERKVLLAGKVEDMINTVVRQIAFYDFECKLHAA-RA 482

Query: 503 TGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVN 562
            G++    IN +W+  Q ESLG  FD  +  Y +FW  +PHF+ S FYVYAYAFG+ LVN
Sbjct: 483 EGELTPEDINALWMSVQAESLGEGFDFME-GYETFWAYIPHFVHSPFYVYAYAFGDGLVN 541

Query: 563 SLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
           +LY +Y +   + F++KY ++L+AG SKH+ ELL P  ++ SDP FW++GL  +  +ID+
Sbjct: 542 ALYSVY-AEGAEGFEDKYFDLLKAGGSKHHKELLAPFGLDASDPKFWDKGLSMISGLIDE 600

Query: 623 VEKM 626
           +E M
Sbjct: 601 LEAM 604


>gi|330993414|ref|ZP_08317349.1| Oligoendopeptidase F-like protein [Gluconacetobacter sp. SXCC-1]
 gi|329759444|gb|EGG75953.1| Oligoendopeptidase F-like protein [Gluconacetobacter sp. SXCC-1]
          Length = 614

 Score =  543 bits (1398), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 262/595 (44%), Positives = 382/595 (64%), Gaps = 9/595 (1%)

Query: 32  NLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAI 91
            L  LPRW+L DLY    + +++ D++  + +S  F   W+G LA     +    L  AI
Sbjct: 29  GLSGLPRWDLSDLYEGPQAPQLATDLDQADADSQDFARVWQGRLASVPGGE----LAQAI 84

Query: 92  AEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDE 151
           AEY+RI E++GR  SYA L +  N S   + +F   +N +L      L+FF LEIN + +
Sbjct: 85  AEYQRIDEVLGRAGSYAQLLFAANTSDSEVARFAQSVNERLTAISTHLLFFTLEINRIPD 144

Query: 152 ALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIES 211
            +L    + DP    ++ +++++R  + + L +++E +L + S  G  A  R F E +  
Sbjct: 145 DVLAAQMS-DPALAHWAPFLRDLRVFRPYQLPDEVEAVLHEKSVTGPAAWNRLFDETMAG 203

Query: 212 LRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
           LR ++  + + L  A  +    DR VR SAA+A+     ++  +FS ITNTLAKD+ I D
Sbjct: 204 LRVRVGGESLTLGNALDTMSSPDRSVRASAARAIGDELGRNVKLFSLITNTLAKDKAIMD 263

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRL 331
             R Y +   +R+ +N VE  V++AL+Q+V   YP+ SHRYY LK KWL L+ + +WDR 
Sbjct: 264 GLRHYPRPTSARNCANMVEDEVVDALVQAVTEAYPRLSHRYYALKAKWLGLEKLEYWDRN 323

Query: 332 APLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHG 391
           APL    + +I ++ A   VL +Y  F P+M  +A++FF H WIDAP   GK SGAFAH 
Sbjct: 324 APLTTQDEPLIGWKEATGQVLGAYEGFDPRMGKVAKEFFDHAWIDAPPVPGKASGAFAHP 383

Query: 392 TIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE 451
           T+PSVHPY+LLNY G+ +DVMTLAHELGHG+H VL+   QG L +++ LTLAETAS+FGE
Sbjct: 384 TVPSVHPYLLLNYRGRTRDVMTLAHELGHGVHQVLAGR-QGYLMSSTPLTLAETASVFGE 442

Query: 452 TLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRI 511
            LTF +LL A +    R+++LA K+EDMLN++VRQ++FY FE  +H ERR  G++   RI
Sbjct: 443 MLTFRALLDAQTDPTRRRLMLAAKVEDMLNTVVRQVAFYRFETLVHEERRK-GELLPARI 501

Query: 512 NEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSN 571
            EIW +TQ ESLGPAF+ +  +Y  +W  VPHFI S FYVYAYAFG+CLVN+LY +++S 
Sbjct: 502 GEIWRQTQAESLGPAFNFTP-DYDVYWTYVPHFIHSPFYVYAYAFGDCLVNALYGVFRSG 560

Query: 572 TVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
               F++KYL++L AG +K + ELL P  ++ +DP FW++GL  +   ID++E++
Sbjct: 561 H-PGFQDKYLDMLAAGGTKRHRELLAPFGLDAADPGFWQKGLDVIAGFIDELERV 614


>gi|83955691|ref|ZP_00964271.1| oligoendopeptidase F [Sulfitobacter sp. NAS-14.1]
 gi|83839985|gb|EAP79161.1| oligoendopeptidase F [Sulfitobacter sp. NAS-14.1]
          Length = 606

 Score =  543 bits (1398), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 271/594 (45%), Positives = 374/594 (62%), Gaps = 9/594 (1%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
            G LP WNL+DLY   D+ E+  D++ +E    +F   +EG LA    + + + L   + 
Sbjct: 20  FGKLPEWNLDDLYTGEDAPELKRDLDWLEEACRSFAEDYEGKLA----ELDANELLECVL 75

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
             E+I ++ GRI SYA L Y    +     KF +D   K+ +F   L+FF LE+N L++ 
Sbjct: 76  RNEKINQIAGRIMSYAGLRYYQLTTDSGRAKFMSDAQEKITNFTTPLVFFTLELNRLEDD 135

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
            L    +Q     +Y      IR +K + LS++ME  L D   VG +A +R F E I  L
Sbjct: 136 HLANVLSQKADLARYKPVFDRIRAMKDYQLSDEMEKFLHDLGVVG-DAWERLFDETIAGL 194

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
            F++ND+ + +        D  R++R++AA+ L+  F  +   F+ + NT AK++E+ DR
Sbjct: 195 EFEVNDEPLNIEGVLNLLTDPSRDLREAAARELADVFQANIRTFARVHNTQAKEKEVIDR 254

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR        RHLSN+VEP V+EAL  +V N YPK SHRYYELK+KWL LDTM  WDR A
Sbjct: 255 WRGMPTPQTGRHLSNHVEPEVVEALRDAVVNAYPKLSHRYYELKRKWLGLDTMQVWDRNA 314

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP      + +E A   V+ +Y  F P+M  IA  FFT  WIDA    GK  GAFAH T
Sbjct: 315 PLPMEDPKTVSWEQAEKTVMDAYNAFDPRMGEIAAPFFTEGWIDAGVKPGKAPGAFAHPT 374

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +  VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG + +++ LTLAETAS+FGE 
Sbjct: 375 VTDVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGEMLSSTPLTLAETASVFGEM 433

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF  +L  A +  ERK+LLA K+EDM+N++VRQI+FYDFE KLH  RR  G++    IN
Sbjct: 434 LTFRKMLDGAKTNAERKVLLAGKVEDMINTVVRQIAFYDFECKLHDARRG-GELTPDDIN 492

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
            +W+  Q ESLGPAF+  D  Y +FW  +PHF+ S FYVYAYAFG+ LVN+LY +Y+   
Sbjct: 493 ALWMSVQGESLGPAFEFMD-GYETFWAYIPHFVHSPFYVYAYAFGDGLVNALYAVYEEGE 551

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              F++KY ++L+AG SKH+ ELL P  ++ SDP FW++GL  +   I+++E M
Sbjct: 552 -PGFEDKYFDMLKAGGSKHHKELLAPFGLDASDPAFWDKGLSMISGFINELEAM 604


>gi|294678322|ref|YP_003578937.1| oligoendopeptidase F [Rhodobacter capsulatus SB 1003]
 gi|294477142|gb|ADE86530.1| oligoendopeptidase F [Rhodobacter capsulatus SB 1003]
          Length = 608

 Score =  541 bits (1395), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 273/596 (45%), Positives = 376/596 (63%), Gaps = 13/596 (2%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAH--ATNQKNCHSLGAA 90
            G LP W+L DLY + D+ E  +DM  +E    +F   +EG LA   A    +C      
Sbjct: 22  FGALPDWDLSDLYTAPDAPEFLHDMAWLEAACASFAKDYEGQLADLDAAGMADC------ 75

Query: 91  IAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLD 150
           IA +E I  + GRI SYA L Y  N +     KF +D   K+  F   L+FF+LE N +D
Sbjct: 76  IARHEAIETVAGRIMSYAGLRYYQNTTDAERAKFMSDAGDKITSFTTPLVFFSLEFNRID 135

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIE 210
           +A  E  +A DPL  ++      +R +K + LS+++E  L D S VG  A  R F E   
Sbjct: 136 DARYEAVFA-DPLVARFKPVFDRMRAMKPYQLSDELEKFLHDQSVVGASAWNRLFDETTA 194

Query: 211 SLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
           +L+F +  + + L        D DR  R++AA+ L+  F ++  +F+ + NTLAK++E++
Sbjct: 195 ALQFTVQGETLNLEATTTLMSDHDRGKREAAARELARVFGQNVKLFARVHNTLAKEKEVE 254

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
           DRWRK       RHLSN+VEP V+EAL  +V   YP+ SHRYY LK KWL L+ +  WDR
Sbjct: 255 DRWRKMPTPQLGRHLSNHVEPEVVEALRNAVVAAYPRLSHRYYALKAKWLGLEKLQVWDR 314

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
            APLP  +   I ++ A+  VL +Y  FSP+M+ IA+ FF   WIDA    GK  GAFAH
Sbjct: 315 NAPLPSETPRKILWDEAKATVLGAYGAFSPRMAEIAQPFFDKGWIDAGVKPGKAPGAFAH 374

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
            T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H VL+++ QG + +++ LTLAETAS+FG
Sbjct: 375 PTVTTVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAK-QGPMLSDTPLTLAETASVFG 433

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E LTF +LL AA +  ERK LLA K+EDM+N++VRQI+FYDFE KLH   R+ G++    
Sbjct: 434 EMLTFRALLDAAKTPAERKQLLAGKVEDMINTVVRQIAFYDFECKLHAA-RAQGELTPED 492

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
           IN +W+  Q ESLGP F+     Y +FW  +PHF+ S FYVYAYAFG+ LVN+LY  Y +
Sbjct: 493 INALWMSVQAESLGPVFEFMP-GYETFWTYIPHFVHSPFYVYAYAFGDGLVNALYATYAA 551

Query: 571 NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              D F+ KY  +L AG SKH+ +LL P  ++ SDP FW++GL  +  +ID++E M
Sbjct: 552 GLPD-FQTKYFEMLEAGGSKHHKDLLAPFGLDASDPAFWDKGLSMIAGLIDELEAM 606


>gi|254511925|ref|ZP_05123992.1| oligoendopeptidase F [Rhodobacteraceae bacterium KLH11]
 gi|221535636|gb|EEE38624.1| oligoendopeptidase F [Rhodobacteraceae bacterium KLH11]
          Length = 643

 Score =  541 bits (1395), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 270/594 (45%), Positives = 376/594 (63%), Gaps = 9/594 (1%)

Query: 23  DMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           D       ++LGNLP W+L DLY S D+ E+S D++ +E E  +F   +EG LA    + 
Sbjct: 10  DANAGGGADDLGNLPEWDLTDLYASEDAPELSRDLDWLEQECASFAADYEGKLA----EL 65

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
           +  +L   +   E+I  + GRI S+A L Y    +     KF +D+  K+  F   L+FF
Sbjct: 66  DAATLLTCVLRNEKINAIAGRIMSFAGLRYYQITTDADRAKFLSDMQEKITVFTTPLVFF 125

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
            LEIN +D+ +L   +A      +Y    + IR +K + LS+++E  L D   VG +A +
Sbjct: 126 TLEINRIDDDVLAAHFAASADLARYEPVFRRIRAMKPYQLSDELEKFLHDLGVVG-DAWE 184

Query: 203 RFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNT 262
           R F E I  L F ++ +++ +        + DR  R++AA+ L+  F  +   F+ + NT
Sbjct: 185 RLFDETIAGLTFTVDGEELNIEGTLNLLTEQDRTKREAAARELATVFQSNIKTFARVHNT 244

Query: 263 LAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKL 322
            AK++EI DRWR        RHLSN+VEP V+EAL ++V   YPK SHRYYELK+KWL L
Sbjct: 245 QAKEKEIVDRWRNMPTAQTGRHLSNDVEPEVVEALREAVVAAYPKLSHRYYELKRKWLGL 304

Query: 323 DTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDG 382
           D M  WDR APLP     I+ +  A   V+ +Y  F P+M  IA  FF+  WIDA    G
Sbjct: 305 DVMQVWDRNAPLPMEDTRIVDWAEAEATVMGAYNAFDPRMGEIASPFFSKGWIDAAVKPG 364

Query: 383 KGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTL 442
           K  GAFAH T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL+++ QG + +++ LTL
Sbjct: 365 KAPGAFAHPTVTEVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAD-QGEMLSSTPLTL 423

Query: 443 AETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRS 502
           AETAS+FGE LTF  +L  A + E+RK+LLA K+EDM+N++VRQI+FYDFE KLH  RR 
Sbjct: 424 AETASVFGEMLTFRKMLDQAETPEQRKVLLAGKVEDMINTVVRQIAFYDFECKLHAARRE 483

Query: 503 TGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVN 562
            G++    IN +W+  Q ESLGPAF+  +  Y +FW  +PHF+ S FYVYAYAFG+ LVN
Sbjct: 484 -GELTPDDINALWMSVQAESLGPAFEFME-GYETFWAYIPHFVHSPFYVYAYAFGDGLVN 541

Query: 563 SLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTV 616
           +LY +Y+S   D F++KY ++LRAG SKH+ ELL P  ++ SDP FW +GL  +
Sbjct: 542 ALYSVYESG-ADGFEDKYFDMLRAGGSKHHKELLAPFGLDASDPAFWGKGLSMI 594


>gi|296115080|ref|ZP_06833722.1| oligoendopeptidase F [Gluconacetobacter hansenii ATCC 23769]
 gi|295978417|gb|EFG85153.1| oligoendopeptidase F [Gluconacetobacter hansenii ATCC 23769]
          Length = 630

 Score =  541 bits (1393), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 277/620 (44%), Positives = 394/620 (63%), Gaps = 11/620 (1%)

Query: 9   FFSNAFFRKALRSSDMTTMDS--QENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLA 66
           +FS+AF R    SS      S    + G LPRW+L DLY S +S  +  D+E  E ++ A
Sbjct: 20  YFSHAFPRGVRVSSPAEGGGSVASPHDGALPRWDLRDLYDSPESPRLQTDLEQAEEDARA 79

Query: 67  FKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYT 126
           F   W G LA    Q +  ++ +AI EY+RI E++GR ASYA L +  N +   I +F  
Sbjct: 80  FADAWRGRLA----QADGAAVASAIVEYQRIDEVLGRAASYAQLLFAANSADAKIARFSQ 135

Query: 127 DINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDM 186
            +N +L      L+FF LE+N + + ++ +  A DP    ++ +I+++R  + + LS+++
Sbjct: 136 SVNERLTAISTHLLFFTLEMNRIPDDVMARQMA-DPALAHWAPFIRDLRVFRPYQLSDEV 194

Query: 187 ECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALS 246
           E +L + S  G  A  R F E + SLR  +  +++ L  A       DR  R  AA+A+ 
Sbjct: 195 ESVLHEKSVTGAAAWNRLFDETMASLRVPLAGEELTLGAALDRMSSPDRMARADAARAVG 254

Query: 247 HTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYP 306
            T  +   +FS +TNTLAKD+ I D  R Y +   +R+ +N VE  V++AL+Q+V   YP
Sbjct: 255 ATLQERIRLFSLVTNTLAKDKAITDTLRHYPRPTSARNCANMVEDGVVDALVQAVTASYP 314

Query: 307 KTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIA 366
           + SHRYY LK KWL ++ + +WDR APL    + +IP+  A   VL +Y  F P+M  I 
Sbjct: 315 RLSHRYYALKAKWLGVEKLQYWDRNAPLTTQDEPLIPWADATAQVLGAYEGFDPRMGEIG 374

Query: 367 EKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVL 426
            +FF + WIDAP   GK SGAFAH T+PS HPY+LLNY G+ +DVMTLAHELGHG+H VL
Sbjct: 375 RRFFDNAWIDAPPVPGKASGAFAHPTVPSAHPYLLLNYRGRTRDVMTLAHELGHGVHQVL 434

Query: 427 SSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQ 486
           +   QG L + + LTLAETAS+FGE LTF +LL A +    R+++LA K+EDMLN++VRQ
Sbjct: 435 AG-AQGYLMSGTPLTLAETASVFGEMLTFRALLDAQADPARRRLMLAAKVEDMLNTVVRQ 493

Query: 487 ISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIE 546
           ++FY FE  +H ERRS G++   RI EIW ETQ ESLGPAF+ +  +Y  +W  VPHFI 
Sbjct: 494 VAFYRFETLVHEERRS-GELLPERIGEIWRETQAESLGPAFEFTP-DYDVYWTYVPHFIH 551

Query: 547 SSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDP 606
           S FYVYAYAFG+CLVN+LYD+++S     F++KYL++LRAG +K + ELL P  ++ +DP
Sbjct: 552 SPFYVYAYAFGDCLVNALYDVFQSGH-PGFQDKYLDMLRAGGTKRHRELLAPFGLDAADP 610

Query: 607 NFWERGLQTVEKMIDDVEKM 626
            FW RGL  +   ID++E++
Sbjct: 611 GFWNRGLDVIAGFIDELERI 630


>gi|126729314|ref|ZP_01745128.1| oligoendopeptidase F [Sagittula stellata E-37]
 gi|126710304|gb|EBA09356.1| oligoendopeptidase F [Sagittula stellata E-37]
          Length = 607

 Score =  541 bits (1393), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 268/604 (44%), Positives = 379/604 (62%), Gaps = 9/604 (1%)

Query: 23  DMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           D       ++LG LP W+L DLYP+ D+ E+  D++ +E    +F T +EG L    +  
Sbjct: 11  DANASAGGKDLGPLPEWDLTDLYPAPDAPELKRDLDWLEDACRSFATDYEGKL----DSL 66

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
           +      AI  +E+I  + GRI S+A L Y      P   KF +D+  K+  +   L+FF
Sbjct: 67  DAKGFLDAIHRHEKIEGIAGRIMSFAGLRYYQMTVDPERAKFLSDMQEKITVYTTPLVFF 126

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
            LE+N L++   +  YA++    +Y   I+ IR +K + LS++ME  L D   VG +A +
Sbjct: 127 TLELNRLEDDFFDSRYAENADLARYKPAIRRIRAMKPYQLSDEMEKFLHDLGVVG-DAWE 185

Query: 203 RFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNT 262
           R F E I  L F I+ ++  +        D DR  R++AA+ L+  F  +   F+ + NT
Sbjct: 186 RLFDETIAGLTFTIDGEEQNIESTLNHLTDQDRSKREAAARELARVFAANIKTFARVHNT 245

Query: 263 LAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKL 322
             K++E+ DRWR        RHLSN+VEP V+EAL  +V   YP+ SHRYYELK+KWL +
Sbjct: 246 QTKEKEVMDRWRGMPTAQTGRHLSNDVEPEVVEALRNAVVAAYPRLSHRYYELKRKWLGV 305

Query: 323 DTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDG 382
           D M  WDR APLP  +  I+ +  AR +V+ +Y  F P+M  IA  FF   WIDA    G
Sbjct: 306 DRMQVWDRNAPLPMETDRIVKWPEARGMVMDAYTAFDPRMGEIATPFFDKGWIDAAVKPG 365

Query: 383 KGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTL 442
           K  GAFAH T+   HPY+LLNYLGKP+DVMTLAHELGHG+H VL+++ QG +  ++ LTL
Sbjct: 366 KAPGAFAHPTVTDAHPYVLLNYLGKPRDVMTLAHELGHGVHQVLAAD-QGEMLASTPLTL 424

Query: 443 AETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRS 502
           AETAS+FGE LTF  +L+ A  ++ERK+LLA K+EDM+N++VRQI+FYDFE KLH  RR 
Sbjct: 425 AETASVFGEMLTFRKMLENAKDQKERKVLLAGKVEDMINTVVRQIAFYDFECKLHEARRG 484

Query: 503 TGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVN 562
            G++    IN +W+  Q ESLG +FD  +  Y +FW  +PHF+ S FYVYAYAFG+ LVN
Sbjct: 485 -GELTPDDINALWMSVQAESLGESFDFME-GYETFWAYIPHFVHSPFYVYAYAFGDGLVN 542

Query: 563 SLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
           +LY  Y+    + F++KY ++L+AG SKH+ ELL P  ++ +DP FW++GL  +E  ID+
Sbjct: 543 ALYAAYEEQP-EGFQDKYFDMLKAGGSKHHKELLAPFGLDATDPAFWDKGLSMIEGFIDE 601

Query: 623 VEKM 626
           +E M
Sbjct: 602 LEAM 605


>gi|221638826|ref|YP_002525088.1| Oligoendopeptidase, pepF/M3 family [Rhodobacter sphaeroides KD131]
 gi|221159607|gb|ACM00587.1| Oligoendopeptidase, pepF/M3 family [Rhodobacter sphaeroides KD131]
          Length = 606

 Score =  540 bits (1392), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 278/598 (46%), Positives = 376/598 (62%), Gaps = 8/598 (1%)

Query: 29  SQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG 88
           S   LGNLP W+L DLYP+ D  E  +DM  ++     F   +EG LA      +   L 
Sbjct: 15  SAGGLGNLPDWDLRDLYPTPDGPEFRDDMAWLKEACAGFAASYEGKLA----SLDAAGLL 70

Query: 89  AAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINT 148
           A I  YE+I  + GR+ SYA L Y  N       KF  D   K+ D+   L+FF+LE N 
Sbjct: 71  ACIEAYEKIDIVAGRLMSYAGLRYYQNTMDSERAKFMADAQDKVTDYTTALVFFSLEFNR 130

Query: 149 LDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCEN 208
           L++A LE   A+     +Y      +R ++ H LS+++E  L D S VG  A  R F E 
Sbjct: 131 LEDAHLEARLAESAALARYKPVFDRMRAMRPHQLSDELERFLHDESTVGAAAWNRLFDET 190

Query: 209 IESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEE 268
           +  L F +  +++ L        D +R  R++AA+AL+  F ++  +F+ + NTLAK++E
Sbjct: 191 MAGLTFTLEGEELNLESTLNLLTDPERPRREAAARALAEVFGRNIKLFARVHNTLAKEKE 250

Query: 269 IQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFW 328
           I DRWRK       RHL+N+VEP V+EAL  +V   YPK SHRYY LK KWL LD +  W
Sbjct: 251 IHDRWRKMPTPQYGRHLANHVEPEVVEALRNAVVAAYPKLSHRYYRLKAKWLGLDKLQVW 310

Query: 329 DRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAF 388
           DR APLP  +  ++ ++ A+  V+++Y+ F P+M+ IA+ FF   WIDA    GK  GAF
Sbjct: 311 DRNAPLPTETPRLVGWDEAQSTVMEAYSAFDPRMAEIAKPFFEKGWIDAGVKPGKAPGAF 370

Query: 389 AHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASI 448
           AH T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG L +++ LTLAETAS+
Sbjct: 371 AHPTVTTVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGELLSSTPLTLAETASV 429

Query: 449 FGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPT 508
           FGE LTF  LL AA +  ERK LLA K+EDM+N++VRQI+FYDFE KLH  RR  G++  
Sbjct: 430 FGEMLTFRRLLDAARTPAERKTLLAGKVEDMINTVVRQIAFYDFECKLHEARRQ-GELTP 488

Query: 509 HRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIY 568
             IN +W+  Q ESLG AF+  +  Y +FW  VPHF+ S FYVYAYAFG+ LVN+LY +Y
Sbjct: 489 EDINALWMSVQAESLGDAFEFME-GYETFWSYVPHFVHSPFYVYAYAFGDGLVNALYAVY 547

Query: 569 KSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              T   F+EKY  +L AG SKH+ ELL P  ++ SDP FW++GL  +   ID++E M
Sbjct: 548 AEGT-PGFQEKYFEMLSAGGSKHHKELLAPFGLDASDPTFWDKGLSMIAGFIDELEAM 604


>gi|86137864|ref|ZP_01056440.1| oligoendopeptidase F [Roseobacter sp. MED193]
 gi|85825456|gb|EAQ45655.1| oligoendopeptidase F [Roseobacter sp. MED193]
          Length = 607

 Score =  539 bits (1389), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 271/606 (44%), Positives = 380/606 (62%), Gaps = 13/606 (2%)

Query: 23  DMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAH--ATN 80
           D       + LGNLP W+L DLY + D+ E++ D++ +  E  AF + +EG LA   A  
Sbjct: 10  DANASSGSDELGNLPEWDLTDLYAADDAPELTRDLDWLAQECSAFASDYEGKLADLDAEG 69

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
             NC      +   E+I  + GR+ SYA L Y    +     KF +D   K+  F   L+
Sbjct: 70  LLNC------VLRNEKINAIAGRVMSYAGLRYYQLTTDAERAKFMSDCQEKITIFTTPLV 123

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           FF LEIN +++  L   +A +    +Y      IR +K + LS+++E  L D   VG +A
Sbjct: 124 FFTLEINRIEDETLAAHFATNSDLARYKPVFDRIRAMKPYQLSDELERFLHDLGVVG-DA 182

Query: 201 LKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFIT 260
            +R F E I  L F ++  ++ +        + DR  R++A++ L+  F  +   F+ + 
Sbjct: 183 WERLFDETIAGLTFTVDGLELNIEGTLNLLTEQDRNKREAASRELARVFQDNVKTFARVH 242

Query: 261 NTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWL 320
           NT AK++EI DRWR        RHLSN+VEP V+EAL ++V   YPK SHRYYELK+KWL
Sbjct: 243 NTQAKEKEILDRWRGMPTPQTGRHLSNDVEPEVVEALREAVVAAYPKLSHRYYELKRKWL 302

Query: 321 KLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQY 380
            LD M  WDR APLP     ++ +  A   V+++Y  F P+M  +A  FF+  WIDA   
Sbjct: 303 GLDRMQVWDRNAPLPMEDTRVVDWAQAEKTVMEAYEAFDPRMGELAAPFFSKGWIDAGVK 362

Query: 381 DGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSL 440
            GK  GAFAH T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL++E QG + +++ L
Sbjct: 363 PGKAPGAFAHPTVTDVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAE-QGEMLSSTPL 421

Query: 441 TLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTER 500
           TLAETAS+FGE LTF  +L+ A +KE+RKILLA K+EDM+N++VRQI+FYDFE KLH   
Sbjct: 422 TLAETASVFGEMLTFRKMLEGAETKEQRKILLAGKVEDMINTVVRQIAFYDFECKLHAA- 480

Query: 501 RSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCL 560
           R+ G++    IN +W+  Q ESLG AFD  +  Y +FW  VPHF+ S FYVYAYAFG+ L
Sbjct: 481 RAEGELTPDDINALWMSVQAESLGEAFDFME-GYETFWCYVPHFVHSPFYVYAYAFGDGL 539

Query: 561 VNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMI 620
           VN+LY +Y     + F++KY ++L+AG SKH+ ELL P  ++ SDP FW++GL  + +MI
Sbjct: 540 VNALYSVYAEGG-EGFEDKYFDMLKAGGSKHHKELLAPFGLDASDPKFWDKGLSMISEMI 598

Query: 621 DDVEKM 626
           D++E M
Sbjct: 599 DELEAM 604


>gi|77462970|ref|YP_352474.1| oligoendopeptidase F [Rhodobacter sphaeroides 2.4.1]
 gi|77387388|gb|ABA78573.1| Oligoendopeptidase F [Rhodobacter sphaeroides 2.4.1]
          Length = 606

 Score =  538 bits (1387), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 277/598 (46%), Positives = 376/598 (62%), Gaps = 8/598 (1%)

Query: 29  SQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG 88
           S   LGNLP W+L DLYP+ D  E  +DM  ++     F   +EG LA      +   L 
Sbjct: 15  SAGGLGNLPDWDLRDLYPTPDGPEFRDDMAWLKEACAGFAASYEGKLA----SLDAAGLL 70

Query: 89  AAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINT 148
           A I  YE+I  + GR+ SYA L Y  N       KF  D   K+ D+   L+FF+LE N 
Sbjct: 71  ACIEAYEKIDIVAGRLMSYAGLRYYQNTMDSERAKFMADAQDKVTDYTTALVFFSLEFNR 130

Query: 149 LDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCEN 208
           L++A LE   A+     +Y      +R ++ H LS+++E  L D S VG  A  R F E 
Sbjct: 131 LEDAHLEARLAESAALARYKPVFDRMRAMRPHQLSDELERFLHDESTVGAAAWNRLFDET 190

Query: 209 IESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEE 268
           +  L F +  +++ L        D +R  R++AA+AL+  F ++  +F+ + NTLAK++E
Sbjct: 191 MAGLTFTLEGEELNLESTLNLLTDPERPRREAAARALAEVFGRNIKLFARVHNTLAKEKE 250

Query: 269 IQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFW 328
           I DRWRK       RHL+N+VEP V+EAL  +V   YPK SHRYY LK KWL LD +  W
Sbjct: 251 IHDRWRKMPTPQYGRHLANHVEPEVVEALRNAVVAAYPKLSHRYYRLKAKWLGLDKLQVW 310

Query: 329 DRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAF 388
           DR APLP  +  ++ ++ A+  V+++Y+ F P+M+ IA+ FF   WIDA    GK  GAF
Sbjct: 311 DRNAPLPTETPRLVGWDEAQSTVMEAYSAFDPRMAEIAKPFFEKGWIDAGVKPGKAPGAF 370

Query: 389 AHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASI 448
           AH T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG L +++ LTLAETAS+
Sbjct: 371 AHPTVTTVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGELLSSTPLTLAETASV 429

Query: 449 FGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPT 508
           FGE LTF  LL AA +  ERK LLA K+EDM+N++VRQI+FYDFE KLH  RR  G++  
Sbjct: 430 FGEMLTFRRLLDAARTPAERKTLLAGKVEDMINTVVRQIAFYDFECKLHEARRQ-GELTP 488

Query: 509 HRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIY 568
             IN +W+  Q ESLG AF+  +  Y +FW  VPHF+ S FYVYAYAFG+ LVN+LY +Y
Sbjct: 489 EDINALWMSVQAESLGDAFEFME-GYETFWSYVPHFVHSPFYVYAYAFGDGLVNALYAVY 547

Query: 569 KSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              T   F++KY  +L AG SKH+ ELL P  ++ SDP FW++GL  +   ID++E M
Sbjct: 548 AEGT-PGFQDKYFEMLSAGGSKHHKELLAPFGLDASDPTFWDKGLSMIAGFIDELEAM 604


>gi|148260482|ref|YP_001234609.1| pepF/M3 family oligoendopeptidase [Acidiphilium cryptum JF-5]
 gi|146402163|gb|ABQ30690.1| oligoendopeptidase, pepF/M3 family [Acidiphilium cryptum JF-5]
          Length = 615

 Score =  538 bits (1386), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 263/593 (44%), Positives = 378/593 (63%), Gaps = 12/593 (2%)

Query: 36  LPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYE 95
           LP WNL DLY   +   I+ D+  +  ++ AF   + G +A      +   L  AIA YE
Sbjct: 30  LPSWNLTDLYRGTEDPAIATDIARLGADARAFAAAFRGRVA----GLDGSGLAEAIARYE 85

Query: 96  RICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLE 155
            I + +GR+ ++A L+++ + + PT  +FY  I+ +  +    ++FF LEIN +D+A  E
Sbjct: 86  AIEQGLGRLHAFAQLNFSADATVPTAGQFYQSISERATEIGADVVFFTLEINQIDDAAFE 145

Query: 156 QSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFK 215
            + A DP   +++ W+ ++R ++ H LS+++E LL +    G  A  R F E I +LR  
Sbjct: 146 AALA-DPALARFAPWLGDLRALRPHQLSDEIERLLHEKEVTGHAAWSRLFDETIAALRVP 204

Query: 216 INDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRK 275
           +  +++ L+ A     D DR  R++A  A+  T  +++ +F+ I NT+AKD+ I+D WR+
Sbjct: 205 VAGEELTLSAALNRLSDPDRAQREAAGHAIGTTLQRNARLFTQILNTIAKDKAIEDGWRR 264

Query: 276 YEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLP 335
           Y     +RHL+N VEP V+EAL+ +V + YP+ +HRYY LK  WL LD +  WDR APLP
Sbjct: 265 YASPEAARHLANRVEPAVVEALVSAVTDAYPRLAHRYYTLKAGWLGLDRLQHWDRNAPLP 324

Query: 336 GTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPS 395
           G S   I +  AR+ VL +Y  FSP+M +IA +FF   WIDA    GK  GAFAH  +P 
Sbjct: 325 GESDRRIGWPEARERVLAAYGAFSPEMRVIAARFFDGGWIDAVPRPGKSGGAFAHPAVPD 384

Query: 396 VHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTF 455
           VHPYILLNY G+ +DVMTLAHELGHG+H VL++  QG L   + LTLAETAS+FGE LTF
Sbjct: 385 VHPYILLNYHGRARDVMTLAHELGHGVHQVLAAR-QGYLMAATPLTLAETASVFGEMLTF 443

Query: 456 DSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIW 515
            +LL A S  + R+++LA K+EDMLN++VRQI+F+ FE +LH  RR  G++    I+ IW
Sbjct: 444 RALLDAESDPQRRRLMLAQKVEDMLNTVVRQIAFHQFEQRLHAARRR-GELLLDEISAIW 502

Query: 516 LETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDC 575
           +  Q+ESLGPAF+ SD +Y  FW  VPHF+ S FYVYAYAFG+CLVN+LY +Y+      
Sbjct: 503 IGVQRESLGPAFEFSD-DYRMFWAYVPHFVHSPFYVYAYAFGDCLVNALYGVYRDQAARG 561

Query: 576 ----FKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVE 624
               F  +YL++L AG ++ + ELL P  ++ SDP FW RGL  +   ID++E
Sbjct: 562 AGADFVARYLDMLAAGGTRRHRELLAPFGLDASDPAFWRRGLDVIAGFIDELE 614


>gi|312112859|ref|YP_004010455.1| oligoendopeptidase, pepF/M3 family [Rhodomicrobium vannielii ATCC
           17100]
 gi|311217988|gb|ADP69356.1| oligoendopeptidase, pepF/M3 family [Rhodomicrobium vannielii ATCC
           17100]
          Length = 619

 Score =  538 bits (1386), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 259/591 (43%), Positives = 390/591 (65%), Gaps = 8/591 (1%)

Query: 36  LPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYE 95
           +P WNL DLYP  D  ++++D+E  +  +  FK  + G LA    +++   L  A+A YE
Sbjct: 33  IPGWNLGDLYP--DEAKLASDIETAKARAGEFKAAYAGKLADLA-ERDPAGLAGALAAYE 89

Query: 96  RICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLE 155
            I +L+GR+ SY+ L+Y  +   P   K + D+  KL      L+FF LE+N +D+A+++
Sbjct: 90  GISDLMGRVGSYSYLNYVTDTGDPARAKLFGDVRDKLTVIGTELLFFELELNRIDDAVMD 149

Query: 156 QSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFK 215
           ++ A D L   Y  W+ ++RK + + L++D+E L  + +  G  A  R F E + SLRF 
Sbjct: 150 KAIANDKLG-HYRPWLTDLRKERPYQLADDIERLFHEKAMTGPAAWSRLFNETLTSLRFD 208

Query: 216 INDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRK 275
           ++ + + L  A     D++   R +AA+++     ++  +F+ + NTLAKD+EI DRWR 
Sbjct: 209 VDGEILTLEPALNLLSDANPVRRAAAAQSIGKVLKENVRLFTLVMNTLAKDKEISDRWRG 268

Query: 276 YEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLP 335
           +  +A SRHL+N VEP V++AL+++V+  YP+ SHRYY LK KWL +DT+ +WDR AP+ 
Sbjct: 269 FPDVASSRHLANRVEPEVVDALVEAVRASYPRLSHRYYALKAKWLGVDTLNYWDRNAPIS 328

Query: 336 GTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPS 395
              + +I ++ A   V+ +Y +FSP+M+ +A+ FF  NWIDAP  DGK  GAF+H T+PS
Sbjct: 329 RDPEPVIAWKDAHSTVIAAYHRFSPKMAEVADGFFKKNWIDAPVRDGKSPGAFSHPTVPS 388

Query: 396 VHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTF 455
            HPYI++NYLGKP+DVMTLAHELGHG+H VL++  QG L   + LTLAETAS+FGE LTF
Sbjct: 389 AHPYIMMNYLGKPRDVMTLAHELGHGVHQVLAN-AQGALMAYTPLTLAETASVFGEMLTF 447

Query: 456 DSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIW 515
            +LL    +  E++ LLA K+ED +N++VRQI+FY FE  +H  RR  G++ + ++   W
Sbjct: 448 KALLNQTENPREKRALLAQKVEDKINTVVRQIAFYQFERLVHEARRQ-GELTSDQLGAFW 506

Query: 516 LETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDC 575
           L+ Q ESLGPA  +++  Y ++W  V HF+ S FYVYAYAFG+CLVNSLY  Y+    + 
Sbjct: 507 LQVQTESLGPAIIMNE-GYDTYWTYVSHFVHSPFYVYAYAFGDCLVNSLYAAYE-RAPEG 564

Query: 576 FKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           F+ +YL++LRAG +KH++ELL P  ++ +DP FW  GL  +E MI ++E +
Sbjct: 565 FEGRYLDMLRAGGTKHHTELLAPFGLDATDPGFWSMGLSVIEDMISELETL 615


>gi|326403675|ref|YP_004283757.1| putative oligoendopeptidase [Acidiphilium multivorum AIU301]
 gi|325050537|dbj|BAJ80875.1| putative oligoendopeptidase [Acidiphilium multivorum AIU301]
          Length = 615

 Score =  538 bits (1385), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 263/593 (44%), Positives = 378/593 (63%), Gaps = 12/593 (2%)

Query: 36  LPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYE 95
           LP WNL DLY   +   I+ D+  +  ++ AF   + G +A      +   L  AIA YE
Sbjct: 30  LPSWNLTDLYRGTEDPAIATDIARLGADARAFAAAFRGRVA----GLDGSGLAEAIARYE 85

Query: 96  RICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLE 155
            I + +GR+ ++A L+++ + + PT  +FY  I+ +  +    ++FF LEIN +D+A  E
Sbjct: 86  AIEQGLGRLHAFAQLNFSADATVPTAGQFYQSISERATEIGADVVFFTLEINQIDDAAFE 145

Query: 156 QSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFK 215
            + A DP   +++ W+ ++R ++ H LS+++E LL +    G  A  R F E I +LR  
Sbjct: 146 AALA-DPALARFAPWLGDLRALRPHQLSDEIERLLHEKEVTGHAAWSRLFDETIAALRVP 204

Query: 216 INDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRK 275
           +  +++ L+ A     D DR  R++A  A+  T  +++ +F+ I NT+AKD+ I+D WR+
Sbjct: 205 VAGEELTLSAALNRLSDPDRVQREAAGHAIGTTLQRNARLFTQILNTIAKDKAIEDGWRR 264

Query: 276 YEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLP 335
           Y     +RHL+N VEP V+EAL+ +V + YP+ +HRYY LK  WL LD +  WDR APLP
Sbjct: 265 YASPEAARHLANRVEPAVVEALVSAVTDAYPRLAHRYYTLKAGWLGLDRLQHWDRNAPLP 324

Query: 336 GTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPS 395
           G S   I +  AR+ VL +Y  FSP+M +IA +FF   WIDA    GK  GAFAH  +P 
Sbjct: 325 GESDRRIGWPEARERVLAAYGAFSPEMRVIAARFFDGGWIDAVPRPGKSGGAFAHPAVPD 384

Query: 396 VHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTF 455
           VHPYILLNY G+ +DVMTLAHELGHG+H VL++  QG L   + LTLAETAS+FGE LTF
Sbjct: 385 VHPYILLNYHGRARDVMTLAHELGHGVHQVLAAR-QGYLMAATPLTLAETASVFGEMLTF 443

Query: 456 DSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIW 515
            +LL A S  + R+++LA K+EDMLN++VRQI+F+ FE +LH  RR  G++    I+ IW
Sbjct: 444 RALLDAESDPQRRRLMLAQKVEDMLNTVVRQIAFHQFEQRLHAARRR-GELLPDEISAIW 502

Query: 516 LETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDC 575
           +  Q+ESLGPAF+ SD +Y  FW  VPHF+ S FYVYAYAFG+CLVN+LY +Y+      
Sbjct: 503 IGVQRESLGPAFEFSD-DYRMFWAYVPHFVHSPFYVYAYAFGDCLVNALYGVYRDQAARG 561

Query: 576 ----FKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVE 624
               F  +YL++L AG ++ + ELL P  ++ SDP FW RGL  +   ID++E
Sbjct: 562 AGADFVARYLDMLAAGGTRRHRELLAPFGLDASDPAFWRRGLDVIAGFIDELE 614


>gi|84500888|ref|ZP_00999123.1| oligoendopeptidase F [Oceanicola batsensis HTCC2597]
 gi|84390955|gb|EAQ03373.1| oligoendopeptidase F [Oceanicola batsensis HTCC2597]
          Length = 606

 Score =  537 bits (1384), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 269/604 (44%), Positives = 375/604 (62%), Gaps = 9/604 (1%)

Query: 23  DMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           D        +LG LP W+L DLY S +   I  D++ +     +F   +EG L    +Q 
Sbjct: 10  DANATSGGRDLGKLPEWDLTDLYASPEDPAIERDLDWLREACASFAADYEGKL----DQL 65

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
           +   +   I   E +  + GR+ SYA L Y    +     KF +D+  ++  +   L+FF
Sbjct: 66  DAEGMLTCIRRDEELTTVSGRLMSYAGLRYYQVTTDGARAKFMSDMQDRITTYTTPLVFF 125

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
            LE+N L +  L+  +A      +Y      IR +K + LS++ME  L D   VG +A +
Sbjct: 126 TLELNRLPDDRLDSLFAASDDLARYKPIFDRIRAMKPYQLSDEMEKFLHDMGVVG-DAWE 184

Query: 203 RFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNT 262
           + F E +  L F I+ +++ L        + DR+ R++AA+ ++     +   F+ + NT
Sbjct: 185 KLFDETVAGLTFTIDGEELGLEATTTLLTEPDRDKREAAAREIARVLGANIRTFARVHNT 244

Query: 263 LAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKL 322
            AK++E+ DRWR       +RHLSN+VEP V+EAL  +V   YP+ SHRYYELK+KWL L
Sbjct: 245 QAKEKEVMDRWRGMPSAQTARHLSNHVEPEVVEALRNAVVAAYPRLSHRYYELKRKWLGL 304

Query: 323 DTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDG 382
           D M  WDR APLP      + ++ A+++V+ +YA F P+M+ +AE FFT  WIDA    G
Sbjct: 305 DRMQVWDRNAPLPIEPPRTVDWDTAQEMVMSAYAGFDPRMANLAEPFFTRGWIDAGVKPG 364

Query: 383 KGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTL 442
           K  GAFAH T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H VL+++ QG L +++ LTL
Sbjct: 365 KAPGAFAHPTVTTVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAD-QGELLSSTPLTL 423

Query: 443 AETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRS 502
           AETAS+FGE LTF  LL  A S  ERK LLA K+EDM+N++VRQI+FYDFE KLH  RR 
Sbjct: 424 AETASVFGEMLTFRKLLDEAKSDAERKTLLAGKVEDMINTVVRQIAFYDFECKLHAARRE 483

Query: 503 TGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVN 562
            G++    IN IW+  Q ESLGPAFD  D  Y  FW  +PHFI S FYVYAYAFG+ LVN
Sbjct: 484 -GELTPEDINAIWMSVQAESLGPAFDFMD-GYEVFWSYIPHFIHSPFYVYAYAFGDGLVN 541

Query: 563 SLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
           +LY  Y+    + F++KY ++LRAG SKH+ ELL P  ++ SDP FW++GL  +E  ID+
Sbjct: 542 ALYAAYQ-EAPEGFQDKYFDMLRAGGSKHHKELLAPFGLDASDPKFWDKGLSMIEGFIDE 600

Query: 623 VEKM 626
           +E M
Sbjct: 601 LEAM 604


>gi|260427147|ref|ZP_05781126.1| putative oligoendopeptidase F [Citreicella sp. SE45]
 gi|260421639|gb|EEX14890.1| putative oligoendopeptidase F [Citreicella sp. SE45]
          Length = 609

 Score =  537 bits (1383), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 273/613 (44%), Positives = 383/613 (62%), Gaps = 11/613 (1%)

Query: 15  FRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGN 74
           F ++L   D        +LG+LP W+L DLY + D+ E+  D++ +E     F   +E  
Sbjct: 5   FPRSLPVFDANASAKGRDLGDLPEWDLSDLYTAPDAPELKRDLDWLEDACARFAADYESQ 64

Query: 75  LAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLAD 134
           LA      +       +  +E+I  + GR+ SYA L Y    +     KF +D+  K+  
Sbjct: 65  LAGL----DAAGFLEMVQRHEKIETVGGRLMSYAGLRYYQATTDAERAKFLSDLQEKVTI 120

Query: 135 FEKVLIFFALEINTL-DEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDT 193
           +   L+FF LE+NT+ D+A      A D L  +Y      IR +K + LS+++E  L D 
Sbjct: 121 YTTPLVFFTLELNTIEDDAYAALFTASDELA-RYKPAFDRIRAMKPYQLSDELERFLHDM 179

Query: 194 SQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSS 253
             VG +A  + F E I  L F I+D+++P+        + DR  R++AA  L+  F ++ 
Sbjct: 180 GVVG-DAWMKLFDETIAGLSFTIDDEELPIESTLTLLTEQDRSKREAAAHELARVFGENI 238

Query: 254 HIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY 313
             F+ + NT AK++EI DRWR        RHLSN+VEP V+EAL  +V   YP+ SHRYY
Sbjct: 239 RTFARVHNTQAKEKEIMDRWRGMPSAQMGRHLSNDVEPEVVEALRDAVVAAYPRLSHRYY 298

Query: 314 ELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHN 373
           ELK+KWL LD M  WDR APLP  S  I+ ++ AR  V  +YA F P+M+ IAE FFT  
Sbjct: 299 ELKRKWLGLDVMQVWDRNAPLPMESDRIVGWDEARKTVTDAYAGFDPRMAEIAEPFFTKG 358

Query: 374 WIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGI 433
           WIDA    GK  GAFAH T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG 
Sbjct: 359 WIDAAVKPGKAPGAFAHPTVTEVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGE 417

Query: 434 LTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFE 493
           +  ++ LTLAETAS+FGE LTF ++L  A  ++ERK++LA K+EDM+N++VRQI+FYDFE
Sbjct: 418 MLASTPLTLAETASVFGEMLTFRAMLDTAKDQKERKVMLAGKVEDMINTVVRQIAFYDFE 477

Query: 494 LKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYA 553
            KLH  RR  G++    IN +W+  Q ESLGPAF+     Y +FW  +PHF+ S FYVYA
Sbjct: 478 CKLHEARRG-GELTPDDINALWMSVQAESLGPAFEYMP-GYETFWAYIPHFVHSPFYVYA 535

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YAFG+ LVN+LY +Y+ +  + F++KY ++L+AG SKH+  LL P  ++ SDP FW++GL
Sbjct: 536 YAFGDGLVNALYAVYQESP-EGFEDKYFDMLKAGGSKHHKALLAPFGLDASDPTFWDKGL 594

Query: 614 QTVEKMIDDVEKM 626
             +E  ID++E M
Sbjct: 595 SMIEGFIDELEAM 607


>gi|99080410|ref|YP_612564.1| peptidase M3B, oligoendopeptidase-related clade 3 [Ruegeria sp.
           TM1040]
 gi|99036690|gb|ABF63302.1| Peptidase M3B oligoendopeptidase-related clade 3 [Ruegeria sp.
           TM1040]
          Length = 606

 Score =  536 bits (1381), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 269/604 (44%), Positives = 386/604 (63%), Gaps = 9/604 (1%)

Query: 23  DMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           D        +LG LP W+L DLY   D+ E+S D++ ++ E  AF   +EG LA    + 
Sbjct: 10  DANASSGAGDLGKLPEWDLSDLYAGEDAAELSRDLDWLQGECAAFAADYEGKLA----EL 65

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
           +   L   +   E+I  + GRI SYA L Y    +     KF +D+  K+  F   L+FF
Sbjct: 66  DAEGLLTCVHRNEKINNIAGRIMSYAGLRYYQLTTDADRAKFLSDVQEKVTVFTTPLVFF 125

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
            LEIN +++A L+  +  +    +Y      IR +K + LS+++E  + D   VG +A +
Sbjct: 126 TLEINRIEDAKLDALFEANADLARYKPVFDRIRAMKPYQLSDELERFMHDLGIVG-DAWE 184

Query: 203 RFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNT 262
           + F E I  L F+I  +++ +        + DR  R++AA+ L+  F  +  IF+ + NT
Sbjct: 185 KLFDETIAGLTFEIEGEELGIEATLNFLTEQDRSKREAAARELARVFADNIKIFARVHNT 244

Query: 263 LAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKL 322
            AK++EI DRWR        RHLSN+VEP V+EAL ++V   YPK SHRYYELK+KWL L
Sbjct: 245 QAKEKEIIDRWRGMPSPQMGRHLSNDVEPEVVEALREAVVAAYPKLSHRYYELKRKWLGL 304

Query: 323 DTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDG 382
           D M  WDR APLP  +  ++ +E AR  V+++Y  F P+M  +A+ FF   WIDA    G
Sbjct: 305 DRMQVWDRNAPLPMETTRVVDWEEARATVMEAYEAFDPRMGELAQPFFDKGWIDAGVKPG 364

Query: 383 KGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTL 442
           K  GAFAH T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H VL+++ QG + +++ LTL
Sbjct: 365 KAPGAFAHPTVTNVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAD-QGEMLSSTPLTL 423

Query: 443 AETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRS 502
           AETAS+FGE LTF  +L+ A +KEERK+LLA K+EDM+N++VRQI+FYDFE KLH   R+
Sbjct: 424 AETASVFGEMLTFRKMLEKAQTKEERKVLLAGKVEDMINTVVRQIAFYDFECKLHAA-RA 482

Query: 503 TGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVN 562
            G++    IN +W+  Q ESLG +FD  +  Y +FW  +PHF+ S FYVYAYAFG+ LVN
Sbjct: 483 EGELTPEDINALWMSVQAESLGESFDFME-GYETFWAYIPHFVHSPFYVYAYAFGDGLVN 541

Query: 563 SLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
           +LY +Y +   + F++KY ++L+AG SKH+ ELL P  ++ SDP FW++GL  +  +ID+
Sbjct: 542 ALYSVY-AEGAEGFEDKYFDMLKAGGSKHHKELLAPFGLDASDPKFWDKGLSMISGLIDE 600

Query: 623 VEKM 626
           +E M
Sbjct: 601 LEAM 604


>gi|146277609|ref|YP_001167768.1| pepF/M3 family oligoendopeptidase [Rhodobacter sphaeroides ATCC
           17025]
 gi|145555850|gb|ABP70463.1| oligoendopeptidase, pepF/M3 family [Rhodobacter sphaeroides ATCC
           17025]
          Length = 606

 Score =  535 bits (1379), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 275/598 (45%), Positives = 373/598 (62%), Gaps = 8/598 (1%)

Query: 29  SQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG 88
           S   LGNLP W+L DLYP+ D+ E+  DM  ++     F   +EG LA      +   L 
Sbjct: 15  SAGGLGNLPEWDLRDLYPAPDAAEVGQDMAWLKSACADFAATYEGKLA----SLDAAGLL 70

Query: 89  AAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINT 148
             +  YE+I    GR+ SYA L Y  N       KF  D   K+ D+   L+FF+LE N 
Sbjct: 71  TCVETYEKIDITAGRLMSYAGLRYYQNTMDSERAKFMADAQDKVTDYTTALVFFSLEFNR 130

Query: 149 LDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCEN 208
           LD+A LE   A+ P   +Y      +R ++ H LS+++E  L D S VG  A  R F E 
Sbjct: 131 LDDAHLESRLAESPALARYRPVFDRMRAMRPHQLSDELERFLHDQSTVGAAAWNRLFDET 190

Query: 209 IESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEE 268
           +  L F I  +++ L        D +R  R++AA+AL+  F     +F+ + NTLAK++E
Sbjct: 191 MAGLTFTIEGEELNLESTLNLLTDPERSRREAAARALADVFGGHIKLFARVHNTLAKEKE 250

Query: 269 IQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFW 328
           I DRWRK       RHL+N+VEP V+EAL  +V   YPK SHRYY LK KW+ LD +  W
Sbjct: 251 IHDRWRKMPTPQYGRHLANHVEPEVVEALRNAVVAAYPKLSHRYYRLKAKWMGLDKLQVW 310

Query: 329 DRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAF 388
           DR APLP  +  ++ +  A+  VL++Y+ F P+M+ IA+ FF   WIDA    GK  GAF
Sbjct: 311 DRNAPLPIETPRLVDWTEAQATVLEAYSAFDPRMAEIAQPFFDKGWIDAGVKPGKAPGAF 370

Query: 389 AHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASI 448
           AH T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG L +++ LTLAETAS+
Sbjct: 371 AHPTVTTVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGELLSSTPLTLAETASV 429

Query: 449 FGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPT 508
           FGE LTF  LL AA +  ERK LLA K+EDM+N++VRQI+FYDFE KLH  RR  G++  
Sbjct: 430 FGEMLTFRKLLDAARTPAERKTLLAGKVEDMINTVVRQIAFYDFECKLHEARRQ-GELTP 488

Query: 509 HRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIY 568
             IN +W+  Q +SLG AF+  +  Y +FW  +PHF+ S FYVYAYAFG+ LVN+LY +Y
Sbjct: 489 EDINALWMSVQAQSLGDAFEFME-GYETFWSYIPHFVHSPFYVYAYAFGDGLVNALYAVY 547

Query: 569 KSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
                + F++KY  +L AG SKH+ ELL P  ++ SDP FW++GL  +   ID++E M
Sbjct: 548 AEGG-EGFEDKYFEMLAAGGSKHHKELLAPFGLDASDPTFWDKGLSMIAGFIDELEAM 604


>gi|89070420|ref|ZP_01157722.1| Oligoendopeptidase F [Oceanicola granulosus HTCC2516]
 gi|89043986|gb|EAR50163.1| Oligoendopeptidase F [Oceanicola granulosus HTCC2516]
          Length = 604

 Score =  535 bits (1379), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 264/595 (44%), Positives = 378/595 (63%), Gaps = 8/595 (1%)

Query: 32  NLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAI 91
           +LG+LP W+L DLY + D+ E+  D++ +E     F   +EG LA  +     H +  A+
Sbjct: 16  DLGDLPEWDLSDLYEAADAPELKRDLDWLEQACADFARDYEGKLADLS----AHQMLEAV 71

Query: 92  AEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDE 151
             YE+I  + GRI S+A L Y    +     KF +D   +L  +   L+F++LE N L +
Sbjct: 72  TRYEKIDVVSGRIMSFAGLRYYQQTTDAERAKFLSDCQDRLTTYTTPLVFWSLEFNRLSD 131

Query: 152 ALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIES 211
             +EQ  ++     +Y   I+ +R ++ + LS+++E  L D S VG  A  + F E I  
Sbjct: 132 ERVEQLLSESAELDRYRPVIERMRAMRPYQLSDELEKFLHDQSVVGASAWNKLFDETIAG 191

Query: 212 LRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
           L F+++ + + +        + DR  R++  +ALS  F  +   F+ + NTL K++EI+D
Sbjct: 192 LTFEVDGETLGIEATLNLLTEQDRAKREAGFRALSEVFGANVRTFARVHNTLTKEKEIED 251

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRL 331
           RWR        RHL+N+VEP V+EAL  +V   YP+ SHRYY LK KWL L+ +  WDR 
Sbjct: 252 RWRGMPTPQTGRHLANHVEPEVVEALRDAVVAAYPRLSHRYYALKAKWLGLERLQVWDRN 311

Query: 332 APLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHG 391
           APLP  S  I+ ++ AR  V  +YA F P+M+ +A  FF   WIDA    GK  GAFAH 
Sbjct: 312 APLPMESDRIVGWDEARATVSDAYADFDPRMADLARPFFDKGWIDAGVKPGKAPGAFAHP 371

Query: 392 TIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE 451
           T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL+++ QG L +++ LTLAETAS+FGE
Sbjct: 372 TVTEVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAD-QGELLSSTPLTLAETASVFGE 430

Query: 452 TLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRI 511
            LTF  LL+ A S  ERK+LLA K+EDM+N++VRQI+FYDFE KLH  RR  G++    I
Sbjct: 431 MLTFRKLLREAPSDAERKVLLAGKVEDMINTVVRQIAFYDFECKLHEARRG-GELTPDDI 489

Query: 512 NEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSN 571
           N +W+  Q ESLGP FD ++  Y +FW  +PHF+ S FYVYAYAFG+ LVN+LY +Y+ +
Sbjct: 490 NALWMSVQAESLGPVFDFAE-GYETFWAYIPHFVHSPFYVYAYAFGDGLVNALYAVYEES 548

Query: 572 TVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
             + F +KY  +L+AG SKH+ +LL P  ++ SDP FW +GL  +E +ID++E+M
Sbjct: 549 G-ESFNDKYFAMLKAGGSKHHKDLLAPFGLDASDPAFWNKGLAMIEGLIDELERM 602


>gi|126461844|ref|YP_001042958.1| pepF/M3 family oligoendopeptidase [Rhodobacter sphaeroides ATCC
           17029]
 gi|126103508|gb|ABN76186.1| oligoendopeptidase, pepF/M3 family [Rhodobacter sphaeroides ATCC
           17029]
          Length = 606

 Score =  535 bits (1378), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 276/598 (46%), Positives = 375/598 (62%), Gaps = 8/598 (1%)

Query: 29  SQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG 88
           S   LGNLP W+L DLYP+ D  E  +DM  ++     F   +EG LA      +   L 
Sbjct: 15  SAGGLGNLPDWDLRDLYPTPDGPEFRDDMAWLKEACAGFAASYEGKLA----SLDAAGLL 70

Query: 89  AAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINT 148
           A I  YE+I  + GR+ SYA L Y  N       KF  D   K+ D    L+FF+LE N 
Sbjct: 71  ACIEAYEKIDIVAGRLMSYAGLRYYQNTMDSERAKFMADAQDKVTDSTTALVFFSLEFNR 130

Query: 149 LDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCEN 208
           L++A LE   A+     +Y      +R ++ H LS+++E  L D S VG  A  R F E 
Sbjct: 131 LEDAHLEARLAESAALARYKPVFDRMRAMRPHQLSDELERFLHDESTVGAAAWNRLFDET 190

Query: 209 IESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEE 268
           +  L F +  +++ L        D +R  R++AA+AL+  F ++  +F+ + NTLAK++E
Sbjct: 191 MAGLTFTLEGEELNLESTLNLLTDPERPRREAAARALAEVFGRNIKLFARVHNTLAKEKE 250

Query: 269 IQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFW 328
           I DRWRK       RHL+N+VEP V+EAL  +V   YPK SHRYY LK KWL L+ +  W
Sbjct: 251 IHDRWRKMPTPQYGRHLANHVEPEVVEALRNAVVAAYPKLSHRYYRLKAKWLGLEKLQVW 310

Query: 329 DRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAF 388
           DR APLP  +  ++ ++ A+  V+++Y+ F P+M+ IA+ FF   WIDA    GK  GAF
Sbjct: 311 DRNAPLPTETPRLVGWDEAQSTVMEAYSAFDPRMAEIAKPFFEKGWIDAGVKPGKAPGAF 370

Query: 389 AHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASI 448
           AH T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG L +++ LTLAETAS+
Sbjct: 371 AHPTVTTVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGELLSSTPLTLAETASV 429

Query: 449 FGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPT 508
           FGE LTF  LL AA +  ERK LLA K+EDM+N++VRQI+FYDFE KLH  RR  G++  
Sbjct: 430 FGEMLTFRKLLDAARTPAERKTLLAGKVEDMINTVVRQIAFYDFECKLHEARRQ-GELTP 488

Query: 509 HRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIY 568
             IN +W+  Q ESLG AF+  +  Y +FW  VPHF+ S FYVYAYAFG+ LVN+LY +Y
Sbjct: 489 EDINALWMSVQAESLGDAFEFME-GYETFWSYVPHFVHSPFYVYAYAFGDGLVNALYAVY 547

Query: 569 KSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              T   F++KY  +L AG SKH+ ELL P  ++ SDP FW++GL  +   ID++E M
Sbjct: 548 AEGT-PGFQDKYFEMLSAGGSKHHKELLAPFGLDASDPTFWDKGLSMIAGFIDELEAM 604


>gi|254462329|ref|ZP_05075745.1| oligoendopeptidase F [Rhodobacterales bacterium HTCC2083]
 gi|206678918|gb|EDZ43405.1| oligoendopeptidase F [Rhodobacteraceae bacterium HTCC2083]
          Length = 609

 Score =  535 bits (1377), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 268/616 (43%), Positives = 384/616 (62%), Gaps = 13/616 (2%)

Query: 13  AFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWE 72
           + F+      D       + LGNLP W+L DLY   ++ E+  D++ +E    +F   +E
Sbjct: 4   SMFQLPFPVRDANAGGGPDPLGNLPEWDLSDLYSDENAPELKRDLDWLEEACASFARDFE 63

Query: 73  GNLAH--ATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINA 130
           G LA+  A    +C      +   ERI  + GRI S+A L Y    +     KF +D+  
Sbjct: 64  GKLANLDAAELLDC------VLRNERINSIAGRIMSFAGLRYYQLTTDADRAKFMSDMQE 117

Query: 131 KLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLL 190
           K+ +F   L+FF LE+N L++  L+  +A +    +Y      IR +K + LS+++E  L
Sbjct: 118 KITNFTTPLVFFTLELNRLEDTQLDAHFAANTDLARYKPVFDRIRAMKPYQLSDELEKFL 177

Query: 191 SDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFN 250
            D   VG +A +R F E I  L F+++ + + +        + DR  R++A++ ++    
Sbjct: 178 HDLGVVG-DAWERLFDETIAGLSFEVDGKTLNIEGTLNLLTEHDRSKREAASREVARVLG 236

Query: 251 KSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSH 310
           ++   F+ + NT AK++EI DRWR  E     RHLSN+VEP V+EAL  +V   YPK SH
Sbjct: 237 ENVKTFARVHNTQAKEKEIIDRWRGMETPQTGRHLSNHVEPEVVEALRTAVVEAYPKLSH 296

Query: 311 RYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFF 370
           RYYE+K+ WL L+ M  WDR APLP  +  I+ ++ A   V+ +Y  F P+M  IA+ FF
Sbjct: 297 RYYEMKRGWLGLERMEVWDRNAPLPMENTAIVGWDAAEATVMDAYNAFDPRMGEIAKPFF 356

Query: 371 THNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSET 430
              WIDA    GK  GAFAH T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  
Sbjct: 357 RKGWIDAGVKPGKAPGAFAHPTVTDVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-G 415

Query: 431 QGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFY 490
           QG + +++ LTLAETAS+FGE LTF  +L+ A ++ ERKILLA K+EDM+N++VRQI+FY
Sbjct: 416 QGEMLSSTPLTLAETASVFGEMLTFQKMLEKAETQAERKILLAGKVEDMINTVVRQIAFY 475

Query: 491 DFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFY 550
           DFE KLH  RR  G++    IN +W+  Q ESLGPAFD  D  Y +FW  +PHF+ S FY
Sbjct: 476 DFECKLHDARRG-GELTPEDINALWMSVQAESLGPAFDFVD-GYETFWAYIPHFVHSPFY 533

Query: 551 VYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWE 610
           VYAYAFG+ LVN+LY +Y+    + F+EKY ++L+AG SKH+ +LL P  ++ SDP FW+
Sbjct: 534 VYAYAFGDGLVNALYAVYREGD-EGFEEKYFDMLKAGGSKHHKDLLAPFGLDASDPKFWD 592

Query: 611 RGLQTVEKMIDDVEKM 626
           +GL  +  MID++E M
Sbjct: 593 KGLSMISGMIDELEAM 608


>gi|114764930|ref|ZP_01444103.1| oligoendopeptidase F [Pelagibaca bermudensis HTCC2601]
 gi|114542642|gb|EAU45666.1| oligoendopeptidase F [Roseovarius sp. HTCC2601]
          Length = 608

 Score =  534 bits (1376), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 264/595 (44%), Positives = 377/595 (63%), Gaps = 9/595 (1%)

Query: 32  NLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAI 91
           +LG LP W+L DLY   D+ E+  D++ +E     F   +EG +A      +       +
Sbjct: 21  DLGKLPEWDLSDLYEGQDAPELKRDLDWLEDACARFAQDFEGKIAGL----DAAGFLEMV 76

Query: 92  AEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDE 151
             +E+I  + GR+ S+A L Y  N       KF +D+  K+  +   L+FF+LE+NT+++
Sbjct: 77  QRHEKIEAVGGRLMSFAGLRYYQNTMDSERAKFLSDLQEKVTIYTTPLVFFSLELNTVED 136

Query: 152 ALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIES 211
                 +  +    +Y      IR +K + LS+++E  L D   VG +A  + F E I  
Sbjct: 137 DAYSALFEANDELARYKPAFDRIRAMKPYQLSDELERFLHDMGVVG-DAWMKLFDETIAG 195

Query: 212 LRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
           L F I+ +++ +  A     + DR  R++AA+ L+  F ++   F+ + NT AK++E+ D
Sbjct: 196 LTFTIDGEEMSIEAALNFLTEQDRSKREAAARELARVFGENIRTFARVHNTQAKEKEVMD 255

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRL 331
           RWR        RHLSN+VEP V+EAL  +V   YP+ SHRYYELK+KWL L+TM  WDR 
Sbjct: 256 RWRGMPSAQMGRHLSNDVEPEVVEALRDAVVAAYPRLSHRYYELKRKWLGLETMQVWDRN 315

Query: 332 APLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHG 391
           APLP  S  I+ ++ ARD V+Q+YA F P+M+ IA  FF   WIDA    GK  GAFAH 
Sbjct: 316 APLPMESTRIVGWDEARDTVMQAYAGFDPRMAEIAAPFFDKGWIDAGVKPGKAPGAFAHP 375

Query: 392 TIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE 451
           T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG +  ++ LTLAETAS+FGE
Sbjct: 376 TVTDVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGEMLASTPLTLAETASVFGE 434

Query: 452 TLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRI 511
            LTF ++L  A+  +ERK+LLA K+EDM+N++VRQI+FYDFE KLH  RR  G++    I
Sbjct: 435 MLTFRAMLDKATDPKERKVLLAGKVEDMINTVVRQIAFYDFECKLHEARRG-GELTPDDI 493

Query: 512 NEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSN 571
           N +W+  Q ESLGP F+  +  Y SFW  +PHF+ S FYVYAYAFG+ LVN+LY +Y+ +
Sbjct: 494 NALWMSVQAESLGPCFEFME-GYESFWAYIPHFVHSPFYVYAYAFGDGLVNALYAVYQED 552

Query: 572 TVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
               F++KY ++L+AG SKH+  LL P  ++ SDP FW++GL  +E  ID++E M
Sbjct: 553 PA-GFEDKYFDMLKAGGSKHHKALLAPFGLDASDPRFWDKGLSMIEGFIDELEAM 606


>gi|89055883|ref|YP_511334.1| peptidase M3B, oligoendopeptidase-related clade 3 [Jannaschia sp.
           CCS1]
 gi|88865432|gb|ABD56309.1| Peptidase M3B oligoendopeptidase-related clade 3 [Jannaschia sp.
           CCS1]
          Length = 607

 Score =  534 bits (1375), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 263/594 (44%), Positives = 373/594 (62%), Gaps = 8/594 (1%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           L  LP W+L DLY   D+  +  D++ +E    +F   +EG LA      +   L     
Sbjct: 21  LEGLPVWDLSDLYEGQDAASLKRDLDWLEEACQSFAADYEGKLA----DLDADGLLDCTL 76

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
            YE+I  + GRI S+A L Y    +     KF +D+  K+  +   L+FF+LE N +++A
Sbjct: 77  RYEKIDMIAGRIMSFAGLRYYQKTTDGERAKFMSDMQDKITTYTTPLVFFSLEFNRIEDA 136

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
             +    ++    +Y      +R +K + LS+++E  L DTS VG  A  + F E I  L
Sbjct: 137 QYDAMMDKNADLARYKPVFDRMRAMKPYQLSDELEKFLHDTSVVGASAWNKLFDEQIAGL 196

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
            F ++ + + +        DSDR  R++ AKAL+  F  ++ +F+ + NTLAK++EI DR
Sbjct: 197 TFDVDGESLGIEATLNLMTDSDRARREAGAKALAEKFEDTAPLFARVHNTLAKEKEIGDR 256

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR        RHL+N+VEP V+EAL  +V   YP+ SHRYY+LK KW+ L+ M  WDR A
Sbjct: 257 WRGLPSPQAGRHLANHVEPEVVEALRNAVVKAYPRLSHRYYKLKAKWMGLEKMEVWDRNA 316

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP +   I+ ++ AR +V ++YA F P+M+ +AE FFT  WIDA   +GK  GAFAH T
Sbjct: 317 PLPMSEDRIVGWDEARRVVSEAYAGFDPRMAELAEPFFTDGWIDAGVKEGKAPGAFAHPT 376

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +  VHPY++LNYLGKP+DVMTLAHELGHG+H  L++  QG + +++ LTLAETAS+FGE 
Sbjct: 377 VTDVHPYVMLNYLGKPRDVMTLAHELGHGVHQRLAA-AQGEMLSSTPLTLAETASVFGEM 435

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF  +L  A     RK++LA K+EDM+N++VRQI+FYDFE KLH  RR  G++    IN
Sbjct: 436 LTFRKMLSEAKDDATRKVMLAGKVEDMINTVVRQIAFYDFECKLHDARRG-GELTVDDIN 494

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
            +W+  Q ESLGP F+  D  Y +FW  +PHF+ S FYVYAYAFG+ LVN+LY +Y    
Sbjct: 495 ALWMSVQGESLGPVFNFMD-GYETFWAYIPHFVHSPFYVYAYAFGDGLVNALYAVYAEGN 553

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + F+EKY ++LRAG SKH+ ELL P  ++ SDP FW++GL  +E  ID++E M
Sbjct: 554 -EGFEEKYFDMLRAGGSKHHKELLAPFGLDASDPAFWDKGLSMIEGFIDELEAM 606


>gi|260575503|ref|ZP_05843502.1| oligoendopeptidase, pepF/M3 family [Rhodobacter sp. SW2]
 gi|259022423|gb|EEW25720.1| oligoendopeptidase, pepF/M3 family [Rhodobacter sp. SW2]
          Length = 606

 Score =  532 bits (1370), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 273/598 (45%), Positives = 375/598 (62%), Gaps = 8/598 (1%)

Query: 29  SQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG 88
           +    G+LP W+L DLYPS ++ +++ D+  +E   +AF+   +G LA  +  +      
Sbjct: 15  AAAGFGDLPEWDLTDLYPSPEAPQLAADLAFVERAVVAFEAAHKGKLASLSADQML---- 70

Query: 89  AAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINT 148
           A + +YE I    GR+ SYA L Y  N       KF  D+  K+  F   ++FF+LE N 
Sbjct: 71  ACVQDYEAIDIAAGRLMSYAGLRYYQNTMDSDRAKFMADMQDKITTFTTPMVFFSLEFNR 130

Query: 149 LDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCEN 208
           LDE  L    A +    +Y      +R ++ + LS+++E  L D S VG  A  R F E 
Sbjct: 131 LDENHLAGLLAANEALARYKPVFDRMRAMRPYQLSDELETFLHDESVVGASAWNRLFDET 190

Query: 209 IESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEE 268
           +  L F   ++ + L        D DR  R++AA+AL+  F +   +FS I NTLAK++E
Sbjct: 191 MAGLTFTPENETLSLEATLNLLTDPDRARREAAARALAKVFERDIKLFSRIHNTLAKEKE 250

Query: 269 IQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFW 328
           I DRWRK       RHLSN+VEP V+EAL  +V   YP+ SHRYY LK KWL L+ M  W
Sbjct: 251 IHDRWRKMPTPQTGRHLSNHVEPEVVEALRNAVVAAYPRLSHRYYALKAKWLGLERMQVW 310

Query: 329 DRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAF 388
           DR APLP  S  ++ ++ AR  V  +YA F P+M+ ++E FF+  WIDA    GK  GAF
Sbjct: 311 DRNAPLPQESPKLVDWDTARQTVQAAYASFDPRMAALSEPFFSKGWIDAGVKPGKAPGAF 370

Query: 389 AHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASI 448
           AH T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG L +++ LTLAETAS+
Sbjct: 371 AHPTVTTVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-AQGELLSSTPLTLAETASV 429

Query: 449 FGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPT 508
           FGE LTF  LL  AS+  ERK LLA K+EDM+N++VRQI+FYDFE KLH   R+ G++  
Sbjct: 430 FGEMLTFRKLLDGASTPAERKTLLAGKVEDMINTVVRQIAFYDFECKLHAA-RAQGELTP 488

Query: 509 HRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIY 568
             IN +W+  Q ESLGP FD     Y +FW  +PHF+ S FYVYAYAFG+ LVN+LY  Y
Sbjct: 489 DDINALWMSVQAESLGPVFDFMP-GYETFWAYIPHFVHSPFYVYAYAFGDGLVNALYAAY 547

Query: 569 KSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            ++ +  F+EKY ++L+AG SKH+ ELL P  ++ SDP FW++GL  +   ID++E M
Sbjct: 548 -ADGLPGFQEKYFDMLKAGGSKHHKELLAPFGLDASDPKFWDKGLSMIAGFIDELEAM 604


>gi|159045143|ref|YP_001533937.1| oligoendopeptidase [Dinoroseobacter shibae DFL 12]
 gi|157912903|gb|ABV94336.1| oligoendopeptidase [Dinoroseobacter shibae DFL 12]
          Length = 611

 Score =  531 bits (1368), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 274/606 (45%), Positives = 377/606 (62%), Gaps = 12/606 (1%)

Query: 23  DMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAH--ATN 80
           D  T    +NLG LP W+L DLYP+ D+ EI  DM+ +E     F   +EG LA   A  
Sbjct: 14  DAATDTGGKNLGALPDWDLSDLYPAPDAPEIKRDMDWLEAACRDFAADYEGKLADLDAAG 73

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
             +C      +  YERI  + GR+ SY  L Y  N +     K   D   K+  +   L+
Sbjct: 74  MLDC------VLRYERIDTVSGRLMSYMGLRYYQNTTDAERAKAMADAQDKITTYTTPLV 127

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           F+ LEIN L +  L+  +A +    +Y      +R +K + LS+++E  L D+S VG  A
Sbjct: 128 FYTLEINRLPDDHLDGLFAANADLARYKPIFDRLRAMKPYQLSDELEKFLHDSSTVGAAA 187

Query: 201 LKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFIT 260
             R F E I  + F+++ +   +        + +R+ R++AA+ L+  F     +F+ + 
Sbjct: 188 WNRLFDETIAGMMFEVDGEAYNIEGTLNFLSEPERDKREAAARELAAQFGSQIKLFARVH 247

Query: 261 NTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWL 320
           NTLAK++EI DRWR        RHL+N+VEP V+EAL  +V   YPK SHRYY LK KW+
Sbjct: 248 NTLAKEKEITDRWRGLPTPQAGRHLANHVEPEVVEALRNAVVAAYPKLSHRYYALKAKWM 307

Query: 321 KLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQY 380
            LD M  WDR APLP     I+ ++ A+  VL++YA F P+M+ IAE FF   WIDA   
Sbjct: 308 GLDKMQVWDRNAPLPREDNRIVDWDEAKATVLEAYADFDPEMARIAEPFFDRGWIDAGVK 367

Query: 381 DGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSL 440
            GK  GAFAH T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG L +++ L
Sbjct: 368 PGKAPGAFAHPTVAEVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGELLSSTPL 426

Query: 441 TLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTER 500
           TLAETAS+FGE LTF  LL AA  K  RKILLA K+EDM+N++VRQI+FYDFE KLH  R
Sbjct: 427 TLAETASVFGEMLTFRKLLDAAPDKATRKILLAGKVEDMINTVVRQIAFYDFECKLHDAR 486

Query: 501 RSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCL 560
           ++ G++    I ++W+  Q ESLGP F+  D  Y +FW  +PHF+ S FYVYAYAFG+ L
Sbjct: 487 KA-GELTPDEIGDLWMSVQGESLGPVFEFMD-GYETFWAYIPHFVHSPFYVYAYAFGDGL 544

Query: 561 VNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMI 620
           VN+LY +Y+    D F+ KY ++L+AG SKH+ +LL P  ++ SDP FW++GL  +  MI
Sbjct: 545 VNALYAVYEEGDPD-FRTKYFDMLKAGGSKHHKDLLEPFGLDASDPAFWDKGLSMISGMI 603

Query: 621 DDVEKM 626
           D++E M
Sbjct: 604 DELEAM 609


>gi|254464700|ref|ZP_05078111.1| oligoendopeptidase F [Rhodobacterales bacterium Y4I]
 gi|206685608|gb|EDZ46090.1| oligoendopeptidase F [Rhodobacterales bacterium Y4I]
          Length = 606

 Score =  530 bits (1365), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 266/613 (43%), Positives = 382/613 (62%), Gaps = 9/613 (1%)

Query: 14  FFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEG 73
            F+      D         LGNLP W+L DLY S D+ E++ D++ ++ E  AF   +EG
Sbjct: 1   MFQLPFPVRDANATAGSGGLGNLPVWDLSDLYASEDAPELARDLDWLQKECAAFAADYEG 60

Query: 74  NLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA 133
            LA      +   L   +   E+I  + GRI S+A L Y    +      F +D   K+ 
Sbjct: 61  KLA----DLDADGLLECVQRNEKINNIAGRIMSFAGLRYYQLTTDADRAAFLSDCQEKVT 116

Query: 134 DFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDT 193
                L+FF LE+N +++  ++     +    +Y++  + IR +K + LS+++E  + D 
Sbjct: 117 IATTPLVFFTLELNRIEDDAMQAHLNANEDLARYASVFRRIRAMKPYQLSDELEKFMHDL 176

Query: 194 SQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSS 253
             VG +A ++ F E I  L F ++ +++ +        + DR  R++AA+ L+  F ++ 
Sbjct: 177 GIVG-DAWEKLFDETIAGLTFTVDGEELNIEGTLNLLTEQDRSKREAAARELARVFGENI 235

Query: 254 HIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY 313
             F+ + NT AK++EI DRWR        RHLSN+VEP V+EAL ++V   YPK SHRYY
Sbjct: 236 KTFARVHNTQAKEKEIIDRWRGMPSPQTGRHLSNDVEPEVVEALREAVVAAYPKLSHRYY 295

Query: 314 ELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHN 373
           ELK+KWL LD M  WDR APLP     II ++ A + V+++Y  F P+M  IA  FF+  
Sbjct: 296 ELKRKWLGLDVMQVWDRNAPLPLEDSRIIGWDEAENTVMEAYEAFDPRMGEIAAPFFSDG 355

Query: 374 WIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGI 433
           WIDA    GK  GAFAH T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H VL++E QG 
Sbjct: 356 WIDAGVKPGKAPGAFAHPTVTNVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAE-QGE 414

Query: 434 LTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFE 493
           + +++ LTLAETAS+FGE LTF  +L  A +KE+RK+LLA K+EDM+N++VRQI+FYDFE
Sbjct: 415 MLSSTPLTLAETASVFGEMLTFRKMLDKAETKEQRKVLLAGKVEDMINTVVRQIAFYDFE 474

Query: 494 LKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYA 553
            KLH   R+ G++    IN IW+  Q ESLG AF+  D  Y +FW  +PHF+ S FYVYA
Sbjct: 475 CKLHAA-RAEGELTPDDINAIWMSVQAESLGEAFEYMD-GYETFWAYIPHFVHSPFYVYA 532

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YAFG+ LVN+LY +Y S   + F++KY  +L+AG SKH+ ELL P  ++ +DP FW++GL
Sbjct: 533 YAFGDGLVNALYSVYASGA-EGFEDKYFEMLKAGGSKHHKELLAPFGLDATDPKFWDKGL 591

Query: 614 QTVEKMIDDVEKM 626
             +   ID++E M
Sbjct: 592 SMISGFIDELEAM 604


>gi|118588384|ref|ZP_01545793.1| oligoendopeptidase F [Stappia aggregata IAM 12614]
 gi|118439090|gb|EAV45722.1| oligoendopeptidase F [Stappia aggregata IAM 12614]
          Length = 577

 Score =  530 bits (1365), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 259/541 (47%), Positives = 364/541 (67%), Gaps = 5/541 (0%)

Query: 29  SQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG 88
           +  ++G+LP W+L DLYP+ D+ E++ D++ I   S  F+T ++G LA    Q N  +L 
Sbjct: 29  ASADIGSLPEWDLTDLYPAVDAPEVAADLKEILDRSKTFETSYKGRLAEMA-QSNVSALV 87

Query: 89  AAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINT 148
            AI  YE + +L+GR+ S+A L Y+ N   P  +KFY D+  ++      L+FF LE+N 
Sbjct: 88  TAIRAYEDLEDLMGRLISFAGLVYSENTIKPASQKFYGDVQEQITTASSHLLFFTLEMNK 147

Query: 149 LDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCEN 208
           +D+A++E +  +D     Y  WI+++RK K + L + +E L  + S  G  A  R F E 
Sbjct: 148 IDDAVMETAL-EDGQFAHYRPWIEDLRKGKPYQLEDRVEQLFHEKSVTGAGAWNRLFDET 206

Query: 209 IESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEE 268
           + SL F ++ Q++ +        D   + R+ A++AL+ TF ++   F+ ITNTLAKD+E
Sbjct: 207 MASLTFDVDGQELSIEPTLNLLVDPKPDTRRKASEALTKTFKENLRTFTLITNTLAKDKE 266

Query: 269 IQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFW 328
           I DRWR +  IADSRHLSN VE  V++AL+ +V++ YP+ SHRYY+LK KWL +D +  W
Sbjct: 267 ISDRWRNFTDIADSRHLSNRVEREVVDALVAAVRDAYPRLSHRYYKLKAKWLGMDQLNTW 326

Query: 329 DRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAF 388
           DR APLP     +IP++ A+D VL +Y+ FSP M+ IA +FF   WIDAP   GK  GAF
Sbjct: 327 DRNAPLPNADTRVIPWDEAKDTVLSAYSAFSPDMAEIAGRFFDRRWIDAPARSGKAPGAF 386

Query: 389 AHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASI 448
           AH T+PS HPY+L+NY GK +DVMTLAHELGHG+H VL++   G L   + LTLAETAS+
Sbjct: 387 AHPTVPSAHPYVLVNYQGKIRDVMTLAHELGHGVHQVLAAP-NGPLMAPTPLTLAETASV 445

Query: 449 FGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPT 508
           FGE LTF SLL  A + + RK++LA+K EDM+N++VRQI+FY FE K+HTERR+ G++ +
Sbjct: 446 FGEMLTFKSLLAKADNPQTRKVMLASKAEDMINTVVRQIAFYTFERKVHTERRN-GELTS 504

Query: 509 HRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIY 568
            +I E+WL  Q ESLGPA  LS+  Y +FW  +PHFI S FYVYAYAFG+CLVNSLY + 
Sbjct: 505 DKIGELWLSVQGESLGPAIKLSE-GYETFWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVT 563

Query: 569 K 569
           +
Sbjct: 564 R 564


>gi|329115656|ref|ZP_08244378.1| Oligoendopeptidase F-like protein [Acetobacter pomorum DM001]
 gi|326695084|gb|EGE46803.1| Oligoendopeptidase F-like protein [Acetobacter pomorum DM001]
          Length = 645

 Score =  528 bits (1361), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 261/608 (42%), Positives = 384/608 (63%), Gaps = 9/608 (1%)

Query: 18  ALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAH 77
           A  +  +    + +   +LPRW+L  LY   D  ++  D+   E ++ AF  +++G ++ 
Sbjct: 46  ATEAGTVANTPAGQGAASLPRWDLSALYAGMDDPKLHADLAEAEKKAQAFAKQYQGKISG 105

Query: 78  ATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEK 137
            + ++    L  AIA +E I E++G+  SYA L +  + S  +I +F   IN +L     
Sbjct: 106 LSGKE----LADAIATFEIIEEMLGKAGSYASLLFAADSSDASISQFSQSINERLTAIST 161

Query: 138 VLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVG 197
            L+FF LE+N L+EA L +   QDP    +  ++++IR  + H LS+D+E +L + S  G
Sbjct: 162 HLLFFTLELNRLEEADLREKL-QDPTLAHWQPYLRDIRMYRPHQLSDDVEKVLLEKSVTG 220

Query: 198 REALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
            +A  R F E I +LR  ++ Q+I +  A     D++R  R+ A KA+   F K+  +F+
Sbjct: 221 GQAWCRLFDETIAALRVTLDGQEITVGDALNRLSDTNRATREQAGKAVGGVFEKNVRLFA 280

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
            ITNTLAKD+ I D  R + +   SR+LSN VE  V++AL+ +V++ YP+ SHRYY LK 
Sbjct: 281 LITNTLAKDKSISDNLRHFARPTSSRNLSNMVEDEVVDALVSAVRSDYPRLSHRYYALKA 340

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           KW+ LD +  WDR APLPG    +IP+  A+++V ++Y  F P+M  +   F T+ WID 
Sbjct: 341 KWMGLDKLEHWDRNAPLPGNDDKLIPWSEAKNIVQKAYDGFDPRMGKVINTFLTNPWIDV 400

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
           P   GK  GAFAH T+PS HPYILLNY G+ +DVMTLAHELGHG+H V++++ QG   ++
Sbjct: 401 PPAPGKSPGAFAHPTVPSAHPYILLNYHGRIRDVMTLAHELGHGVHQVMAAK-QGYFMSD 459

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
           + LTLAETAS+FGE LTF SLL A    + R++LLA K+EDMLN++VRQI+FY+FE ++H
Sbjct: 460 TPLTLAETASVFGEMLTFQSLLDAEKDPQRRRLLLAAKVEDMLNTVVRQIAFYEFETRVH 519

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
             R+  G++   +I  IW   Q ESLGPAF+ +  EY  FW  +PHFI S FYVYAYAFG
Sbjct: 520 DARKK-GELLPEQIGAIWRGVQTESLGPAFNFTP-EYDVFWAYIPHFIHSPFYVYAYAFG 577

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
           +CLVN+LY ++ S     F++KY+ +L AG +  + ELL P  ++ SDP FW +GL  + 
Sbjct: 578 DCLVNALYQVF-SEGAPGFQDKYIAMLEAGGTLRHKELLAPFGLDASDPGFWRKGLDVIS 636

Query: 618 KMIDDVEK 625
             ID +E+
Sbjct: 637 GFIDQLEQ 644


>gi|310815302|ref|YP_003963266.1| Oligoendopeptidase F [Ketogulonicigenium vulgare Y25]
 gi|308754037|gb|ADO41966.1| Oligoendopeptidase F [Ketogulonicigenium vulgare Y25]
          Length = 603

 Score =  528 bits (1359), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 265/594 (44%), Positives = 377/594 (63%), Gaps = 8/594 (1%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           +G LP W+L DLYP  DS E++ D++ +  E  AF+  +EG L+  +       + AA+ 
Sbjct: 16  IGPLPEWDLTDLYPGEDSPELARDLDWLAGECTAFQADYEGKLSSLS----AGDMLAAVK 71

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
            YE I  + GRI S+A LSY    +     KF +D+  ++ +    L+F+ LE N LD+A
Sbjct: 72  RYEEIDIIAGRIMSFAGLSYYQMTTDSERAKFLSDMQDEITNDTTALVFWGLEFNRLDDA 131

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
            L+   AQ+    +Y    + +R ++ + LS+++E  L D S VG  A  R F E +  L
Sbjct: 132 HLDGLIAQNADLARYQPIFERMRAMRPYQLSDELEKFLHDQSVVGASAWNRLFDETMAGL 191

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
            F++N + + +        D +R  R++A  AL+  F ++   F+ I NTLAK++E++DR
Sbjct: 192 SFEVNGETLNIEATLNLLTDDNRPTREAAHVALAKVFRENVKTFARIHNTLAKEKEVEDR 251

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR +     +RHL+N+VEP V+EAL  +V   YP+ SHRYY LK KW+ LD +  WDR A
Sbjct: 252 WRGFPTPQTARHLANHVEPEVVEALRNAVVAAYPRLSHRYYRLKAKWMGLDVLQVWDRNA 311

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP   Q  I +E A+D VL +Y  F P+++ +A  FFT  WIDA    GK  GAFAH T
Sbjct: 312 PLPRNPQRPISWEEAKDTVLAAYGDFDPRLADLAAPFFTDGWIDAAVKPGKAQGAFAHPT 371

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           + +VHPY+L+NYLGK +DVMTLAHELGHGIH  L++  QG L +++ LTLAETAS+FGE 
Sbjct: 372 VSTVHPYVLVNYLGKTRDVMTLAHELGHGIHQRLAA-GQGELLSSTPLTLAETASVFGEM 430

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF  +L   + K  RK LLA+K+EDM+N++VRQI+FYDFE KLH   R+ G++    I 
Sbjct: 431 LTFRKVLDQTTDKAARKALLASKVEDMINTVVRQIAFYDFECKLHAA-RAEGELTPDDIA 489

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
            +W+  Q +SLG AF+ +D  Y +FW  V HF+ S FYVYAYAFG+ LVN+LY  Y    
Sbjct: 490 VLWMSVQAQSLGDAFEFAD-GYENFWTYVSHFVHSPFYVYAYAFGDGLVNALYAAYTEGD 548

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            D F++KY ++L AG SKH+SELL P  ++ +DP FW++GL  +E  ID++E M
Sbjct: 549 PD-FQQKYFDLLSAGGSKHHSELLKPFGLDATDPKFWDKGLSMIEGFIDELESM 601


>gi|162147894|ref|YP_001602355.1| group B oligopeptidase pepB [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209542511|ref|YP_002274740.1| oligoendopeptidase, pepF/M3 family [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161786471|emb|CAP56053.1| Group B oligopeptidase pepB [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209530188|gb|ACI50125.1| oligoendopeptidase, pepF/M3 family [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 615

 Score =  526 bits (1355), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 271/592 (45%), Positives = 381/592 (64%), Gaps = 9/592 (1%)

Query: 34  GNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAE 93
           G+LPRW+L DLY S +S  +  D+   E ++ AF   W G LA A+      +L  AIAE
Sbjct: 32  GDLPRWDLGDLYDSPESDRLRTDLNQAEADAAAFADVWRGRLAGASPA----ALAEAIAE 87

Query: 94  YERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEAL 153
           Y+RI E++GR ASYA L +  + S   I +F   +N +L D    L+FF LE+N + +  
Sbjct: 88  YQRIDEVLGRAASYAQLLFAGDSSDAAIGRFSQSVNERLTDISTHLLFFTLELNRIGDDE 147

Query: 154 LEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLR 213
           +    A DP    ++ +++++R  + H LS+++E +L + S  G  A  R F E +  LR
Sbjct: 148 MAARLA-DPALAVWAPFLRDLRVFRPHQLSDEIEQVLHEKSVTGAAAWCRLFDETMAGLR 206

Query: 214 FKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRW 273
             ++D ++ + +A     D DR VR+ AA+A+   F  +  +FS ITNTLAKD+ I D  
Sbjct: 207 IPLDDSRLTVGEALNRLSDPDRAVRERAARAIGAVFGDNIRLFSLITNTLAKDKAISDSL 266

Query: 274 RKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAP 333
           R Y +    R+ SN VE  V++AL+Q+V   YP+ SHRYY LK KWL L+ +  WDR AP
Sbjct: 267 RHYPRPGSYRNRSNMVEDEVVDALVQAVTTDYPRLSHRYYALKAKWLGLEKLEHWDRNAP 326

Query: 334 LPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTI 393
           LP     IIP++ A   VL +Y  F P+M  +A +FF H WIDA    GK SGAFAH T+
Sbjct: 327 LPSADDRIIPWDQATRQVLAAYEAFDPRMGTVARRFFDHAWIDAAPAPGKASGAFAHPTV 386

Query: 394 PSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETL 453
           PSVHPY+LLNY G+ +DVMTLAHELGHG+H VL++   G L + + LTLAETAS+FGE L
Sbjct: 387 PSVHPYLLLNYHGRTRDVMTLAHELGHGVHQVLAA-PHGYLMSGTPLTLAETASVFGEML 445

Query: 454 TFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINE 513
           TF +LL A +    R+++LA K+EDMLN++VRQI+FY FE  +H ER+S G++   RI  
Sbjct: 446 TFRALLDAETDPARRRLMLAAKVEDMLNTVVRQIAFYRFETLVHAERKS-GELLPERIGA 504

Query: 514 IWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTV 573
           IW + Q ESLGPAF+ +  +Y  +W  VPHFI S FYVYAYAFG+CLVN+LY +++S   
Sbjct: 505 IWRQVQTESLGPAFNFTP-DYDVYWTYVPHFIHSPFYVYAYAFGDCLVNALYGVFQSGHA 563

Query: 574 DCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEK 625
             F++KYL++LRAG +  + ELL P  ++ +DP FW +GL  +   ID++E+
Sbjct: 564 -GFQDKYLDMLRAGGTMRHRELLAPFGLDAADPGFWRKGLDVIAGFIDELER 614


>gi|258543050|ref|YP_003188483.1| oligoendopeptidase F [Acetobacter pasteurianus IFO 3283-01]
 gi|256634128|dbj|BAI00104.1| oligoendopeptidase F [Acetobacter pasteurianus IFO 3283-01]
 gi|256637188|dbj|BAI03157.1| oligoendopeptidase F [Acetobacter pasteurianus IFO 3283-03]
 gi|256640240|dbj|BAI06202.1| oligoendopeptidase F [Acetobacter pasteurianus IFO 3283-07]
 gi|256643297|dbj|BAI09252.1| oligoendopeptidase F [Acetobacter pasteurianus IFO 3283-22]
 gi|256646352|dbj|BAI12300.1| oligoendopeptidase F [Acetobacter pasteurianus IFO 3283-26]
 gi|256649405|dbj|BAI15346.1| oligoendopeptidase F [Acetobacter pasteurianus IFO 3283-32]
 gi|256652391|dbj|BAI18325.1| oligoendopeptidase F [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655449|dbj|BAI21376.1| oligoendopeptidase F [Acetobacter pasteurianus IFO 3283-12]
          Length = 645

 Score =  526 bits (1354), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 260/608 (42%), Positives = 382/608 (62%), Gaps = 9/608 (1%)

Query: 18  ALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAH 77
           A ++  +    + +   +LPRW+L  LY   D  ++  D+   E ++  F  +++G +  
Sbjct: 46  ATQAGTVANTPAGQGAASLPRWDLSALYAGMDDPKLHADLAEAEKKAQDFAKQYQGKIGS 105

Query: 78  ATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEK 137
            + ++    L  AIA +E I E++G+  SYA L +  + S  +I +F   IN +L     
Sbjct: 106 LSGKE----LADAIATFEVIEEMLGKAGSYASLLFAADSSDASISQFSQSINERLTAIST 161

Query: 138 VLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVG 197
            L+FF LE+N L+EA L++   +DP    +  ++++IR  + H LS+D+E +L + S  G
Sbjct: 162 HLLFFTLELNRLEEADLQEKL-KDPALAHWQPYLRDIRMYRPHQLSDDVEKVLLEKSVTG 220

Query: 198 REALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
            +A  R F E I +LR  ++ Q I +  A     D++R  R+ A KA+   F K+  +F+
Sbjct: 221 GQAWCRLFDETIAALRVTLDGQAITVGDALNRLSDTNRATREQAGKAVGDVFEKNVRLFA 280

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
            ITNTLAKD+ I D  R + +   SR+LSN VE  V++AL+ +V+  YP+ SHRYY LK 
Sbjct: 281 LITNTLAKDKSISDNLRHFARPTSSRNLSNMVEDEVVDALVSAVRADYPRLSHRYYALKA 340

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           KW+ LD +  WDR APLPG    +IP+  A+++V ++Y  F P+M  +   F T+ WID 
Sbjct: 341 KWMGLDKLEHWDRNAPLPGNDDKLIPWSEAKNIVQKAYDGFDPRMGKVINTFLTNPWIDV 400

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
           P   GK  GAFAH T+PS HPYILLNY G+ +DVMTLAHELGHG+H VL+++ QG   ++
Sbjct: 401 PPAPGKSPGAFAHPTVPSAHPYILLNYHGRIRDVMTLAHELGHGVHQVLAAK-QGYFMSD 459

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
           + LTLAETAS+FGE LTF SLL A    + R++LLA K+EDMLN++VRQI+FY+FE ++H
Sbjct: 460 TPLTLAETASVFGEMLTFQSLLDAEKDPQRRRLLLAAKVEDMLNTVVRQIAFYEFETRVH 519

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
             R+  G++   +I  IW   Q ESLGPAF+ +  EY  FW  +PHFI S FYVYAYAFG
Sbjct: 520 DARKK-GELLPEQIGAIWRSVQTESLGPAFNFTP-EYDVFWAYIPHFIHSPFYVYAYAFG 577

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
           +CLVN+LY ++ S     F++KY+ +L AG +  + ELL P  ++ SDP FW +GL  + 
Sbjct: 578 DCLVNALYQVF-SEGAPGFQDKYIAMLEAGGTLRHKELLAPFGLDASDPGFWRKGLDVIS 636

Query: 618 KMIDDVEK 625
             ID +E+
Sbjct: 637 GFIDQLEQ 644


>gi|119384569|ref|YP_915625.1| pepF/M3 family oligoendopeptidase [Paracoccus denitrificans PD1222]
 gi|119374336|gb|ABL69929.1| oligoendopeptidase, pepF/M3 family [Paracoccus denitrificans
           PD1222]
          Length = 620

 Score =  524 bits (1349), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 273/597 (45%), Positives = 370/597 (61%), Gaps = 12/597 (2%)

Query: 32  NLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAH--ATNQKNCHSLGA 89
           +LG LP W+L DLYP+ DS E++ D+E +E     F   +EG LA   A    +C     
Sbjct: 32  DLGALPEWDLSDLYPAPDSPELTRDLEAVEQACCEFARNYEGKLASLDAGKMLDC----- 86

Query: 90  AIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTL 149
            I  Y++I  L GRI SYA L Y  N +     K   D+  ++      L+FF+LE N +
Sbjct: 87  -IERYQQIDILAGRIMSYAGLRYYQNTTDSARAKQMGDLQDRITTATTKLVFFSLEFNRI 145

Query: 150 DEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENI 209
            +A  E+ +A      +Y      +R ++ + LSN++E  L D S VG  A  R F E  
Sbjct: 146 PDARYEEVFAAPNGPARYKPVFDRMRAMRPYQLSNELERFLHDNSVVGAAAWNRLFDETT 205

Query: 210 ESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEI 269
             L F +  +++ L        D DR  R++ A+AL   F K+  +F+ I NTLAK++ I
Sbjct: 206 AGLTFDVAGEELGLEATLNLLTDHDRARREAGARALVEVFGKNVKLFARIHNTLAKEKSI 265

Query: 270 QDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWD 329
           +D+WRK      +RHLSN+VEP V+EAL  +V   YP+ SHRYY LK KWL LD +  WD
Sbjct: 266 EDKWRKMPTPQTARHLSNHVEPEVVEALRNAVTAAYPRLSHRYYRLKAKWLGLDKLQVWD 325

Query: 330 RLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFA 389
           R APLP  S  +I +  A+  VL +YA FSP+++ +A+ FF   WIDA    GK  GAFA
Sbjct: 326 RNAPLPTESPRLIAWPEAQATVLDAYAGFSPKLAELAQPFFERGWIDAAVKPGKAPGAFA 385

Query: 390 HGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIF 449
           H T+ +VHPY+LLNYLGKP+DVMTLAHELGHG+H  L++  QG L   + LTLAETAS+F
Sbjct: 386 HPTVTTVHPYVLLNYLGKPRDVMTLAHELGHGVHQSLAA-AQGELLAATPLTLAETASVF 444

Query: 450 GETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTH 509
           GE LTF +LL   + K +RK LLA K+EDM+N++VRQI+FYDFE KLH   R+ G++   
Sbjct: 445 GEMLTFRALLAKTTDKTQRKALLAGKVEDMINTVVRQIAFYDFECKLHAA-RAKGELTPE 503

Query: 510 RINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYK 569
            IN +W+  Q ESLG AF+     Y +FW  VPHF+ S FYVYAYAFG+ LVN+LY  Y+
Sbjct: 504 DINALWMSVQAESLGDAFEFMP-GYETFWTYVPHFVHSPFYVYAYAFGDGLVNALYAAYE 562

Query: 570 SNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
               D F+ KY ++L AG S+H+ ELL P  ++ SDP FW++GL  +E  ID++E M
Sbjct: 563 DGLPD-FQAKYFDMLAAGGSRHHKELLAPFGLDASDPAFWDKGLSMIEGFIDELEAM 618


>gi|296533046|ref|ZP_06895692.1| oligoendopeptidase F [Roseomonas cervicalis ATCC 49957]
 gi|296266632|gb|EFH12611.1| oligoendopeptidase F [Roseomonas cervicalis ATCC 49957]
          Length = 610

 Score =  523 bits (1347), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 258/592 (43%), Positives = 374/592 (63%), Gaps = 8/592 (1%)

Query: 34  GNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAE 93
           G LP W+L DLY       +  D+  +E E+ AF     G L     + +  +L  AIA 
Sbjct: 24  GALPVWDLSDLYAGSGDPRLEADLARVEAEARAFHEAHAGKL----EKMSGDALAEAIAA 79

Query: 94  YERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEAL 153
           YERI E++GR+ SYA L +  +       +FY  +  ++       +FF+LE+N LDEA+
Sbjct: 80  YERIEEVLGRVMSYASLVFAGDAQDAANGRFYQTMQERVTAISSHTLFFSLELNKLDEAV 139

Query: 154 LEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLR 213
           LE+ ++   L  +Y  +++++R  + H LS+++E LL +    GR A  R F E +  + 
Sbjct: 140 LEKKFSSRALA-RYRPFLRDLRVFRPHQLSDEVERLLHEKEVTGRAAWNRLFDETVAGME 198

Query: 214 FKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRW 273
            K+ ++ + ++ A     D DR VR++AA+ +S  F + + +F+ ITNTLAKD+EI D W
Sbjct: 199 VKVGEEVLNVSGALNKLSDRDRSVREAAARGVSAAFGEKARLFTLITNTLAKDKEIIDGW 258

Query: 274 RKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAP 333
           R Y +   SR+ +N VE  V++AL+ +V   +P  SHRYY +K KWL L  +  WDR AP
Sbjct: 259 RHYPRPGSSRNRANMVEDAVVDALVDAVVASFPALSHRYYAMKAKWLGLPKLQHWDRNAP 318

Query: 334 LPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTI 393
           LP      IP++ ARD VL +Y+ FSP++  I ++FF   WIDA    GK  GAFAH T+
Sbjct: 319 LPAEDDSQIPWDAARDRVLSAYSAFSPELGRIGKEFFDKPWIDAALRPGKSGGAFAHPTV 378

Query: 394 PSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETL 453
           PS HPY+LLNY GK +DVMTLAHELGHG+H VL+++ QG L + + LTLAETAS+FGE L
Sbjct: 379 PSAHPYLLLNYHGKSRDVMTLAHELGHGVHQVLAAK-QGYLMSGTPLTLAETASVFGEML 437

Query: 454 TFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINE 513
           TF ++L A +  + R+ LLA K+EDMLN++VRQI+FY FE  LH  RR  G++    I  
Sbjct: 438 TFRAVLDAETDPKRRRALLAGKVEDMLNTVVRQIAFYRFETLLHDARRK-GELSREEIGA 496

Query: 514 IWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTV 573
           +W+  Q ESLGPAF+ +  +Y  +W  +PHFI + FYVYAYAFG+CLVN+LY +++   V
Sbjct: 497 LWMRVQVESLGPAFEFTP-DYEIYWSYIPHFIHTPFYVYAYAFGDCLVNALYGVFQEGGV 555

Query: 574 DCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEK 625
             F+ KYL +L+AG +  + ELL P  ++ SDP FW +GL  +   ID++E+
Sbjct: 556 KDFQAKYLELLKAGGTLRHKELLAPFGLDASDPAFWHKGLNVIAGFIDELER 607


>gi|83952979|ref|ZP_00961706.1| oligoendopeptidase F [Roseovarius nubinhibens ISM]
 gi|83835641|gb|EAP74943.1| oligoendopeptidase F [Roseovarius nubinhibens ISM]
          Length = 567

 Score =  512 bits (1318), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 256/567 (45%), Positives = 356/567 (62%), Gaps = 9/567 (1%)

Query: 23  DMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           D       +NLG+LP W+L DLY   D+ E+  D++ +E     F   +EG L    +  
Sbjct: 10  DANAQGGADNLGHLPEWDLSDLYKGEDAPELIRDLDWLESACAEFARDYEGKL----DTL 65

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
           +   L   I   E+I  + GRI S+A L Y    + P   KF +D   K+  +   L+FF
Sbjct: 66  DAAGLLECIVRDEKISNIAGRIMSFASLRYYQLTTDPARTKFLSDCQEKITAYTTPLVFF 125

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
            LE+N + E  L   YA++    +Y   +  IR +K H LS++ME  L D   VG +A +
Sbjct: 126 TLELNRISEDKLTAMYAENADLARYKPSLNRIRAMKPHQLSDEMEKFLHDMGVVG-DAWE 184

Query: 203 RFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNT 262
           R F E I  L F++  + + +        + DR+ R++A + L+  F ++  IFS + NT
Sbjct: 185 RLFDETIAGLSFEVAGETLTIEGTLNLLTEQDRDTREAATRELARVFGENIRIFSRVHNT 244

Query: 263 LAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKL 322
            AK++E+ DRWR        RHLSN+VE  V+EAL  +V   YP+ SHRYYELK+KWL L
Sbjct: 245 AAKEKEVMDRWRNMPSAQAGRHLSNDVEAEVVEALRDAVVAAYPRLSHRYYELKRKWLGL 304

Query: 323 DTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDG 382
           D M  WDR APLP   Q  + ++ ARD+V+++Y  F P+M  +AE FF+  WIDA    G
Sbjct: 305 DRMQVWDRNAPLPMELQKTVDWDSARDIVMEAYNAFDPRMGELAEPFFSKGWIDAGVKPG 364

Query: 383 KGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTL 442
           K  GAFAH T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H  L+++ QG   +++ LTL
Sbjct: 365 KAPGAFAHPTVTTVHPYVMLNYLGKPRDVMTLAHELGHGVHQRLAAD-QGEWLSSTPLTL 423

Query: 443 AETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRS 502
           AETAS+FGE LTF  +L  A+S +ERK+LLA K+EDM+N++VRQI+FYDFE KLH  RR 
Sbjct: 424 AETASVFGEMLTFRKMLDKAASPQERKVLLAGKVEDMINTVVRQIAFYDFECKLHAARRE 483

Query: 503 TGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVN 562
            G++    I  +W+  Q ESLGPAFD  +  Y +FW  +PHF+ S FYVYAYAFG+ LVN
Sbjct: 484 -GELTPEDIGALWMSVQGESLGPAFDFME-GYDTFWAYIPHFVHSPFYVYAYAFGDGLVN 541

Query: 563 SLYDIYKSNTVDCFKEKYLNILRAGNS 589
           +LY +Y+ N  D F++KY ++LRAG S
Sbjct: 542 ALYAVYEENP-DGFQDKYFDMLRAGGS 567


>gi|58040284|ref|YP_192248.1| oligoendopeptidase F [Gluconobacter oxydans 621H]
 gi|58002698|gb|AAW61592.1| Oligoendopeptidase F [Gluconobacter oxydans 621H]
          Length = 602

 Score =  506 bits (1303), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 249/590 (42%), Positives = 370/590 (62%), Gaps = 10/590 (1%)

Query: 37  PRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYER 96
           PRW+L DLY S +   +++D +     + +F   ++G L   T  +    L  A AEYE 
Sbjct: 20  PRWDLSDLYASPEDPVLASDFDRWAGAARSFCETYKGRLETLTGAE----LAKAFAEYEA 75

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTL-DEALLE 155
           I E +G+I S++ L +  + + P   +F   +  ++ +    L+FF LE+N + DE L  
Sbjct: 76  IEEGLGKIGSFSSLGFAAHTTDPVWGRFAQGVQERMTEVASDLMFFTLELNRIPDEVLAR 135

Query: 156 QSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFK 215
              AQ+    K+  +++++R  + + LS+++E +L D S  GR A  R F E + +L   
Sbjct: 136 ICEAQE--MRKWDPYLRDLRMYRPYQLSDEVEQVLMDKSVTGRNAWNRLFDETMATLSVT 193

Query: 216 INDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRK 275
           I+ ++ PL  A+    ++DR  R++AA+ +S    ++S + + ITNTLAKD+ I D+ R 
Sbjct: 194 IDGEEKPLGDAFNLLTNTDRAKREAAAQQISAVLGENSRLLTMITNTLAKDKAIGDKLRG 253

Query: 276 YEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLP 335
           Y +   +R+L+N VE  V++AL+ +V   YP+ +HRYY LK KWL L+ +  WDR APLP
Sbjct: 254 YPRPTSARNLANMVEDEVVDALVGAVDEAYPRLAHRYYALKAKWLGLEKLEHWDRNAPLP 313

Query: 336 GTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPS 395
           G     I +   +++V  +YA F P +  I  +F TH WIDA    GK SGAF+H  +PS
Sbjct: 314 GVEARKIDWVQGKEIVRTAYAGFDPGLGEIVNRFLTHPWIDAAPVAGKSSGAFSHSCVPS 373

Query: 396 VHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTF 455
           VHPYIL+NY G+P+DVMTLAHELGHG+H  L+ + QG L  ++ LTLAETAS+FGE LTF
Sbjct: 374 VHPYILMNYRGQPRDVMTLAHELGHGVHQTLAGQKQGYLNADTPLTLAETASVFGEMLTF 433

Query: 456 DSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIW 515
            SLL A S  + R+ +LA K+EDMLN++VRQI+FY FE+K+H E R+ G++   R+ EIW
Sbjct: 434 QSLLDAESDPKRRRHMLAAKVEDMLNTVVRQIAFYQFEVKVHDE-RAKGELSPERLGEIW 492

Query: 516 LETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDC 575
            E Q  SLGPAF  +  +Y  +W  +PHF+ S FYVYAYAFG+CLVN+LY +Y+    + 
Sbjct: 493 REVQVRSLGPAFHFTP-DYDLYWSYIPHFVHSPFYVYAYAFGDCLVNALYGVYQEKP-EG 550

Query: 576 FKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEK 625
           F  KY  +L AG +  + ELL P  ++ +DP FW +GL  +  +ID +E+
Sbjct: 551 FAAKYRTMLEAGGTLRHKELLAPFGLDATDPGFWRKGLDVISGLIDQLEQ 600


>gi|294084910|ref|YP_003551670.1| oligoendopeptidase, pepF/M3 family [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664485|gb|ADE39586.1| oligoendopeptidase, pepF/M3 family [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 592

 Score =  465 bits (1196), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 236/598 (39%), Positives = 354/598 (59%), Gaps = 12/598 (2%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           L N P W+L DLY   D   I+ D++    +S A +T W+G L    ++ N   L   I 
Sbjct: 2   LDNSPVWDLSDLYTDIDDNRIAADIKSCRKDSAALQTSWQGKL----DKANGSELAEVIT 57

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
            YE I E +GR+  +A L +  N +  +I K +  +    A+    L+F  LEI T D+A
Sbjct: 58  IYEMIIERLGRVQCHAQLLFAANTADASIAKHHQSMREAGAEIGAQLLFVELEIATFDDA 117

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
            +        L   ++ WI+ +R +  + LS DME +L++    GR A  R F E   ++
Sbjct: 118 HMNWVMQTAELA-HWAPWIRRVRAMAPYQLSADMEKMLAEQGPTGRGAWVRLFDETATAM 176

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           RF     ++   +        +   RK A  +LS T  K+  + S I NT+AKD+E++DR
Sbjct: 177 RFPFQGDEVTEAEILDMVSSPNAAHRKEAGLSLSTTLKKNERLLSLIINTIAKDKEVEDR 236

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR +++   SR+L+N+V+  V++AL+++V +     SHRYY LK +W+    + +WDR A
Sbjct: 237 WRGFKRPVASRNLANDVDDNVVDALVRAVNDRNVDLSHRYYSLKARWMGQSQLDWWDRNA 296

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PL G       ++ ARD+VL ++A F   M+ IA+ FF +NWIDA    GK SGAF+H  
Sbjct: 297 PLLGDDDRDFTWQEARDIVLDAFASFDQGMATIAKPFFDNNWIDAAPRLGKSSGAFSHPA 356

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +PS HPYIL+N+ GK +DVMTLAHE+GHG+H  L+++  G L +++ LTLAETAS+F E 
Sbjct: 357 VPSAHPYILMNFSGKARDVMTLAHEMGHGVHQCLAAD-NGYLMSDTPLTLAETASVFAEM 415

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           L F  LL A ++   R++LLA K+EDMLN++VRQI+F++FE  LH  RRS+  +P   I+
Sbjct: 416 LAFRRLLDATANPATRRVLLAGKVEDMLNTVVRQIAFHNFETALHDARRSSELMP-EEIS 474

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
           +IW+ETQ+ +LG    + D +Y   W  VPHF+ + FYVYAYAFG+CLVN+L+  Y++  
Sbjct: 475 DIWMETQRAALGQGIRIGD-DYRPVWSYVPHFVHTPFYVYAYAFGDCLVNALWQNYQNAL 533

Query: 573 VD----CFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            +     F  KY  +L AG ++ Y   L    ++  DP FW  GL  +  MID++E +
Sbjct: 534 ANGDAAGFVTKYKALLSAGGTERYDVALAKFGLDAGDPAFWSTGLDMISNMIDELESL 591


>gi|218680830|ref|ZP_03528727.1| oligoendopeptidase, pepF/M3 family protein [Rhizobium etli CIAT
           894]
          Length = 378

 Score =  457 bits (1176), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 210/379 (55%), Positives = 280/379 (73%), Gaps = 4/379 (1%)

Query: 248 TFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPK 307
           TF  +   F+ ITNTLAKD+EI DRWR +E IADSRHL+N VE  V++AL  +V+  YP+
Sbjct: 1   TFKANIRTFTLITNTLAKDKEIADRWRGFEDIADSRHLANRVERDVVDALAAAVREAYPR 60

Query: 308 TSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAE 367
            SHRYY++K KWL ++ M FWDR APLP TS  +I +  A+D VL +Y  F+P+M+ IA 
Sbjct: 61  LSHRYYKMKAKWLGMEQMNFWDRNAPLPETSSAVISWPEAKDTVLSAYGNFAPEMADIAR 120

Query: 368 KFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLS 427
           +FF   WIDAP   GK  GAFAH T+PS HPY+L+NY+GKP+DVMTLAHELGHG+H VL+
Sbjct: 121 RFFDEQWIDAPVRPGKAPGAFAHPTVPSAHPYVLVNYMGKPRDVMTLAHELGHGVHQVLA 180

Query: 428 SETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQI 487
              QG L   + LTLAETAS+FGE LTF +LL+  S K ERK +LA K+EDM+N++VRQI
Sbjct: 181 G-AQGALMCQTPLTLAETASVFGEMLTFRALLEKTSDKRERKAMLAQKVEDMINTVVRQI 239

Query: 488 SFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIES 547
           +FY+FE KLHT R++ G++    I E+WL  Q ESLGPA ++S+  Y ++W  +PHFI S
Sbjct: 240 AFYEFERKLHTARKA-GELTADDIGELWLSVQSESLGPAINISE-GYETYWAYIPHFIHS 297

Query: 548 SFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPN 607
            FYVYAYAFG+CLVNSLY +Y+      F+EKY  +L+AG +KH+SELL P  ++ ++P+
Sbjct: 298 PFYVYAYAFGDCLVNSLYAVYQ-KAEKGFQEKYFELLKAGGTKHHSELLKPFGLDATNPS 356

Query: 608 FWERGLQTVEKMIDDVEKM 626
           FW +GL  +E +ID++E +
Sbjct: 357 FWSQGLSMIEGLIDELEAL 375


>gi|218460061|ref|ZP_03500152.1| oligoendopeptidase F protein [Rhizobium etli Kim 5]
          Length = 361

 Score =  439 bits (1128), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 205/363 (56%), Positives = 265/363 (73%), Gaps = 3/363 (0%)

Query: 203 RFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNT 262
           R F E +  LR++I+ +K+PL  A     + D EVR+ AA AL+ TF  +  IF+ ITNT
Sbjct: 1   RLFDETMAELRYEIDGEKVPLEVALNMLQEKDPEVRRKAAMALAETFKANIRIFTLITNT 60

Query: 263 LAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKL 322
           LAKD++I DRWR +E IADSRHL+N VE  V++AL  +V+  YP+ SHRYY++K KWL +
Sbjct: 61  LAKDKDISDRWRGFEDIADSRHLANRVEREVVDALAAAVREAYPRLSHRYYKMKAKWLGM 120

Query: 323 DTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDG 382
           + M FWDR APLP TS  +I +  A+D VL +Y  F+P+M+ IA +FF   WIDAP   G
Sbjct: 121 EQMNFWDRNAPLPETSSAVISWSDAKDTVLSAYGNFAPEMADIARRFFDEQWIDAPVRPG 180

Query: 383 KGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTL 442
           K  GAFAH T+PS HPY+L+NYLGKP+DVMTLAHELGHG+H VL+   QG L   + LTL
Sbjct: 181 KAPGAFAHPTVPSAHPYVLVNYLGKPRDVMTLAHELGHGVHQVLAG-AQGALMCQTPLTL 239

Query: 443 AETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRS 502
           AETAS+FGE LTF +LL+  + K ERK +LA K+EDM+N++VRQI+FY+FE KLHT R+S
Sbjct: 240 AETASVFGEMLTFRALLEKTTDKRERKAMLAQKVEDMINTVVRQIAFYEFERKLHTARKS 299

Query: 503 TGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVN 562
            G++    I E+WL  Q ESLGPA  +S+  Y ++W  +PHFI S FYVYAYAFG+CLVN
Sbjct: 300 -GELTADDIGELWLSVQSESLGPAISISE-GYETYWAYIPHFIHSPFYVYAYAFGDCLVN 357

Query: 563 SLY 565
           SLY
Sbjct: 358 SLY 360


>gi|329890414|ref|ZP_08268757.1| oligoendopeptidase, pepF/M3 family protein [Brevundimonas diminuta
           ATCC 11568]
 gi|328845715|gb|EGF95279.1| oligoendopeptidase, pepF/M3 family protein [Brevundimonas diminuta
           ATCC 11568]
          Length = 596

 Score =  428 bits (1100), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 219/595 (36%), Positives = 339/595 (56%), Gaps = 14/595 (2%)

Query: 35  NLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTR---WEGNLAHATNQKNCHSLGAAI 91
           + P W+L DLY S +   I+ D+E     + A   R   W+G LA  +  +   +L  AI
Sbjct: 12  DAPLWDLSDLYASREDARIAADLE----RARALVDRMNAWQGRLAALSGAELGRALDEAI 67

Query: 92  AEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDE 151
             YE+  +++G + +YA L+ + N      + F  D+  KL       ++  LEIN LDE
Sbjct: 68  GLYEQAADVMGALGAYAFLAASTNREDAAAQGFEADVREKLTVIATPTVWLTLEINALDE 127

Query: 152 ALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIES 211
           A +E +        +++ W++ +R +K H LS ++E  +++   + +    R F E + +
Sbjct: 128 AAVEAALTAHAPAARWAPWLRRVRAMKPHELSAELETFIAERGPI-QAQWPRLFDETLAA 186

Query: 212 LRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
           LR  + D+++ L +      D+D   R++A + LS  F+  +   + + NT+A ++ ++D
Sbjct: 187 LRAPVRDEELTLAEGLNRLSDADGAKRQAAGEGLSTAFSGIARTMAMVLNTVAAEKALED 246

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRL 331
           R R +++ ADSRHL N V+   ++A+ ++V   YP+ +HRYY LK K +  D +  WDR 
Sbjct: 247 RKRGFKRPADSRHLGNEVDGESVDAMAEAVAEAYPRLAHRYYALKAKAMGKDRLAHWDRN 306

Query: 332 APLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHG 391
           AP+   +     +   R++VL S+A      +  A  FF   WIDA    GK SGA+AH 
Sbjct: 307 APIEAAASRAYDWAGGREVVLSSFADLGRDFAERAGWFFDRPWIDARARAGKQSGAYAHP 366

Query: 392 TIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE 451
                HPY+ LN++G+ +DV+TLAHELGHG+H  L++  QG L  ++ LTLAETASIF E
Sbjct: 367 VTADRHPYVFLNWMGERRDVLTLAHELGHGVHQTLAA-GQGSLLADTPLTLAETASIFAE 425

Query: 452 TLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRI 511
            LTFD LL  A+  E+R  LLA +IED LN++VRQI+F+ FE + H E R+ G++P  RI
Sbjct: 426 GLTFDRLLAEATPDEQRA-LLAGRIEDGLNTVVRQIAFHRFETRFHDE-RAAGEVPVERI 483

Query: 512 NEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSN 571
            EIW+E    SLGP+ DL+   Y  +W  V HF+ + FYVYAYAFG+ LV +L +    +
Sbjct: 484 REIWMEELGASLGPSVDLTG--YEDWWAYVSHFVHAPFYVYAYAFGDLLVAALMETRAKD 541

Query: 572 TVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
               F   Y ++L  G ++ Y E L P  +N  DP FW  G + +E +ID  E +
Sbjct: 542 PA-AFTPLYRDLLSGGGARTYVEALKPFGLNPRDPAFWTIGTKRLEGLIDRFEAL 595


>gi|254417771|ref|ZP_05031495.1| oligoendopeptidase, pepF/M3 family [Brevundimonas sp. BAL3]
 gi|196183948|gb|EDX78924.1| oligoendopeptidase, pepF/M3 family [Brevundimonas sp. BAL3]
          Length = 637

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 220/605 (36%), Positives = 339/605 (56%), Gaps = 19/605 (3%)

Query: 29  SQENLGNLPRWNLEDLYPSHDSQEISNDME---CIEHESLAFKTRWEGNLAHATNQKNCH 85
           SQ +    P W+L DLY S D   I+ D++    +  E    + R  G         +  
Sbjct: 44  SQSDPAEAPLWDLTDLYGSRDDARIAADLDRARALVDEMNGLQGRLAGQ------GGDPA 97

Query: 86  SLGAA----IAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
           SLGAA    I+ YE+  +++G + +YA L+ +        + F  D+  K+       ++
Sbjct: 98  SLGAALDRAISLYEQASDVLGALGAYAFLAASTARDDAGAQGFEADVREKITAIATPTVW 157

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
             LEIN +D+A LE +        ++  W++ +R +K H LS+++E  +++   +  +  
Sbjct: 158 LTLEINQIDDAALEAALQAHAGASRWRPWLRRVRAMKPHELSSELETFIAERGPITAQ-W 216

Query: 202 KRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITN 261
            R F E + +LR K  ++ + L +A     D     RK+AA+ LS      +   + + N
Sbjct: 217 PRLFDEQLAALRAKAGNESLTLAEALNRLSDPKPARRKAAAEGLSEALAARAPTLALVLN 276

Query: 262 TLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLK 321
           T+A D+ ++DRWR +++ ADSRHL N V+   ++A+ ++V   YP+ SHRYY LK K + 
Sbjct: 277 TVAADKAMEDRWRGFKRPADSRHLGNEVDGEAVDAMAEAVAAAYPQLSHRYYALKAKAMG 336

Query: 322 LDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYD 381
              +  WDR AP+  T+     +   R++VL S++    + +  A  FF   WID     
Sbjct: 337 KARLDHWDRNAPIETTAPRAFTWSQGREIVLDSFSDLGAEFAERAAGFFDKPWIDGRARP 396

Query: 382 GKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLT 441
           GK SGA+AH      HPY+ LN++G+ +DV+TLAHELGHG+H  L+++ QG L  ++ LT
Sbjct: 397 GKQSGAYAHPVTADRHPYVFLNWMGERRDVLTLAHELGHGVHQTLAAD-QGTLLADTPLT 455

Query: 442 LAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERR 501
           LAETASIF E LTFD LL  A  +E+R  LLA +IED LN++VRQI+F+ FE + H ER+
Sbjct: 456 LAETASIFAEGLTFDRLLATAPKREQRG-LLAGRIEDGLNTVVRQIAFHRFETRFHDERQ 514

Query: 502 STGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLV 561
             G++   RINE+WL     SLGPA  L+   Y  +W  V HF+ S FYVYAYAFG+ LV
Sbjct: 515 K-GEVSQQRINELWLTEMGASLGPAVTLNP-GYEHWWAYVSHFVHSPFYVYAYAFGDLLV 572

Query: 562 NSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMID 621
            +L +  +++    F   Y ++L  G +K Y E L P  +N  DP FW  G + +E+++D
Sbjct: 573 AALMEARRADPT-GFTPLYRDLLAGGGAKTYVEALKPFGLNPRDPAFWSVGCKRLERLVD 631

Query: 622 DVEKM 626
             E +
Sbjct: 632 QFEAL 636


>gi|167644848|ref|YP_001682511.1| pepF/M3 family oligoendopeptidase [Caulobacter sp. K31]
 gi|167347278|gb|ABZ70013.1| oligoendopeptidase, pepF/M3 family [Caulobacter sp. K31]
          Length = 608

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 219/599 (36%), Positives = 334/599 (55%), Gaps = 21/599 (3%)

Query: 36  LPRWNLEDLYPSHDSQEISNDM--------ECIEHESLAFKTRWEGNLAHATNQKNCHSL 87
           LP WNL DLY   D  +I  D+        E    E L  + R E        ++    L
Sbjct: 22  LPEWNLADLYAGRDDPKIEIDLAAAKAANDELASLEGLFLQARGE-------PERLGVLL 74

Query: 88  GAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEIN 147
              I  YE+    +  + +YA L+ +     P   KF  D+ A+ +      +FF+LE+N
Sbjct: 75  DRGIKLYEQATNGLWSVGAYASLAASIARDDPAWAKFEADLRARSSQIAAESLFFSLELN 134

Query: 148 TLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCE 207
            L++  LE +    P  ++++ W++ +R  + H L+ D+E  + D        + R + E
Sbjct: 135 QLEDGELEAALKAFPAAVRWTPWLRRVRLSRPHELTPDLERYIVDRGPAVSNWV-RLYDE 193

Query: 208 NIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDE 267
            +  L+ K+ D+ + L +A     D+D + RK+AA  L+    +       + NTLA ++
Sbjct: 194 TLAKLKAKVGDETLTLPEALNRLSDADGKRRKAAADGLAQALEERVSTQGLVMNTLAFEK 253

Query: 268 EIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYF 327
           +++DRWR ++  A SRHL+N V+   ++AL  +V   YP+ SHRYY LK K +  +T+ +
Sbjct: 254 QVEDRWRHFDSPAQSRHLANEVDGDAVDALEAAVVEAYPRLSHRYYALKAKVMGRETLDY 313

Query: 328 WDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGA 387
           WDR APL   +     ++ AR +VL SY   +P+ +  A+ FF   WIDA    GK SGA
Sbjct: 314 WDRNAPLTAATPRAYGWDEARQIVLDSYRDLAPKFADAAQTFFAEPWIDARPRAGKQSGA 373

Query: 388 FAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETAS 447
           ++H      HPY+ LN++G+ +DV+TLAHELGH +H  LS+   G L  ++ LTLAETAS
Sbjct: 374 YSHPVTADRHPYVFLNFMGERRDVLTLAHELGHAVHQTLSAPL-GTLLADTPLTLAETAS 432

Query: 448 IFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIP 507
           IFGE L FD LL A ++  +RK LLA KIED LN++VRQI+F+ FE + H  RR  G++ 
Sbjct: 433 IFGEGLVFDRLL-AEATPADRKGLLAGKIEDGLNTVVRQIAFHRFERRFHEARRD-GELS 490

Query: 508 THRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDI 567
             +I  +WLE   ESLGPA  L++  Y  +W  V HF+ + FYVYAYAFG+ LV  L + 
Sbjct: 491 PDQIGRLWLEVMGESLGPAVTLNE-GYEHYWAYVSHFVHAPFYVYAYAFGDLLVRGLMEK 549

Query: 568 YKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + N  + F   Y ++L AG ++ Y E L P  +N  +  FW  G   +E+++D+ E +
Sbjct: 550 RRENP-EAFSPLYEDLLAAGGTRTYVEALKPFGLNPREKAFWAAGCAQLERLVDEFEAL 607


>gi|315498563|ref|YP_004087367.1| oligoendopeptidase, pepf/m3 family [Asticcacaulis excentricus CB
           48]
 gi|315416575|gb|ADU13216.1| oligoendopeptidase, pepF/M3 family [Asticcacaulis excentricus CB
           48]
          Length = 607

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 233/614 (37%), Positives = 342/614 (55%), Gaps = 18/614 (2%)

Query: 22  SDMTTMDSQENLGN-LPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
           +   + DS   L N LP W+L DLY S D  +I+ D       +L    + +GN   A  
Sbjct: 2   TQTASTDSAPTLSNALPVWDLTDLYSSVDDPKIAADF-AEATATLKELQKLQGNFVAA-- 58

Query: 81  QKNCHSLGAAIAE----YERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFE 136
           + N   LG  I +    YER  + +    +Y  L+   +     I K   D+  K A   
Sbjct: 59  RGNAERLGLLIDQAATLYERASDRMAGAMAYTTLASTISREDTRIAKLDADLRNKAALIS 118

Query: 137 KVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQV 196
              +F +LE+N L++  +EQ+        K+  W++ IR  + H LS D+E LL +    
Sbjct: 119 TDSLFLSLELNQLEDWEIEQALRVTEKAQKWRPWLRRIRANRPHELSADLEKLLLE-KMP 177

Query: 197 GREALKRFFCENIESLRFKINDQKIP----LTKAYKSFFDSDREVRKSAAKALSHTFNKS 252
           G  +  R F E +  LR KI  +  P    L +A       D  VRK+AA+ LS     +
Sbjct: 178 GATSWVRLFDETLTRLRVKIGPKSKPEVLTLNEALTRLSSPDEAVRKAAAEGLSVALKDN 237

Query: 253 SHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRY 312
           + + +   NTLA +++++DRWRK+   A SRHL+N V+   ++A+ ++V   Y   SHRY
Sbjct: 238 APVLALALNTLAFEKQVEDRWRKFATPAASRHLANEVDGDGVDAMAEAVGESYAALSHRY 297

Query: 313 YELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTH 372
           Y LK K +    + FWDR APL   +  +  ++ AR +VL S+A+  P  +  A  FF  
Sbjct: 298 YALKAKVMGKTVLNFWDRNAPLTAAAPKLYSWDEARSIVLDSFARLGPDFAERAAVFFEK 357

Query: 373 NWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQG 432
            WIDA   +GK SGA+AH    S HPY++LN+ G+ ++++TLAHELGH +H  L++    
Sbjct: 358 PWIDAQPREGKSSGAYAHPVSSSHHPYVMLNFTGERREMLTLAHELGHAVHQTLAAPLGS 417

Query: 433 ILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDF 492
           IL  ++ LTLAETASIF E L F+ L+ A +S E++K LLA KIED LNS+VRQI+F+ F
Sbjct: 418 ILA-DTPLTLAETASIFAEGLVFEYLV-ADASPEDKKALLAGKIEDGLNSVVRQIAFHRF 475

Query: 493 ELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVY 552
           E + H ER   G++P  R+N +WLE   ESLGPA  L+D  Y  +W  + HF+ + FYVY
Sbjct: 476 EERFHAERLE-GEVPVDRLNALWLEVMGESLGPAITLND-GYEYWWAYISHFVHAPFYVY 533

Query: 553 AYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERG 612
           AYAFG+ LV++L +  + N  + F   Y  +L AG +K Y E L P  +N  +  FWE G
Sbjct: 534 AYAFGDLLVSALMEKRRENP-EAFTPLYAQLLSAGGTKTYVEALAPFGLNPREKAFWEMG 592

Query: 613 LQTVEKMIDDVEKM 626
            Q ++ +ID  E +
Sbjct: 593 CQRLKGLIDQFEAL 606


>gi|302384079|ref|YP_003819902.1| oligoendopeptidase, pepF/M3 family [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302194707|gb|ADL02279.1| oligoendopeptidase, pepF/M3 family [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 602

 Score =  402 bits (1032), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 222/597 (37%), Positives = 337/597 (56%), Gaps = 19/597 (3%)

Query: 37  PRWNLEDLYPSHDSQEISNDMECIEH---ESLAFKTRWEGNLAHATNQKNCHSLGA---- 89
           P W+L DLY S     I+ D+E       E  A K R+         + +  +LGA    
Sbjct: 17  PLWDLSDLYGSRTDARIAADLETARQGVAEMNALKGRF------VAQRGDAPALGATLNR 70

Query: 90  AIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTL 149
           AI  YE+  E +G + +YA L+ +        + F  D+  K+       ++  LEIN L
Sbjct: 71  AITLYEQASERLGALGAYAFLAASTARDDAGAQGFEADLREKITTIATPTVWLTLEINQL 130

Query: 150 DEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENI 209
           DEA +E + + D    K+  W++ +R +K H LS+++E  +++   +  +   R F E +
Sbjct: 131 DEAEIEAALSADADAAKWRPWLRRVRAMKPHELSSELETFIAERMPIAAQ-WPRLFDETL 189

Query: 210 ESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEI 269
            +LR +   + + L++A     D     R+ AA+ L+      +   + + NT+A D+ +
Sbjct: 190 AALRVESGKESLTLSEALNQLSDPKEAKRRGAAEGLNAALAARTSTLALVLNTVAADKAM 249

Query: 270 QDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWD 329
           +DRWR +++ ADSRHL+N V+   ++A+  +V   YPK SHRYY LK K L    +  WD
Sbjct: 250 EDRWRGFKRPADSRHLANEVDGEAVDAMADAVAAAYPKLSHRYYALKAKALGKAKLDQWD 309

Query: 330 RLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFA 389
           R APL  T+     +   R LVL+S+     + S  A +FF   WID     GK SGA+A
Sbjct: 310 RNAPLETTAPRGFDWTQGRALVLESFGDLGSEFSDRAGRFFDKPWIDGRARAGKQSGAYA 369

Query: 390 HGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIF 449
           H      HPY+ LN++G+ +DV+TLAHELGHG+H  L++E +G L  ++ LTLAETASIF
Sbjct: 370 HPVTADRHPYVFLNWMGERRDVLTLAHELGHGVHQTLAAE-RGTLLADTPLTLAETASIF 428

Query: 450 GETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTH 509
            E LTFD LL A + K E++ LLA +IED LN++VRQI+F+ FE + H E R+ G++   
Sbjct: 429 AEGLTFDRLL-ATAPKAEQRGLLAGRIEDGLNTVVRQIAFHRFETRFHDE-RAKGEVSAD 486

Query: 510 RINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYK 569
           R+ ++++E    SLGPA  L+   Y ++W  V HF+ S FYVYAYAFG+ LV +L +  +
Sbjct: 487 RLGDLFIEEMGASLGPAVTLNP-GYETWWSYVSHFVHSPFYVYAYAFGDLLVAALMETRR 545

Query: 570 SNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            +  D F   Y  +L AG +K Y E L P  +N  DP FW  G + +E+++D  E +
Sbjct: 546 KDP-DGFAPLYRELLAAGGTKTYVEALEPFGLNPRDPAFWTIGTRRLERLVDQFEAL 601


>gi|116747980|ref|YP_844667.1| pepF/M3 family oligoendopeptidase [Syntrophobacter fumaroxidans
           MPOB]
 gi|116697044|gb|ABK16232.1| oligoendopeptidase, pepF/M3 family [Syntrophobacter fumaroxidans
           MPOB]
          Length = 589

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 213/587 (36%), Positives = 335/587 (57%), Gaps = 11/587 (1%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           WNL DLY   D+  +  D +     ++ F  R+ G +A  + ++      AAI EYE + 
Sbjct: 10  WNLNDLYSGPDAPAMEQDRQSANDLAVQFAARYRGKVAALSPEEAS----AAIREYEALQ 65

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           E++ ++ +YA L +      P+       I    +   +  +FF LE   +D+     + 
Sbjct: 66  EILQKLDAYAALHFATRTRDPSTGALLQAIREFRSQVHRDTLFFELEWAQIDDEAFAAAL 125

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
               L   Y  +++  R+ + HLL+   E +L++   V  ++    F + +  LRF   +
Sbjct: 126 RHSALG-PYRHYLELSRRYRPHLLTEPEEKILAEKEPVANDSWTTLFDKVLGHLRFGPGE 184

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           +    ++     +  DR VR+ AA+ L+    +   + + I NT+  D+ + DR R+Y  
Sbjct: 185 RTE--SEVLSDLYAGDRTVRQQAARELTQGLTEMLPVLTHIFNTILLDKAVTDRLRRYPH 242

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
              +R+L+N  E  ++EAL+++V + Y     RYY LK+  L  + ++ +DR AP+PG  
Sbjct: 243 WLRARNLANEAEDVMVEALVEAVSSRY-DVVRRYYRLKRTLLGYEELFDYDRYAPIPGLP 301

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
           +    +E A+ LVL  +  FSP+ + IA  FF HNWI AP   GK SGAF+H T+PS HP
Sbjct: 302 KKAFSWEEAKHLVLSGFEAFSPEFAEIASDFFRHNWIHAPVLPGKRSGAFSHPTVPSCHP 361

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           Y+L+N+ G  +DV TLAHELGHG+H VL+ + QG+L  ++ LTLAETAS+FGE + F  L
Sbjct: 362 YVLVNFTGTSRDVATLAHELGHGVHQVLARK-QGLLNADTPLTLAETASVFGEMIVFRHL 420

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
           L+   S++ER  LL +K+ED   ++ RQ+S   FE  +H +RRS G++   RI++ WL++
Sbjct: 421 LERVESRKERAALLCSKLEDSFATVFRQVSMNRFESAVHNQRRSGGELDPERISQFWLDS 480

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
           QK+  G +  L+  +Y  +W  +PHFI S  YVYAYAFG  LV SLY  Y+  T   F  
Sbjct: 481 QKQMFGDSVTLTG-DYRIWWSYIPHFIHSPGYVYAYAFGELLVLSLYRQYR-QTGASFVP 538

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEK 625
            + ++L AG     +ELL P  I+LSDP+FW+RGL+ +E M+D+ E+
Sbjct: 539 LFRDLLEAGGKASPNELLSPFGIDLSDPSFWKRGLEVIEGMLDEAEQ 585


>gi|268317448|ref|YP_003291167.1| oligoendopeptidase, pepF/M3 family [Rhodothermus marinus DSM 4252]
 gi|262334982|gb|ACY48779.1| oligoendopeptidase, pepF/M3 family [Rhodothermus marinus DSM 4252]
          Length = 601

 Score =  393 bits (1010), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 223/585 (38%), Positives = 327/585 (55%), Gaps = 16/585 (2%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           RW+L DLYP  D   +  D+E    E+ AF   + G +     ++       A+  YE I
Sbjct: 9   RWDLTDLYP--DEAALKQDLEQALAEAEAFARTYHGRIGSLEAEELA----EALRRYEAI 62

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQS 157
            + +GR  +YA L ++ N   P        +  +     + L+F  LE   ++     Q 
Sbjct: 63  LDRLGRAYTYAYLHWSTNTEDPARGALLQHVRERYTQASQQLLFLELEWAAVEPERARQL 122

Query: 158 YAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIN 217
              + L   Y  +++  ++++ HLLS   E +L++    GR+A  RFF E + SLRF++N
Sbjct: 123 METEALR-PYRHYLELQQRLRPHLLSEPEEKILAEKRVTGRDAWTRFFDELLGSLRFELN 181

Query: 218 DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYE 277
            Q +   +     +D DREVR+ AA A +          ++I NT+  D+   DR R Y 
Sbjct: 182 GQLLTEQEVLAKLYDPDREVRRQAALAFTEGLKPRIRELTYIFNTVLADKASDDRLRGYR 241

Query: 278 KIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPL--P 335
              +SR+L+N V   ++EAL+++V   Y   + R+YELK++ L LD +Y +DR APL   
Sbjct: 242 TWIESRNLANEVSDEMVEALIRAVTARYDLVA-RFYELKRRLLGLDELYDYDRYAPLKEA 300

Query: 336 GTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPS 395
           GT      +E AR LV ++Y  F P+M  IA +FF   WIDA    GK SGAF+HG +PS
Sbjct: 301 GTR---YRWEEARQLVEEAYRAFHPRMGEIAAQFFERRWIDAAMTPGKRSGAFSHGAVPS 357

Query: 396 VHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTF 455
            HPYILLNY G  +DV TLAHELGHG+H  LS + QGIL  ++ LT AETAS+FGE L F
Sbjct: 358 AHPYILLNYTGTIRDVQTLAHELGHGVHQYLSRK-QGILQADTPLTTAETASVFGEMLVF 416

Query: 456 DSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIW 515
           + LL A +    R  +L  KI+D + ++ RQ++   FE ++H  RR  G++PT    + W
Sbjct: 417 ERLLAAEADPSNRLAMLMGKIDDTMATVFRQVAMNRFEDRMHNARRQQGELPTEAFCDFW 476

Query: 516 LETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDC 575
           +ETQ++    +  L D  Y  +W  +PHFI +  YVYAYAFG  LV +L+  Y+    D 
Sbjct: 477 IETQQDMFRGSVVLGD-HYRYWWSYIPHFIHTPGYVYAYAFGELLVLALFARYRQEGPD- 534

Query: 576 FKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMI 620
           F E+YL +L AG S     L+  L ++L+DP FW  GLQ +E++I
Sbjct: 535 FAERYLQLLEAGGSDWPHVLVGRLGVDLTDPQFWHEGLQAIEELI 579


>gi|295688047|ref|YP_003591740.1| PepF/M3 family oligoendopeptidase [Caulobacter segnis ATCC 21756]
 gi|295429950|gb|ADG09122.1| oligoendopeptidase, pepF/M3 family [Caulobacter segnis ATCC 21756]
          Length = 597

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 219/594 (36%), Positives = 327/594 (55%), Gaps = 13/594 (2%)

Query: 37  PRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGA----AIA 92
           P WNL DLY   D   I  D+      +    +  EG    A  +K    LG      I 
Sbjct: 11  PEWNLADLYVGRDDPRIETDLSAARAANDELAS-LEGMFLEA--RKEPQRLGVLLDRGIT 67

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
            YE+    +  + +YA L+ +     P   KF  D+ A+ +      +FF LE+N L++ 
Sbjct: 68  LYEQATNGLWGVGAYAALAASVARDDPAWAKFEADLRARSSQIAAESLFFTLELNQLEDG 127

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
            + ++    P   +++ W++ +R  + H LS ++E  + D +      + R + E +  L
Sbjct: 128 EIAKALDAHPEAARWAPWLRRVRLSRPHELSPELERFIVDKAPAVANWV-RLWDETLAKL 186

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
              + D+ + L++A     D D   RK+AA  L+      +   +   NTLA +++++DR
Sbjct: 187 TASVGDESLTLSEALNRLSDPDVARRKAAADGLAKALEDRASTQALALNTLAFEKQVEDR 246

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR+YE  A SRHL+N V+   ++AL Q+V   YP+ SHRYY LK K + L T+ +WDR A
Sbjct: 247 WRRYETPAQSRHLANEVDGEAVDALEQAVVEAYPRLSHRYYALKAKVMGLKTLDYWDRNA 306

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PL   +     ++ A+ +VL+S+   +P+ +  A  FF   WIDA    GK SGAFAH  
Sbjct: 307 PLTAAAPRAYAWDEAKGMVLESFQDLAPKFADAARVFFDRPWIDARPRPGKQSGAFAHPV 366

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
               HP++ +NY+G+ +DV+TLAHELGH +H  L  +  G L  ++ LTLAETASIFGE 
Sbjct: 367 TADRHPFVFMNYMGERRDVLTLAHELGHAVHQTL-CQPLGTLLADTPLTLAETASIFGEG 425

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           L FD LL A +S E+RK LLA KIED LN++VRQI+F+ FE + H E R  G++   +I 
Sbjct: 426 LVFDRLL-AETSPEDRKGLLAGKIEDGLNTVVRQIAFHRFERRFH-EARLEGELSPDQIG 483

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
            +WL+   ESLGPA  L+D  Y  +W  V HF  + FYVYAYAFG+ LV  L +  + + 
Sbjct: 484 VLWLDVMGESLGPAVKLND-GYEHYWAYVSHFCHAPFYVYAYAFGDLLVRGLMEKRREDP 542

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              F   Y  +L AG ++ Y E L P  +N  D  FW  G   +E+++D+ E +
Sbjct: 543 A-AFAPLYEELLAAGGTRTYVEALKPFGLNPRDKAFWAAGCAQLERLVDEFEAL 595


>gi|288923849|ref|ZP_06417933.1| oligoendopeptidase, pepF/M3 family [Frankia sp. EUN1f]
 gi|288344804|gb|EFC79249.1| oligoendopeptidase, pepF/M3 family [Frankia sp. EUN1f]
          Length = 618

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 219/601 (36%), Positives = 322/601 (53%), Gaps = 25/601 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  L      + I   +   +  +  F  R  G +A      +   L AAI E   I 
Sbjct: 16  WDLGPLLGGQGEESIDGQLADAQGRAEVFARRHAGRVA----ALDGPGLVAAIGELTAIY 71

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           ELIGR  SYA L ++ + + P        +  +    E  L+FF LE   LD+   E+  
Sbjct: 72  ELIGRAGSYASLRFSTDTADPGRGALMQKVRERSTAIETTLLFFGLEWAALDDDAAERLL 131

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
           A D L  +   +++  R+ + +LLS   E LL++ S  GR A  R F E + ++     D
Sbjct: 132 AADGLD-QARHYLRTERRYRPYLLSEPEEKLLTEKSVTGRAAWSRLFSEQVSAIEVGAGD 190

Query: 219 QKIP---------------LTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTL 263
                              L  A      SDREVR++ A+A++          ++I NTL
Sbjct: 191 AGGTGEAGGVGDAGAGGEALDVALSRLASSDREVRRATAEAVTAALAPGLRTRAYIFNTL 250

Query: 264 AKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLD 323
             D+ + DR R Y     SR+L+N V    ++AL+ +V+  Y     R+Y LK + L L 
Sbjct: 251 IHDKAVNDRLRGYPTWLTSRNLANEVSDESVQALVAAVRERY-DIPQRWYRLKARILGLP 309

Query: 324 TMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGK 383
            +  +DR+A +  T+ +   +E +RDLVL S+  FSP+M+  A +FF   WIDAP   GK
Sbjct: 310 RLADYDRMAAVT-TADEHFGWEQSRDLVLDSFGSFSPEMARQARRFFDEKWIDAPVRPGK 368

Query: 384 GSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLA 443
             GAFA   +PSVHPY++LN+  + +DV+TLAHELGHGIHF L+++ QGIL  N+ LT+A
Sbjct: 369 RGGAFASSAVPSVHPYVMLNFTSRRRDVLTLAHELGHGIHFALAAK-QGILQQNTPLTVA 427

Query: 444 ETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRST 503
           ETAS+FGET+ F+ LL   S  E+R  LLA  +E  + ++ RQI+   FE  +HT+RR+ 
Sbjct: 428 ETASVFGETIVFNRLLAQTSDPEQRLALLAEAVEGAIATVFRQIAMNQFEQAVHTQRRTA 487

Query: 504 GDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNS 563
           G++     NE W+ +Q+E LG + +L++  Y ++W  VPHFI +  YVYAYA+G  L  S
Sbjct: 488 GELSVDAFNEAWVASQRELLGDSVELTE-GYRTWWSYVPHFIGTPGYVYAYAYGQLLALS 546

Query: 564 LYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDV 623
           +Y  Y  +    F   YL +L AG S+   EL   + I+L+DP FW  GL  VE  +   
Sbjct: 547 VYQRYVEDG-GAFVPHYLEMLAAGGSRSPEELGRIVGIDLADPGFWAAGLDLVEGQLRAA 605

Query: 624 E 624
           E
Sbjct: 606 E 606


>gi|16127543|ref|NP_422107.1| peptidase M3 family protein [Caulobacter crescentus CB15]
 gi|221236358|ref|YP_002518795.1| oligoendopeptidase F [Caulobacter crescentus NA1000]
 gi|13425009|gb|AAK25275.1| peptidase M3 family protein [Caulobacter crescentus CB15]
 gi|220965531|gb|ACL96887.1| oligoendopeptidase F [Caulobacter crescentus NA1000]
          Length = 596

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 219/594 (36%), Positives = 330/594 (55%), Gaps = 13/594 (2%)

Query: 37  PRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGA----AIA 92
           P WNL DLY   D   I  D+   +  +    +  EG    A  +K    LG      I 
Sbjct: 11  PEWNLADLYVGRDDPRIETDLAAAKAANDELAS-LEGMFLEA--RKEPERLGVLLDRGIT 67

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
            YE+    +  + +YA L+ +     P   KF  D+ A+ +      +FF LE+N L+++
Sbjct: 68  LYEQATNGLWGVGAYAALAASVARDDPAWAKFEGDLRARSSQIAAESLFFTLELNQLEDS 127

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
            + ++    P   +++ W++ +R  + H LS ++E  + D +      + R + E +  L
Sbjct: 128 EIAKALQAHPDAARWAPWLRRVRLSRPHELSPELERFIVDKAPAVANWV-RLYDETLAKL 186

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
             K  D+ + L +A     D   E RK+AA  L+      +   + + NTLA +++++DR
Sbjct: 187 TAKAGDETLTLAEALNRMSDPSVERRKAAADGLAAALEARASTQALVLNTLAFEKQVEDR 246

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR+YE  A SRHL+N V+   ++AL Q+V   YP+ SHRYY LK K + + T+ +WDR A
Sbjct: 247 WRRYETPAQSRHLANEVDADAVDALEQAVVEAYPRLSHRYYALKAKVMGVATLDYWDRNA 306

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PL   +     ++ A+ +VL+S+   +P+ +  A  FF   WIDA    GK SGAFAH  
Sbjct: 307 PLTAAAPRAYAWDEAKSMVLESFQDLAPKFADAARVFFDKPWIDAMPRPGKQSGAFAHPV 366

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
               HP++ +NY+G+ +DV+TLAHELGH +H  L  +  G L  ++ LTLAETASIFGE 
Sbjct: 367 TADRHPFVFMNYMGERRDVLTLAHELGHAVHQTL-CQPLGTLLADTPLTLAETASIFGEG 425

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           L FD LL A +S E+RK LLA KIED LN++VRQI+F+ FE + H E R  G++   +I 
Sbjct: 426 LVFDRLL-AEASPEDRKGLLAGKIEDGLNTVVRQIAFHRFERRFH-EARQDGELSPDQIG 483

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
            +WLE   ESLGPA  L +  Y  +W  V HF  + FYVYAYAFG+ LV  L +  + + 
Sbjct: 484 ALWLEVMGESLGPAVKL-NAGYEHYWAYVSHFCHAPFYVYAYAFGDLLVRGLMEKRRED- 541

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           ++ F   Y  +L AG +K Y E L P  +N  +  FW  G   +E+++D+ E +
Sbjct: 542 LERFAPLYEQLLAAGGTKTYVEALAPFGLNPREKAFWAAGCAQLERLVDEFESL 595


>gi|83814939|ref|YP_445436.1| oligoendopeptidase F [Salinibacter ruber DSM 13855]
 gi|83756333|gb|ABC44446.1| oligoendopeptidase F [Salinibacter ruber DSM 13855]
          Length = 607

 Score =  375 bits (963), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 206/600 (34%), Positives = 332/600 (55%), Gaps = 12/600 (2%)

Query: 27  MDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS 86
           M++ +   +  RW L+DLY   D+  +  D+  +E ++ AF  ++ G +     +    +
Sbjct: 1   METPDTGADDVRWALDDLYDDPDA--LEEDLASLEADATAFAEQYRGRI----GELGPEA 54

Query: 87  LGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEI 146
           L  A+     + + +GR  +YA L +  + +          +   +   ++ L+FF  E 
Sbjct: 55  LSEALDTLGALQDRLGRAHAYAHLYWTADTNDAERGALRQSVQETVDRIQQRLVFFDTEW 114

Query: 147 NTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFC 206
             LD   +E     + L   Y  +++   + K+H+LS   E +LS+ S  G+ A  RFF 
Sbjct: 115 VALDPERVEDLLGHEALD-DYRHYLETEYQRKEHVLSEAEEKVLSEKSITGKNAWTRFFD 173

Query: 207 ENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKD 266
           E + + RF+++ + +   +     +D DR VR+ AA A +          +++ NTL  D
Sbjct: 174 ETLGAARFELDGESLTQEQTLSKLYDPDRTVRREAAHAFTDGLKDHLRTLTYVFNTLLAD 233

Query: 267 EEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMY 326
           +   DR R Y+   + R+L+N V+   ++ L+++V   Y   + R+Y LKK+ L +D +Y
Sbjct: 234 KASTDRLRDYDHWLEQRNLANEVDDETVDTLIEAVTGRYDLVA-RFYRLKKQLLDVDELY 292

Query: 327 FWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSG 386
            +DR AP+   +     +  AR LVL++Y  F P M+ +A +FF  +WIDA    GK SG
Sbjct: 293 DYDRYAPIR-EADSTYEWGDARALVLEAYGDFHPTMAQVARQFFEGDWIDAALVPGKRSG 351

Query: 387 AFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETA 446
           AF+HGT+PS HPY+LLNY GKP+DV TLAHELGHG+H  L+ E Q I  + + LT AE A
Sbjct: 352 AFSHGTVPSAHPYVLLNYTGKPRDVQTLAHELGHGVHQSLARE-QSIFHHGTPLTTAEMA 410

Query: 447 SIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDI 506
           S+FGE L F  L++       R  LL  KI+D L ++ RQ++   FE ++HT RR+ G++
Sbjct: 411 SVFGEMLVFQRLMRNEEDPANRLALLVAKIDDTLATVFRQVAMNRFEHRIHTARRNQGEL 470

Query: 507 PTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYD 566
              +  E W+ETQ+     +  L +  Y  +W  VPHF+ +  YVYAYAFG  LV +LY 
Sbjct: 471 QADQFAEHWMETQRAMFEGSVTLGE-HYQHWWSYVPHFLHTPGYVYAYAFGELLVLALYA 529

Query: 567 IYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            Y+S+    F ++YL++LRAG S    EL+  + ++L D +FW  GL  +E +I++ E +
Sbjct: 530 RYESSD-GGFADRYLDLLRAGGSDWPHELVGQMGVDLEDEDFWTGGLSHIEALIEEAEAL 588


>gi|294507320|ref|YP_003571378.1| oligoendopeptidase F [Salinibacter ruber M8]
 gi|294343648|emb|CBH24426.1| oligoendopeptidase F [Salinibacter ruber M8]
          Length = 607

 Score =  375 bits (963), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 206/600 (34%), Positives = 332/600 (55%), Gaps = 12/600 (2%)

Query: 27  MDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS 86
           M++ +   +  RW L+DLY   D+  +  D+  +E ++ AF  ++ G +     +    +
Sbjct: 1   METPDTGADDVRWALDDLYDDPDA--LEEDLASLEADATAFAEQYRGRI----GELGPEA 54

Query: 87  LGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEI 146
           L  A+     + + +GR  +YA L +  + +          +   +   ++ L+FF  E 
Sbjct: 55  LSEALDTLGALQDRLGRAHAYAHLCWTADTNDAERGALRQSVQETVDRIQQRLVFFDTEW 114

Query: 147 NTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFC 206
             LD   +E     + L   Y  +++   + K+H+LS   E +LS+ S  G+ A  RFF 
Sbjct: 115 VALDPERVEDLLGHEALD-DYRHYLETEYQRKEHVLSEAEEKVLSEKSITGKNAWTRFFD 173

Query: 207 ENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKD 266
           E + + RF+++ + +   +     +D DR VR+ AA A +          +++ NTL  D
Sbjct: 174 ETLGAARFELDGEPLTQEQTLSKLYDPDRTVRREAAHAFTDGLKDHLRTLTYVFNTLLAD 233

Query: 267 EEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMY 326
           +   DR R Y+   + R+L+N V+   ++ L+++V   Y   + R+Y LKK+ L +D +Y
Sbjct: 234 KASTDRLRDYDHWLEQRNLANEVDDETVDTLIEAVTGRYDLVA-RFYRLKKQLLDVDELY 292

Query: 327 FWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSG 386
            +DR AP+   +     +  AR LVL++Y  F P M+ +A +FF  +WIDA    GK SG
Sbjct: 293 DYDRYAPIR-EADSTYEWGDARALVLEAYGDFHPTMAQVARQFFEGDWIDAALVPGKRSG 351

Query: 387 AFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETA 446
           AF+HGT+PS HPY+LLNY GKP+DV TLAHELGHG+H  L+ E Q I  + + LT AE A
Sbjct: 352 AFSHGTVPSAHPYVLLNYTGKPRDVQTLAHELGHGVHQSLARE-QSIFHHGTPLTTAEMA 410

Query: 447 SIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDI 506
           S+FGE L F  L++       R  LL  KI+D L ++ RQ++   FE ++HT RR+ G++
Sbjct: 411 SVFGEMLVFQRLMRNEEDPANRLALLVAKIDDTLATVFRQVAMNRFEHRIHTARRNQGEL 470

Query: 507 PTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYD 566
              +  E W+ETQ+     +  L +  Y  +W  VPHF+ +  YVYAYAFG  LV +LY 
Sbjct: 471 QADQFAEHWMETQRAMFEGSVTLGE-HYQHWWSYVPHFLHTPGYVYAYAFGELLVLALYA 529

Query: 567 IYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            Y+S+    F ++YL++LRAG S    EL+  + ++L D +FW  GL  +E +I++ E +
Sbjct: 530 RYESSD-GGFADRYLDLLRAGGSDWPHELVGQMGVDLEDEDFWTGGLSHIEALIEEAEAL 588


>gi|329850360|ref|ZP_08265205.1| oligoendopeptidase, pepF/M3 family protein [Asticcacaulis
           biprosthecum C19]
 gi|328840675|gb|EGF90246.1| oligoendopeptidase, pepF/M3 family protein [Asticcacaulis
           biprosthecum C19]
          Length = 638

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 223/609 (36%), Positives = 340/609 (55%), Gaps = 18/609 (2%)

Query: 24  MTTMDSQENLGN-LPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           MT M +  NL + LP W+L DLY   +  +I+ D    E   +    + +G+   A  + 
Sbjct: 41  MTQMPT--NLDSALPVWDLTDLYTGPEDPKIAQDFASGEGH-IKELAKLQGSFLSA--RG 95

Query: 83  NCHSLGAAIAE----YERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKV 138
           N   LG  I +    YE+  + +G   +YA L+   +  +P I K  +D+ A+ +     
Sbjct: 96  NPERLGLLIDQAASLYEKAMDDMGGALAYATLASTIDRENPQIAKLQSDLGAQASMISSD 155

Query: 139 LIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDME-CLLSDTSQVG 197
            ++ +LE+N LD+  +EQ+        K+  W++ IR  + H LS ++E  +L     VG
Sbjct: 156 SLYLSLELNKLDDWEIEQALKAVDKAQKWRPWLRRIRASRPHELSAELERLMLERAPAVG 215

Query: 198 REALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           +    R F E +  LR K+  +++ L +A          VRK+AA  L+    +++ + +
Sbjct: 216 Q--WTRLFDETLTRLRAKVGKEQLTLNEALTRLSSPQPAVRKAAAGGLTEALKENAPVLA 273

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
              NTLA +++++DRWRKYE  A SRHL+N V+   ++A+  +V   Y   SHRYY+LK 
Sbjct: 274 LALNTLAFEKQVEDRWRKYEAPAASRHLANEVDKDAVDAMADAVAESYTALSHRYYKLKA 333

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           + L    + FWDR APL    Q    ++ ++ +VL S+ +   + +  A+ FF   WIDA
Sbjct: 334 RILGKKQLDFWDRNAPLTQEVQKKYGWDESKKIVLDSFRQMGIEFADRAQVFFDRPWIDA 393

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
               GK SGA+AH    + HPY++LN+ G  ++V+TLAHELGH +H  L      IL  +
Sbjct: 394 APRPGKSSGAYAHPVTANRHPYVMLNFTGDRREVLTLAHELGHAVHQTLCQPLGSILA-D 452

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
           + LTLAETASIF E L F+ L+ A +S E++K LLA KIED LNS++RQI+F+ FE + H
Sbjct: 453 TPLTLAETASIFAEGLVFEHLV-ADASAEDKKALLAGKIEDCLNSVIRQIAFHRFEERFH 511

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
             R   G++   +IN IWLE   ESLGPA  L+D  Y  +W  V HF+ + FYVYAYAFG
Sbjct: 512 ATRLD-GEVSVPQINAIWLEVMGESLGPAIKLND-GYEYWWAYVSHFVHAPFYVYAYAFG 569

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
           + LV++L +  + +    F   Y  +L  G +K Y+E L P  +N  D  FW+ G   +E
Sbjct: 570 DLLVSALMEKRRQDP-QGFTPLYKTLLSGGGTKAYTEALAPFGMNPRDKAFWKMGCARLE 628

Query: 618 KMIDDVEKM 626
            +ID  E +
Sbjct: 629 GLIDGFEAL 637


>gi|320354437|ref|YP_004195776.1| peptidase M3A and M3B thimet/oligopeptidase F [Desulfobulbus
           propionicus DSM 2032]
 gi|320122939|gb|ADW18485.1| peptidase M3A and M3B thimet/oligopeptidase F [Desulfobulbus
           propionicus DSM 2032]
          Length = 593

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 209/601 (34%), Positives = 323/601 (53%), Gaps = 13/601 (2%)

Query: 26  TMDSQENLGNLP-RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC 84
           T++  + LG     W+L  LYP      I  DM      + +  T   G +       + 
Sbjct: 2   TIELNQQLGTTEVLWDLAALYPGEAGPTIECDMRHCRQMAESLSTETAGKI----KDLDT 57

Query: 85  HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL 144
            ++   +   E I  L+ R+ ++A L +               +    A    + +FF L
Sbjct: 58  ATIKTVVERLEAIDTLLARLEAFAFLRFITQTGDAAASALLQQVEELEAAVGTLTVFFRL 117

Query: 145 EINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRF 204
           E N LD   +EQ + Q P   +Y+ +++ +R+   + LS+  E LL +   VGR A    
Sbjct: 118 EWNRLDAYRVEQ-HLQQPELHRYAHYLRTLRQFAPYQLSSKEEELLQELRPVGRSAWNVL 176

Query: 205 FCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLA 264
           F + +  LRF    +     +     +  DREVRK+ A  L+     + H+ + I NTLA
Sbjct: 177 FEKLLGQLRFGARGRTE--EEVLNDLYHPDREVRKNGAAELTEGLRANLHLLTHIFNTLA 234

Query: 265 KDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDT 324
            ++ I DR R+Y     + +L+N +E   +E L+ +V + Y    HRYY LKK  L  + 
Sbjct: 235 AEKMIDDRLRRYPSWDSAINLANELERQTVETLVTAVTSRY-DIVHRYYRLKKDLLGCEE 293

Query: 325 MYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKG 384
           +Y +DR AP+PG  +  IP+   R +VL+S+A FSP M+ IA++FFT NWI AP   GK 
Sbjct: 294 LYDYDRYAPVPGGEEAAIPWNQCRQIVLESFADFSPVMANIAKQFFTDNWIHAPVLQGKR 353

Query: 385 SGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAE 444
            GAF+H  +P  HPYIL+NY G  +DV T+AHELGHG+H  L++E QG   +++ L LAE
Sbjct: 354 GGAFSHPCVPEAHPYILVNYTGNIRDVSTVAHELGHGVHQYLAAE-QGFYNSDTPLVLAE 412

Query: 445 TASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTG 504
           TAS+F E L F + ++  S+   R+  +  K+E +  ++ RQ++   FE  +H  RR  G
Sbjct: 413 TASVFAELLVFKAQIRIMSTPAARRAFICQKLESIFATVFRQVAMNRFEAAMHGGRRH-G 471

Query: 505 DIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSL 564
           ++   +++  WLETQ+   G +  L D +Y  +W  + HF+ +  YVYAYAFG  LV +L
Sbjct: 472 ELSAEQLSTFWLETQRPMFGDSLTLRD-DYAIWWAYISHFLGTPGYVYAYAFGELLVLAL 530

Query: 565 YDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVE 624
           Y  +     + F ++YL +LRAG S+   ELL P  I+L+DP FW  GL  VE+M+ + E
Sbjct: 531 YGRFIEEGPN-FVDQYLMLLRAGGSRSPYELLRPFGIDLNDPAFWFGGLGVVEQMLMEAE 589

Query: 625 K 625
           +
Sbjct: 590 Q 590


>gi|94263231|ref|ZP_01287048.1| peptidase [delta proteobacterium MLMS-1]
 gi|93456449|gb|EAT06569.1| peptidase [delta proteobacterium MLMS-1]
          Length = 591

 Score =  364 bits (935), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 200/587 (34%), Positives = 323/587 (55%), Gaps = 11/587 (1%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W L+DLY   D+ ++  D+   E E+ A   ++ G+LA    + +   L   +   E + 
Sbjct: 16  WKLDDLYAGADAPQLRGDLAHCEQEAQAIHRQFAGHLA----ELDAAGLADLVERLEELE 71

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
             +GR+A++AML++  N            I    +   K  IFF LE N L  A  E   
Sbjct: 72  ARLGRVATFAMLNFTTNTKDAAAGALLQQIREIGSRIGKETIFFELEWNRLTAAEAEVLL 131

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
           A   L   Y   + ++R+   H+LS+  E LL + +  GR +    F + +  L+F    
Sbjct: 132 AAGELA-HYRHHLASLRRYAPHMLSDAEEALLLEKAPAGRGSWTTLFDKVMGHLKFGATG 190

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           +     +         R+ R+ AA  L+   +   H+ +   NTL  D+ I DR R+Y  
Sbjct: 191 RSE--EEVLSDLHLPQRDKRQQAAAELTAGLDSQLHVLTHTFNTLLADKMIDDRLRQYPH 248

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
              S +L N +    +  L+++V   Y     RYY+LKK+ L +D +  +DR APLP   
Sbjct: 249 WLSSMNLYNELADQTVNTLIEAVTGRY-DIPQRYYQLKKELLGVDELLDYDRYAPLPHLP 307

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
           + ++ +  AR+LVL ++A F+P+M+ IAE+FF  +WI AP  +GK  GAFAH  +P+VHP
Sbjct: 308 EQVVAWPQARELVLAAFADFTPEMAEIAERFFAESWIHAPLLEGKRGGAFAHPAVPAVHP 367

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           YI++NY G  +D+ T+AHELGHG+H  L+S+ +G   ++++L LAETAS+F E L F+  
Sbjct: 368 YIMVNYTGNLRDISTVAHELGHGVHQYLASQ-RGYYNSSTTLVLAETASVFAELLLFNRQ 426

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
           L+  +  E R+     K+E +  ++ RQ++   FE ++H  RR  G++ +  I+  WL +
Sbjct: 427 LELLADPEARRAFTCQKLESIFATVFRQVAMNRFEDRVHHARRQQGELSSEEISRHWLAS 486

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
           Q+E    +  LSD +Y  +W  +PHF+ +  YVY+YAFG  LV +LY +Y+ +    F  
Sbjct: 487 QREMFADSVTLSD-DYARWWSYIPHFLNTPGYVYSYAFGELLVLALYRLYQQDR-QAFVP 544

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEK 625
           +YL +L+AG S    ELL P  ++L+DP FW  GL  +++M+ +VE+
Sbjct: 545 QYLELLKAGGSASPYELLKPFGVDLNDPAFWAGGLTVIDEMLREVEE 591


>gi|94265629|ref|ZP_01289371.1| peptidase [delta proteobacterium MLMS-1]
 gi|93453839|gb|EAT04202.1| peptidase [delta proteobacterium MLMS-1]
          Length = 591

 Score =  363 bits (932), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 200/587 (34%), Positives = 322/587 (54%), Gaps = 11/587 (1%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W L+DLY   D  ++  D+   E E+ A   ++ G+LA    + +   L   +   E + 
Sbjct: 16  WKLDDLYAGADDPQLRGDLAHCEQEAQAIHRQFAGHLA----ELDAAGLADLVERLEELE 71

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
             +GR+A++AML++  N            I    +   K  IFF LE N L  A  E   
Sbjct: 72  ARLGRVATFAMLNFTTNTKDAAAGALLQQIREIGSRIGKETIFFELEWNRLTAAEAEVLL 131

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
           A   L   Y   + ++R+   H+LS+  E LL + +  GR +    F + +  L+F    
Sbjct: 132 AAGELA-HYRHHLASLRRYAPHMLSDAEEALLLEKAPAGRGSWTTLFDKVMGHLKFGATG 190

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           +     +         R+ R+ AA  L+   +   H+ +   NTL  D+ I DR R+Y  
Sbjct: 191 RSE--EEVLSDLHLPQRDKRQQAAAELTAGLDSQLHVLTHTFNTLLADKMIDDRLRQYPH 248

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
              S +L N +    +  L+++V   Y     RYY+LKK+ L +D +  +DR APLP   
Sbjct: 249 WLSSMNLYNELADQTVNTLIEAVTGRY-DIPQRYYQLKKELLGVDELLDYDRYAPLPHLP 307

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
           + ++ +  AR+LVL ++A F+P+M+ IAE+FF  +WI AP  +GK  GAFAH  +P+VHP
Sbjct: 308 EQVVAWPQARELVLAAFADFTPEMAEIAERFFAESWIHAPLLEGKRGGAFAHPAVPAVHP 367

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           YI++NY G  +D+ T+AHELGHG+H  L+S+ +G   ++++L LAETAS+F E L F+  
Sbjct: 368 YIMVNYTGNLRDISTVAHELGHGVHQYLASQ-RGYYNSSTTLVLAETASVFAELLLFNRQ 426

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
           L+  +  E R+     K+E +  ++ RQ++   FE ++H  RR  G++ +  I+  WL +
Sbjct: 427 LELLADPEARRAFTCQKLESIFATVFRQVAMNRFEDRVHHARRQQGELSSEEISRHWLAS 486

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
           Q+E    +  LSD +Y  +W  +PHF+ +  YVY+YAFG  LV +LY +Y+ +    F  
Sbjct: 487 QREMFADSVTLSD-DYARWWSYIPHFLNTPGYVYSYAFGELLVLALYRLYQQDR-QAFVP 544

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEK 625
           +YL +L+AG S    ELL P  ++L+DP FW  GL  +++M+ +VE+
Sbjct: 545 QYLELLKAGGSASPYELLKPFGVDLNDPAFWAGGLTVIDEMLREVEE 591


>gi|198284386|ref|YP_002220707.1| peptidase M3A and M3B thimet/oligopeptidase F [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218666206|ref|YP_002427051.1| oligoendopeptidase F, putative [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|198248907|gb|ACH84500.1| peptidase M3A and M3B thimet/oligopeptidase F [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218518419|gb|ACK79005.1| oligoendopeptidase F, putative [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 598

 Score =  360 bits (924), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 209/588 (35%), Positives = 306/588 (52%), Gaps = 10/588 (1%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W LEDLY   D   ++ DM      +  F   +   L       N   L AA+ + E I 
Sbjct: 17  WRLEDLYAGVDDPRLAEDMRWANGAATRFAEAYRPGLGGL----NAAQLAAALEQLEAIR 72

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           + IGR+ ++  LSY  +   P                +  LIFF +  N +D+A      
Sbjct: 73  QRIGRVGTFRYLSYVTHADQPAYGAALQAYEEAATAIQNQLIFFDIAWNAVDDARAGALL 132

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
           A DP    ++  ++N RK + HL S   E +LS+    GR   +R F E +  +RF +  
Sbjct: 133 A-DPALAHWTHLLRNWRKYRDHLRSESEEQILSEKRVTGRGLWERLFDETLTEMRFPLRG 191

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           +++   +      + DRE+R+ AA++LS       H  +   N +  D+ + DR R+Y  
Sbjct: 192 KQMSEQEVLTLLSNPDRELRRDAAESLSKGLEGRLHTLTTCFNAVLADKSLDDRLRRYPH 251

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
               R+LSN +   ++EAL Q+V   Y   + RYY LK K L L  +  +DR APLPG  
Sbjct: 252 WLSERNLSNEISDGMVEALEQAVVGRYGLVA-RYYRLKAKLLNLSPLMDYDRYAPLPGGD 310

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
           +     E  R +VL +   FSP++  I ++FF   WIDA    GK  GAFAH   P VHP
Sbjct: 311 RRYDWAEC-RRIVLAAVTDFSPELGGIGQRFFDEGWIDAALAPGKRGGAFAHPVTPDVHP 369

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           Y+++NY G  +DVMT+AHELGHGIH  L +  QG L  ++ LT AETAS+FGE LTF+ L
Sbjct: 370 YLMVNYTGTVRDVMTVAHELGHGIHQYL-ARGQGYLNADTPLTTAETASVFGEMLTFEQL 428

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
           ++       R  LL  KIED   ++ RQ++ + FE+ +H  RR+ G++   R+ E+W++T
Sbjct: 429 MREEQDPRRRLGLLCGKIEDTFATVFRQMAMHRFEVVMHGARRAEGELSKDRLAELWMQT 488

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
           Q E    +   S   Y  +W  +PHFI S  YVYAYAFG  L  +L   Y++   D F  
Sbjct: 489 QTEQFADSIQFSP-GYRWWWSYIPHFIGSPGYVYAYAFGELLTLALIQRYRAAPAD-FVP 546

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            Y  +L+ G SK  +E++    I+L DP  W R L  +  M+D+ EK+
Sbjct: 547 GYTAMLKLGGSKAPAEVVATTGIDLEDPEIWSRALDYMSGMVDEAEKL 594


>gi|297568943|ref|YP_003690287.1| peptidase M3A and M3B thimet/oligopeptidase F [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296924858|gb|ADH85668.1| peptidase M3A and M3B thimet/oligopeptidase F [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 590

 Score =  358 bits (920), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 202/586 (34%), Positives = 311/586 (53%), Gaps = 11/586 (1%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W LEDLY S D   ++ D+   E E+ A +  + G LA        H     +   E + 
Sbjct: 16  WQLEDLYHSPDDPTLAADLSACEEEAGAIRAEFAGRLAALEPTALLH----LVRRLETLE 71

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
             +GR A+YA L++               I    +   K  +FF LE + L+ A+ EQ  
Sbjct: 72  ARLGRAATYAYLNFATQTKDAAAGALLQKIREAGSRASKETVFFELEWSRLEAAVAEQLM 131

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
           A  P    Y   + ++R+   HLLS+  E LL + +  GR +    F + +  L+F  + 
Sbjct: 132 AA-PELAPYRHHLASLRRYAPHLLSDAEETLLIERAPAGRSSWTTLFDKVMGHLQFGESG 190

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           +     +     +  DR++R+ AA  L+       H+ +   NTL  D+ I DR R+Y  
Sbjct: 191 RSE--EEVLSDLYLPDRDLRRQAAAELTAGLGSQLHVLTHSFNTLLADKMIDDRQRRYPN 248

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
              S +L N +    +E L+ +V   Y     RYY LK++ L LD +  +DR APLP   
Sbjct: 249 WLSSMNLYNELNDTTVETLITAVTARY-DIPQRYYRLKRQLLGLDELLDYDRYAPLPDLP 307

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
              + +E  R LVL+++A+FSP M+  AE FF   WI AP  +GK  GAFAH  +P VHP
Sbjct: 308 TTTVNWEQCRKLVLEAFAEFSPDMAANAELFFQRRWIHAPLLEGKRGGAFAHPAVPEVHP 367

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           YI++NY G  +D+ T+AHELGHG+H  L++  QG   ++++L LAETAS+F E L F   
Sbjct: 368 YIMVNYTGNLRDISTVAHELGHGVHQYLAA-AQGYYNSSTTLVLAETASVFAELLLFKRQ 426

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
           L      E R+     K+E +  ++ RQI+   FE ++H  RR  G++ + +I+  W  +
Sbjct: 427 LALIEKPEARRAFTCQKLESIFATVFRQIAMNRFEDRVHNARRQEGELSSEQISAQWRAS 486

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
           Q+E    +  L+  +Y ++W  +PHF+ +  YVY+YAFG  LV +L+ +Y+ N  D F  
Sbjct: 487 QEEMFADSVRLTT-DYDTWWSYIPHFLSTPGYVYSYAFGELLVLALFKLYQQNPAD-FVP 544

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVE 624
           KYL +L+ G S    +L+ P  +NL DP FW  GLQ +++M+ +VE
Sbjct: 545 KYLELLKNGGSASPYQLVKPFGVNLDDPAFWAGGLQVIDEMLQEVE 590


>gi|51245294|ref|YP_065178.1| oligopeptidase [Desulfotalea psychrophila LSv54]
 gi|50876331|emb|CAG36171.1| related to oligopeptidase [Desulfotalea psychrophila LSv54]
          Length = 606

 Score =  354 bits (909), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 195/619 (31%), Positives = 332/619 (53%), Gaps = 24/619 (3%)

Query: 5   PDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHES 64
           P  ++  ++   K L+++D+              WNL+DLY S +  +I  D+     E+
Sbjct: 12  PKEQYMESSTLNKNLQTTDII-------------WNLQDLYQSPNDPQIETDLNWCSGEA 58

Query: 65  LAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKF 124
           +A +  W G +A  +       L   +A  E +     ++ +Y+ L++   + + T    
Sbjct: 59  IALREEWSGKIATISPA----DLALLVARLEALDCRFTKLGTYSFLNFTTQMDNSTAGAL 114

Query: 125 YTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSN 184
              ++ + +     ++FF LE   L    ++Q      +   Y  +++ + K + H+LS 
Sbjct: 115 DQRVHEQYSRSSAEIVFFELEWTHLSSKRIDQLLTAPEIAF-YRHYLEALNKNRPHMLSE 173

Query: 185 DMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKA 244
             E LL +    GR +    F +    L+F   + +    +     +   RE R  AA  
Sbjct: 174 KEEQLLQEKEITGRSSWTTLFEKVFAHLKF--GETRRSEEEVLTELYSEHRETRMHAALE 231

Query: 245 LSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNY 304
           ++       HI + I NTLA ++ + DR R+Y+    S +++N +E   ++AL+ +V N 
Sbjct: 232 MTEGLQSQLHILTHIFNTLAAEKMVTDRIRRYDGWLSSMNIANELEESTVDALVDAVTNR 291

Query: 305 YPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSI 364
           Y     +YY +K++ L L+ +Y +DR APLP        ++  +++VL S+A+FSP+M+ 
Sbjct: 292 Y-DIVEKYYNIKREILGLEELYDYDRYAPLPHLPTGTTSWQECKEIVLSSFAEFSPKMAE 350

Query: 365 IAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHF 424
           IA +FF   WI AP  D K  GAFAH  +P VHPY+L+NY G  +D+ T+AHELGHG+H 
Sbjct: 351 IAGEFFAKGWIHAPIQDTKRGGAFAHPCVPEVHPYVLVNYTGNIRDISTVAHELGHGVHQ 410

Query: 425 VLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIV 484
           VL++  QG   +++ L LAETAS+F E L F + L+  SS EE+K L+  K+E +  ++ 
Sbjct: 411 VLAA-GQGHFNSDTPLPLAETASVFAELLVFKAQLKLLSSPEEKKALICQKLESIFATVF 469

Query: 485 RQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHF 544
           RQ +   FE  +H  RR  G++    +++ W+++Q+   G +  L+   Y  +W  +PHF
Sbjct: 470 RQTAMNRFEDSMHRGRREKGELSDEELSQFWIDSQQAMFGDSVQLTS-NYRIWWSYIPHF 528

Query: 545 IESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLS 604
           + +  YVY+YAFG  LV +LY IY++   + F  KYL +L AG S    +LL P   +L+
Sbjct: 529 LATPGYVYSYAFGELLVLALYGIYQTEG-EAFVAKYLELLSAGGSSSPYDLLKPFGFDLN 587

Query: 605 DPNFWERGLQTVEKMIDDV 623
           DP FW++GL  +E+M++ +
Sbjct: 588 DPAFWQKGLGVIEEMVESL 606


>gi|197106569|ref|YP_002131946.1| oligoendopeptidase, PepF/M3 family [Phenylobacterium zucineum HLK1]
 gi|196479989|gb|ACG79517.1| oligoendopeptidase, PepF/M3 family [Phenylobacterium zucineum HLK1]
          Length = 570

 Score =  349 bits (896), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 204/568 (35%), Positives = 304/568 (53%), Gaps = 9/568 (1%)

Query: 36  LPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGA--AIAE 93
           LP+W L+DLY   +   I  D+      +       +G L  A              I  
Sbjct: 10  LPQWRLDDLYADREDPRIEADLASAAQATAQLAAL-KGRLVGARAAAAELGALLDQGIRL 68

Query: 94  YERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEAL 153
           YE     +  + +YA L+ +   + P   KF  D+ A+ A      +FF LEIN L++A 
Sbjct: 69  YEDATNHLWSVGAYASLAASTARNDPAWSKFEADLRARSAQIGAESLFFTLEINQLEDAE 128

Query: 154 LEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLR 213
           LE +    P   ++  W++ +R  + H LS ++E +L D        + R   E + +L 
Sbjct: 129 LEAALQARPEAGRWRPWLRRVRAARPHELSAELERMLVDRGPAVANWM-RLSDETLAALT 187

Query: 214 FKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRW 273
            ++  + + L +      D +   RK AA+AL+      + + +   NTLA +++++DRW
Sbjct: 188 ARVGGETLTLPEILNRLSDPEGARRKQAAQALAKALEARNPVLALCLNTLAFEKQVEDRW 247

Query: 274 RKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAP 333
           RKY   A SRHL+N V+   +EAL  +V   Y   SHRYY LK + +  D +  WDR AP
Sbjct: 248 RKYPSPAASRHLANEVDADAVEALEAAVVEAYGPVSHRYYRLKARAMGKDVLDHWDRNAP 307

Query: 334 LPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTI 393
           L  T+     ++ AR +VL+S+   +P+ +  A  FF   WIDA    GK SGA++H   
Sbjct: 308 LETTAPRTYGWDEARGIVLESFQALAPRFADTARTFFAQPWIDARPRAGKQSGAYSHPVT 367

Query: 394 PSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETL 453
            + HPY+ +NY+G+ +DV+TLAHELGH +H  L +   G L  ++ LTLAETASIFGE L
Sbjct: 368 ANRHPYVFMNYMGERRDVLTLAHELGHAVHQTLCAPL-GTLLADTPLTLAETASIFGEGL 426

Query: 454 TFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINE 513
            F+ LL A +   ER+ LLA +IED LN++VRQI+F+ FE + H E R+ G++    I  
Sbjct: 427 VFERLL-AEAPPAERRGLLAGRIEDGLNTVVRQIAFHRFEAQFH-EARAQGELSADEIGS 484

Query: 514 IWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTV 573
           +WL+   ESLGPA  L +  Y  +W  V HF+ + FYVYAY FG+ LV  L +  + +  
Sbjct: 485 LWLQVMGESLGPAVRL-NAGYEHYWGYVSHFVHAPFYVYAYPFGDLLVRGLMEKRREDP- 542

Query: 574 DCFKEKYLNILRAGNSKHYSELLLPLNI 601
             F   Y  +L AG +K Y E L P  +
Sbjct: 543 QGFAPLYEQLLAAGGTKTYVEALAPFGL 570


>gi|284046014|ref|YP_003396354.1| oligoendopeptidase, pepF/M3 family [Conexibacter woesei DSM 14684]
 gi|283950235|gb|ADB52979.1| oligoendopeptidase, pepF/M3 family [Conexibacter woesei DSM 14684]
          Length = 607

 Score =  349 bits (895), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 190/540 (35%), Positives = 297/540 (55%), Gaps = 8/540 (1%)

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
           +   L  A+ +   + EL+GR  SYA L +  + +   I      +  +    +  L+FF
Sbjct: 61  DAPGLRTAMEQLAALHELVGRAGSYASLRFAVDTADERIGALLQHVQERATAIQTTLLFF 120

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
            LE  TLD+A  E+  A +     ++ +++  R+ + +LLS   E +L++    G  A  
Sbjct: 121 ELEWATLDDARAEELLAGEDNAF-FAHYLRTERRYRPYLLSEPEERILAEKGISGAGAWT 179

Query: 203 RFFCENIESLRFKINDQKIPLT--KAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFIT 260
           R F E + SL  ++     P+T  +A       DR+ R+ AA+A++          +FI 
Sbjct: 180 RLFAELMSSLEVRLPSAPEPVTLEQALALLSGPDRDERRGAAEAVTEALRPGLRTRAFIF 239

Query: 261 NTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWL 320
           NTL  D+ + DR R Y     +R+L+N      ++AL+ +V+  Y     R+Y LK + L
Sbjct: 240 NTLLHDKAVDDRLRTYPNWLTARNLANEASDESVQALVTAVRGRY-DVPQRWYRLKARLL 298

Query: 321 KLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQY 380
            ++ +  +DR A +  T +    +  AR+LVL +Y  F+P++  +A +FF   WIDAP  
Sbjct: 299 GVERLADYDRAATVADTDERFT-WREARELVLDAYDSFTPELGALARRFFDERWIDAPVR 357

Query: 381 DGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSL 440
            GK  GAF   T+PS HPY+LLNY  + +DV+TLAHELGHG+H  L++  QG+    + L
Sbjct: 358 PGKRGGAFCSYTVPSAHPYVLLNYTARRRDVLTLAHELGHGVHAALAA-PQGVFHQGTPL 416

Query: 441 TLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTER 500
           TLAETAS+FGETL F  LL++AS+   R  LL+  IE  + ++ RQ + + FE  +HT R
Sbjct: 417 TLAETASVFGETLVFGRLLESASTPASRLSLLSESIEGAIATVFRQTAMHTFEETIHTAR 476

Query: 501 RSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCL 560
           R  G++   R  E+W  +Q+E  G A ++++  Y ++W  +PHFI S  YVYAYA+G  L
Sbjct: 477 REEGELGIDRFGELWAASQEELFGDAVEVTE-GYRTWWSYIPHFINSPGYVYAYAYGQLL 535

Query: 561 VNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMI 620
             S+Y  Y+      F   YL +L AG S    EL   + ++L+DP FW+ GL  V+  +
Sbjct: 536 ALSVYGRYRQEGA-SFVPDYLRMLSAGGSMAPEELGRLVGLDLTDPGFWDAGLALVDDQL 594


>gi|284107504|ref|ZP_06386385.1| Peptidase M3A and M3B, thimet/oligopeptidase F [Candidatus
           Poribacteria sp. WGA-A3]
 gi|283829930|gb|EFC34211.1| Peptidase M3A and M3B, thimet/oligopeptidase F [Candidatus
           Poribacteria sp. WGA-A3]
          Length = 541

 Score =  340 bits (872), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 181/491 (36%), Positives = 280/491 (57%), Gaps = 10/491 (2%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           RW+L DLY       +  D E I   +  F+ +  G +   +       L  A++E ER+
Sbjct: 8   RWDLSDLYEGISDPRVEKDFERISARADRFEKKXRGKIKSPS--LTAGKLAGAVSELERL 65

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQS 157
            E IG+I S+A L +  +  +P    F + +  K  + +K LIFF +E  ++ +   ++ 
Sbjct: 66  SEGIGKILSFAHLLFAADTRNPKTGAFRSSMQQKATEIQKKLIFFYVEWVSVPKKRAKKL 125

Query: 158 YAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIN 217
              +P    Y  +++  R+ + H LS   E +L + S  G++A  R F E + +++F++ 
Sbjct: 126 LG-NPKLSGYRHFLEQERQYRDHTLSEAEEKILQEKSNTGQKAFSRLFDEVVNNIQFRVR 184

Query: 218 ----DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRW 273
                +K+  ++     +DSDR+ RK+A   L+    ++SH+ ++I NTL  D  I DR 
Sbjct: 185 LSGKTEKLNQSRTLSLLYDSDRKKRKAAWSGLTRGLKENSHVLTYIFNTLVNDHSINDRL 244

Query: 274 RKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAP 333
           R YE    +RHLSN +    +EAL++S +  +   S RYY LK K L     Y +DR AP
Sbjct: 245 RSYEDPMSARHLSNEISHGAVEALLESCEQNFEFVS-RYYGLKAKLLGYRRFYDYDRYAP 303

Query: 334 LPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTI 393
           L G+ ++ +P++ A+++VL S+ +FS +M   A  FF  NWIDA   DGK  GAF+HGT+
Sbjct: 304 L-GSEREQVPWDRAKEIVLSSFGEFSSKMKKTASLFFEKNWIDAELRDGKRGGAFSHGTV 362

Query: 394 PSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETL 453
           P VHPY+ +NY GKP+DVM LAHELGHG+H  LS   QG    ++ LT AETAS+F E L
Sbjct: 363 PGVHPYVFMNYTGKPRDVMVLAHELGHGVHQYLSRR-QGYFQAHTPLTTAETASVFAEML 421

Query: 454 TFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINE 513
            F  L +  + +E R +L+A K+ED++ ++ RQ     FE  LH ERR  G++ T RI+E
Sbjct: 422 VFHRLKEEETRREGRLVLVAEKLEDIMATVFRQAVLTRFEQSLHRERRDQGELATARISE 481

Query: 514 IWLETQKESLG 524
           +W+E  +E  G
Sbjct: 482 LWIEANREMFG 492


>gi|255020623|ref|ZP_05292686.1| oligoendopeptidase F [Acidithiobacillus caldus ATCC 51756]
 gi|254970008|gb|EET27507.1| oligoendopeptidase F [Acidithiobacillus caldus ATCC 51756]
          Length = 599

 Score =  338 bits (868), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 199/588 (33%), Positives = 297/588 (50%), Gaps = 10/588 (1%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W LEDLY   D   +  DM   E  + AF      +   A  + +   L  A+   + I 
Sbjct: 15  WRLEDLYAGPDDPRLEADMTWAEAAATAFAR----DYRDALPRLDAAQLAEALTRLQEIR 70

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           + + R+ SY  LSY  +               +      +L+FF +    LDE       
Sbjct: 71  QRLARVGSYRYLSYVTHSDDARFGAALQAYEERATQIGNILVFFDIAWARLDEDRARALM 130

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
           A   L   +   + + R    HLLS   E +L++    G     R F E +  +RF +  
Sbjct: 131 AAAELA-PWRHLLAHWRAYGDHLLSEAEERILAEKRVTGAGLWARLFDETLTEMRFPLRG 189

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           + +   +      D DR +R  AA+ALS       H  +   N +  D+ + DR R+Y  
Sbjct: 190 KSLSEQEILSKLSDPDRALRHDAAEALSSGLESRLHTLTTCFNAILADKALDDRLRRYPH 249

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
               R+L+N ++  ++ +L  +V   YP  + RYY LK + L +D +  +DR APLPG S
Sbjct: 250 WLAERNLANEIDDAMVASLEAAVVARYPLVA-RYYRLKGRLLGIDRLMDYDRYAPLPGKS 308

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
           +    ++  + +VL + A FSP+++ I  +FF   WIDA    GK  GAFAH   P VHP
Sbjct: 309 R-THDWQDCQRIVLAAVADFSPELAAIGRRFFDEGWIDAALAPGKRGGAFAHPVTPDVHP 367

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           Y+++NY G+ +DVMT+AHELGHGIH  L+ E QG L  ++ LT AETAS+FGE LTF+ L
Sbjct: 368 YLMVNYTGQTRDVMTVAHELGHGIHQYLARE-QGFLNADTPLTTAETASVFGEMLTFEQL 426

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
           L+  S    R  LL  KIED   ++ RQ++ + FE ++H  RR  G++   R+ E+WL T
Sbjct: 427 LREESDPRGRLALLCGKIEDTFATVFRQMAMHRFEAQMHEARRREGELSRERLAELWLAT 486

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
           Q E    +   S   Y  +W  +PHFI S  YVYAYAFG  L  +L   Y++     F  
Sbjct: 487 QTEQFADSVAFSQ-GYRWWWSYIPHFIGSPGYVYAYAFGELLTLALIQRYRAEG-KAFVP 544

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           +Y+ +LR G S+   E++    I+L+DP  W   L  +E ++   E +
Sbjct: 545 RYIEMLRLGGSRSPVEVVGVTGIDLTDPGIWSSALDYLESLVVQAETL 592


>gi|237752270|ref|ZP_04582750.1| oligoendopeptidase f [Helicobacter winghamensis ATCC BAA-430]
 gi|229375759|gb|EEO25850.1| oligoendopeptidase f [Helicobacter winghamensis ATCC BAA-430]
          Length = 582

 Score =  325 bits (833), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 196/592 (33%), Positives = 327/592 (55%), Gaps = 25/592 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           WNL+ L+ S +S  + N M+    ++  F+ +++GNL    N  N  S   ++ EYE +C
Sbjct: 8   WNLKPLFDSKES--LQNAMQSAITKAQDFEKKYKGNL----NALNAESFYQSLKEYEALC 61

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           E + RI +YA L +  N        FY +   ++   +  L+FF LE N L+ A  +Q +
Sbjct: 62  EKLSRIMTYAFLCFASNTKEGA---FYAECEMEVNKAQDFLLFFDLEFNALERAK-QQEF 117

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIN- 217
            +      Y+ +++ ++K  K+ LS   E +L  T  VG ++ KR F E++ +LRF I  
Sbjct: 118 IESAKG--YAYYLELLQKHAKYQLSLQEEKVLLKTQPVGVDSFKRLFDEHLSNLRFLITL 175

Query: 218 ---DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWR 274
              ++++   +     +D DREVRK A ++LS T  ++  + ++I N + KD +I    R
Sbjct: 176 KGANKEVSEEEVLSLLYDKDREVRKMAQESLSKTLAQNLPLLTYIYNVVRKDLKITVELR 235

Query: 275 KYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPL 334
            YE +  SRH++N      ++ ++ ++ N        YY LK + L  D +Y +DR AP+
Sbjct: 236 GYESLEQSRHIANQTTQKSVDMMVDTI-NKNVGIVEEYYTLKAQLLGYDCLYDYDRYAPI 294

Query: 335 PGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIP 394
                D    E ++ +VL+++A+FSP+   IA++ F   WID+   + K  GAF+H  +P
Sbjct: 295 ANDEADFSYME-SKSIVLEAFAEFSPKFYEIAKRAFDEGWIDSHPRENKRGGAFSHSAVP 353

Query: 395 SVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLT 454
           SVHPY++LN+  + +D  T+AHELGH IH  LS    G L  ++ LT AETAS+F E L 
Sbjct: 354 SVHPYLMLNHTNRRRDAFTMAHELGHTIHQYLSYSV-GYLNADTPLTTAETASVFAEMLL 412

Query: 455 FDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEI 514
           F+ + Q  + K E+  L A K+ED+  ++ RQ  F +FE  +H   +  G++ T  +N +
Sbjct: 413 FEKMQQRLNDK-EKIALYAGKLEDVFATLFRQNVFTNFERLVH---KKDGELSTEMLNAL 468

Query: 515 WLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVD 574
           W E  ++  G +  L++  Y  +W  +PHFI + FY YAY++G  LV +L+ +Y+    D
Sbjct: 469 WQEENQKMFGKSVILTE-NYRLWWSYIPHFIHTPFYCYAYSYGQLLVFALFGVYRKQRED 527

Query: 575 CFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            F  KY   L  G SK   EL+    ++L   +FWE G+Q V  +++ ++++
Sbjct: 528 -FVAKYEKFLSLGGSKTPKELVGIFGLDLESSDFWEIGMQEVRILLEGLKEI 578


>gi|313142468|ref|ZP_07804661.1| oligoendopeptidase f [Helicobacter canadensis MIT 98-5491]
 gi|313131499|gb|EFR49116.1| oligoendopeptidase f [Helicobacter canadensis MIT 98-5491]
          Length = 570

 Score =  323 bits (827), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 195/590 (33%), Positives = 324/590 (54%), Gaps = 24/590 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           WNL  L+ S +S E S   E   + ++ F+ +++G LA      + HS   AI  YE+IC
Sbjct: 2   WNLTPLFSSKESLEESLFSEI--NRAVKFEQQYKGQLATL----DYHSFSQAIKGYEKIC 55

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           E + R+ +YA L +  N        F      ++   +  L+FF LE N L+E     S 
Sbjct: 56  ENLSRVMTYAFLCFAANTKEGA---FLAKCEMEVNKAQDKLLFFDLEFNALEE-----SQ 107

Query: 159 AQDPL--TLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI 216
            +D +    +YS +++ + K  KH L+   E +L  T  VG ++ KR F E++  L+F+ 
Sbjct: 108 KKDLICNVKEYSYYLELLAKNAKHQLTLPEEKILLKTQPVGVDSFKRLFDEHLSRLKFEF 167

Query: 217 NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKY 276
             +++   +     +D ++ +RK AAK+LS T  ++  + ++I N + KD  I    R Y
Sbjct: 168 QGKQLSEEEILSFLYDKNQAMRKEAAKSLSVTLKENLELLAYIYNVVRKDLRITAELRGY 227

Query: 277 EKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPG 336
           + + +SRH  N +    ++++++++ N        YY LK K L L+ +Y +DR APL  
Sbjct: 228 KTLEESRHNDNQITQKSVDSMVKTI-NDSVGIVEEYYSLKAKLLGLEKLYDYDRYAPLLC 286

Query: 337 TSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSV 396
           +     P+E ++ +VL+++ +FSP+   IA+K F   WID+   + K  GAF+H  +PSV
Sbjct: 287 SEDSEFPYEESKKIVLETFREFSPRFYEIAKKAFDEGWIDSHPRENKRGGAFSHSAVPSV 346

Query: 397 HPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFD 456
           HPY++LN+  K +D  T+AHELGH IH  LS +  G L  ++ LT AETAS+F E L FD
Sbjct: 347 HPYLMLNHTNKRRDAFTMAHELGHTIHQYLSYKV-GYLNADTPLTTAETASVFAEMLLFD 405

Query: 457 SLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWL 516
             ++    KEE+  L A K+ED+  ++ RQ  F +FE ++H E     ++     ++IW 
Sbjct: 406 K-MKEMLPKEEKIALYAGKLEDIFATLFRQNVFTNFERRVHQEE---AELSVEEFSQIWQ 461

Query: 517 ETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCF 576
           E  ++  G +  L++ +Y  +W  + HFI + FY YAY++G  LV +L+ +YK      F
Sbjct: 462 EENQKMFGKSVILTE-DYRLWWSYISHFIHTPFYCYAYSYGQLLVMALFGVYKKEG-KSF 519

Query: 577 KEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
             KY   L  G SK   EL+    +++ D NFW+ G++ VE ++  ++ +
Sbjct: 520 VGKYEEFLSLGGSKSPRELVGIFGLDIEDDNFWKIGIKEVESLLKGLKAI 569


>gi|218508170|ref|ZP_03506048.1| oligoendopeptidase F protein [Rhizobium etli Brasil 5]
          Length = 253

 Score =  323 bits (827), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 147/255 (57%), Positives = 190/255 (74%), Gaps = 3/255 (1%)

Query: 305 YPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSI 364
           YP+ SHRYY++K KWL ++ M FWDR APLP TS  +I +  A+D VL +Y  F+P+M+ 
Sbjct: 2   YPRLSHRYYKMKAKWLGMEQMNFWDRNAPLPETSSAVISWSDAKDTVLSAYGNFAPEMAD 61

Query: 365 IAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHF 424
           IA +FF   WIDAP   GK  GAFAH T+PS HPY+L+NY+GKP+DVMTLAHELGHG+H 
Sbjct: 62  IARRFFDEQWIDAPVRPGKAPGAFAHPTVPSAHPYVLVNYMGKPRDVMTLAHELGHGVHQ 121

Query: 425 VLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIV 484
           VL+   QG L   + LTLAETAS+FGE LTF +LL+  + + ERK +LA K+EDM+N++V
Sbjct: 122 VLAG-AQGALMCQTPLTLAETASVFGEMLTFRALLEKTTDRRERKAMLAQKVEDMINTVV 180

Query: 485 RQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHF 544
           RQI+FY+FE KLHT R+S G++    I E+WL  Q ESLGPA  +S+  Y ++W  +PHF
Sbjct: 181 RQIAFYEFERKLHTARKS-GELTADDIGELWLSVQSESLGPAISISE-GYETYWAYIPHF 238

Query: 545 IESSFYVYAYAFGNC 559
           I S FYVYAYAFG+C
Sbjct: 239 IHSPFYVYAYAFGDC 253


>gi|224418956|ref|ZP_03656962.1| oligoendopeptidase F (pepF) [Helicobacter canadensis MIT 98-5491]
 gi|253827904|ref|ZP_04870789.1| oligoendopeptidase PepF [Helicobacter canadensis MIT 98-5491]
 gi|253511310|gb|EES89969.1| oligoendopeptidase PepF [Helicobacter canadensis MIT 98-5491]
          Length = 576

 Score =  323 bits (827), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 195/590 (33%), Positives = 324/590 (54%), Gaps = 24/590 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           WNL  L+ S +S E S   E   + ++ F+ +++G LA      + HS   AI  YE+IC
Sbjct: 8   WNLTPLFSSKESLEESLFSEI--NRAVKFEQQYKGQLATL----DYHSFSQAIKGYEKIC 61

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           E + R+ +YA L +  N        F      ++   +  L+FF LE N L+E     S 
Sbjct: 62  ENLSRVMTYAFLCFAANTKEGA---FLAKCEMEVNKAQDKLLFFDLEFNALEE-----SQ 113

Query: 159 AQDPL--TLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI 216
            +D +    +YS +++ + K  KH L+   E +L  T  VG ++ KR F E++  L+F+ 
Sbjct: 114 KKDLICNVKEYSYYLELLAKNAKHQLTLPEEKILLKTQPVGVDSFKRLFDEHLSRLKFEF 173

Query: 217 NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKY 276
             +++   +     +D ++ +RK AAK+LS T  ++  + ++I N + KD  I    R Y
Sbjct: 174 QGKQLSEEEILSFLYDKNQAMRKEAAKSLSVTLKENLELLAYIYNVVRKDLRITAELRGY 233

Query: 277 EKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPG 336
           + + +SRH  N +    ++++++++ N        YY LK K L L+ +Y +DR APL  
Sbjct: 234 KTLEESRHNDNQITQKSVDSMVKTI-NDSVGIVEEYYSLKAKLLGLEKLYDYDRYAPLLC 292

Query: 337 TSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSV 396
           +     P+E ++ +VL+++ +FSP+   IA+K F   WID+   + K  GAF+H  +PSV
Sbjct: 293 SEDSEFPYEESKKIVLETFREFSPRFYEIAKKAFDEGWIDSHPRENKRGGAFSHSAVPSV 352

Query: 397 HPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFD 456
           HPY++LN+  K +D  T+AHELGH IH  LS +  G L  ++ LT AETAS+F E L FD
Sbjct: 353 HPYLMLNHTNKRRDAFTMAHELGHTIHQYLSYKV-GYLNADTPLTTAETASVFAEMLLFD 411

Query: 457 SLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWL 516
             ++    KEE+  L A K+ED+  ++ RQ  F +FE ++H E     ++     ++IW 
Sbjct: 412 K-MKEMLPKEEKIALYAGKLEDIFATLFRQNVFTNFERRVHQEE---AELSVEEFSQIWQ 467

Query: 517 ETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCF 576
           E  ++  G +  L++ +Y  +W  + HFI + FY YAY++G  LV +L+ +YK      F
Sbjct: 468 EENQKMFGKSVILTE-DYRLWWSYISHFIHTPFYCYAYSYGQLLVMALFGVYKKEG-KSF 525

Query: 577 KEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
             KY   L  G SK   EL+    +++ D NFW+ G++ VE ++  ++ +
Sbjct: 526 VGKYEEFLSLGGSKSPRELVGIFGLDIEDDNFWKIGIKEVESLLKGLKAI 575


>gi|242309023|ref|ZP_04808178.1| oligoendopeptidase f [Helicobacter pullorum MIT 98-5489]
 gi|239524447|gb|EEQ64313.1| oligoendopeptidase f [Helicobacter pullorum MIT 98-5489]
          Length = 572

 Score =  320 bits (819), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 191/591 (32%), Positives = 328/591 (55%), Gaps = 20/591 (3%)

Query: 36  LPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYE 95
           + +WNL+ L+ S +  E +N  E I++ S  F+ +++  +A     +        + EYE
Sbjct: 1   MDKWNLKPLFESKEILE-NNIQENIKN-SQKFEDKYKNQMASLQPLE----FEKMLKEYE 54

Query: 96  RICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLE 155
           RICE +  I +YA L +  N        F +    ++   ++ L+FF +E N L   +  
Sbjct: 55  RICENLSCIMTYAYLCFAANTKEGA---FLSKCEMEVNKAQEKLLFFEIEFNALPNNIQS 111

Query: 156 QSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFK 215
               Q     KYS +++ + K  KH L+   E +L     VG ++ KR F E++ +LRFK
Sbjct: 112 SFIKQ---CKKYSYFLELLAKNAKHQLTLPEEKVLLKMQPVGVDSFKRLFDEHLSALRFK 168

Query: 216 INDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRK 275
             D+++   +     +D +RE RK AA++LS T +K+  + ++I N + KD +I    R 
Sbjct: 169 FQDKEVSEEEVLSLLYDKNRETRKEAAQSLSETLSKNLELLAYIYNVVRKDLKISAELRG 228

Query: 276 YEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLP 335
           Y  + +SRH+ N +    ++ ++Q++ N        YY+LK + L L+T+Y +DR APL 
Sbjct: 229 YSNLEESRHIDNQITQKSVDIMVQTI-NDSVGVVEEYYKLKTQLLGLETLYDYDRYAPLL 287

Query: 336 GTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPS 395
            +      +E ++ LVL+++ +FSP+   IA+  F   WID+   + K  GAF+HG +PS
Sbjct: 288 CSEDSEFSYEESKKLVLETFLEFSPRFYEIAKCAFDEGWIDSHPRENKRGGAFSHGAVPS 347

Query: 396 VHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTF 455
           VHPY++LN+  + +DV T+AHELGH IH  LS      L  ++ LT AETAS+F E L F
Sbjct: 348 VHPYLMLNHTNRRRDVFTMAHELGHTIHQYLSYGVD-YLNADTPLTTAETASVFAEMLLF 406

Query: 456 DSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIW 515
           +  ++   S+EE+  L A+K+ED+  ++ RQ  F +FE ++H   +  G++     ++IW
Sbjct: 407 EK-MKNMLSREEKIALYASKLEDIFATLFRQNVFTNFERRVH---QKEGELSVDEFSQIW 462

Query: 516 LETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDC 575
            E  ++  G +  L+   Y  +W  +PHFI + FY YAY++G  LV +L+ +Y+    D 
Sbjct: 463 QEENQKMFGKSVVLTQ-NYSCWWSYIPHFIHTPFYCYAYSYGQLLVMALFGVYRKEGQD- 520

Query: 576 FKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           F  KY   L  G S+   EL+    +++ D +FW+ G+  V++++  ++++
Sbjct: 521 FVNKYEKFLSLGGSQSPRELVGIFGLDIEDDDFWKIGICEVKRLMQGLKEI 571


>gi|34557423|ref|NP_907238.1| oligoendopeptidase F (pepF) [Wolinella succinogenes DSM 1740]
 gi|34483139|emb|CAE10138.1| OLIGOENDOPEPTIDASE F (PEPF) [Wolinella succinogenes]
          Length = 573

 Score =  316 bits (810), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 191/587 (32%), Positives = 313/587 (53%), Gaps = 21/587 (3%)

Query: 36  LPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYE 95
           + RW+L  L+ S ++  +   ++    ES+AFK  + G L+   +     +   AI EYE
Sbjct: 1   MKRWDLSALFESVEA--LDEALKVCARESVAFKESYAGRLSTLESS----AFEKAIGEYE 54

Query: 96  RICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLE 155
            + + IGRI SYA L +  +        FY     K  +  + L+FF +E   L E+L  
Sbjct: 55  NLSDAIGRIMSYAFLVFAEDTQKGD---FYAKYELKCNEISEHLLFFEIEFGDL-ESLKR 110

Query: 156 QSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFK 215
           Q + Q     +Y+ +++ I + KKH LS   E ++     VG  A  R F E++ SL FK
Sbjct: 111 QEFIQ--AIPRYAYYLQKIEENKKHTLSLPEERIMLKLDPVGSNAFSRLFDEHLSSLSFK 168

Query: 216 INDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRK 275
              +++   +         R  R+ AA++L+        + ++I N + K+  I    R 
Sbjct: 169 FQGKELSEEEILALLHHPKRSKREKAARSLTKGLAPHQGVLAYILNVVRKENAILCDIRG 228

Query: 276 YEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLP 335
           Y    +SRH+ N +    ++++++ V N        +Y+LK++ L  + +Y +DR APL 
Sbjct: 229 YATPEESRHIDNQISQKSVDSMLEVV-NAEMGIVEEFYDLKREILGYEELYDYDRYAPL- 286

Query: 336 GTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPS 395
           G S++ I FE A+ +VLQ+  +FSP+   IA++ F   WID+     K  GAF+HGT+PS
Sbjct: 287 GRSKEKIDFESAQKIVLQALGEFSPRFGEIAQRAFDEGWIDSHPRPRKRGGAFSHGTVPS 346

Query: 396 VHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTF 455
            HPY+LLN+    +D+ T+AHELGH IH  LS    G L  ++ LT AETAS+F E L F
Sbjct: 347 AHPYVLLNHTDGRRDIFTMAHELGHAIHQELSKGV-GCLNADTPLTTAETASVFAEMLLF 405

Query: 456 DSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIW 515
           D + ++   KE+R  L A K+ED+  ++ RQ  F +FE  +H  +    +I     N +W
Sbjct: 406 DKMKRSLKPKEKR-TLYAGKLEDIFATLFRQSVFTNFERLIHGIKE---EIKAEEFNHLW 461

Query: 516 LETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDC 575
           +E  ++  G +  L+   Y S+W  +PHF+ + FY YAY++G  LV +L+ +YK   +  
Sbjct: 462 MEENQKMFGKSVTLTQ-NYASWWSYIPHFVHTPFYCYAYSYGQLLVLALFGLYKRG-LPQ 519

Query: 576 FKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
           F+++Y   L  G SK  +EL+     ++ D  FW  G+  V  ++++
Sbjct: 520 FEDRYEEFLSLGGSKRPAELVGIFGFDIEDSEFWNIGIAEVRSLLEE 566


>gi|317051325|ref|YP_004112441.1| peptidase M3A and M3B thimet/oligopeptidase F [Desulfurispirillum
           indicum S5]
 gi|316946409|gb|ADU65885.1| peptidase M3A and M3B thimet/oligopeptidase F [Desulfurispirillum
           indicum S5]
          Length = 591

 Score =  312 bits (800), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 187/588 (31%), Positives = 302/588 (51%), Gaps = 12/588 (2%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           RWNL  +Y   D   I  D   +  E+ A + R+ G +    +Q     +   + + E I
Sbjct: 9   RWNLSSIYTGMDDHAIERDCAMVRSEAAALRERFRGKI----DQIFPSEMAVLLQKLETI 64

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQS 157
            +++G++ +YA L +  + +      F+  +    +     L FF +E   LDEA     
Sbjct: 65  NQMMGKLGAYAFLLFAVDTADEEKSAFFQSMKELSSALSAELTFFDIEWANLDEAR-AAV 123

Query: 158 YAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIN 217
           + QD    +Y  +++  R  + HLLS   E ++S  S V   A+   F + +  + F  +
Sbjct: 124 HMQDSSLAQYHHFLRKSRIYRDHLLSEPEERVISRYSVVAGSAMNSLFSKVMSRMSFGAD 183

Query: 218 DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYE 277
             ++   +      D    VRK A +  +    +  HI + I NT+  ++ I D  R Y 
Sbjct: 184 --RLSQEELMSKLRDVSAAVRKQAQEDFTAGLREYGHILTHIYNTVISEKMIVDDLRSYP 241

Query: 278 KIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGT 337
               S +L+N +    +E L+ SV + Y     R+Y LK+K L ++T+Y +DR APL  T
Sbjct: 242 NWIRSMNLANELSDAAVENLVGSVVSRY-DIPQRFYHLKRKILGVETLYDYDRYAPLD-T 299

Query: 338 SQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVH 397
                 +E A   VL ++   SP M  IA  FF   WID+    GK SGAFAH   P  H
Sbjct: 300 VNRTYSWEYACAAVLDAFDTVSPAMGDIARTFFEKKWIDSVCRPGKRSGAFAHPVTPDAH 359

Query: 398 PYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDS 457
           P I+ N+ G  +D+ TLAHELGHGIH  L+ + QG   +++ L LAETAS+F E + F S
Sbjct: 360 PVIMTNFTGNFRDMETLAHELGHGIHQYLAHQ-QGYFGSSTPLVLAETASVFAEMVLFRS 418

Query: 458 LLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLE 517
                S   ++   L  KIE ++ ++ RQIS   FE   HT RR  G++ +  I+++W+ 
Sbjct: 419 EYAKLSDNRQKLAALCAKIESIIATVFRQISMNRFEDAYHTTRREKGELGSADISQLWMR 478

Query: 518 TQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIY-KSNTVDCF 576
           +Q++  G + +L++  Y  +W  +PHFI +  YVY+YAFG  LV SLY  Y + +  D +
Sbjct: 479 SQRDMFGDSVELTE-NYSIWWSYIPHFINAPGYVYSYAFGELLVLSLYSQYLQQDDKDAY 537

Query: 577 KEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVE 624
            ++Y+ +L  G     +E L  L ++++ P FW  GL  +E+++++ E
Sbjct: 538 MKRYMELLGKGGVVPPAEALTSLGVDITSPEFWNSGLGAIEELVNEAE 585


>gi|117925459|ref|YP_866076.1| peptidase M3A and M3B, thimet/oligopeptidase F [Magnetococcus sp.
           MC-1]
 gi|117609215|gb|ABK44670.1| peptidase M3A and M3B, thimet/oligopeptidase F [Magnetococcus sp.
           MC-1]
          Length = 601

 Score =  311 bits (796), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 203/588 (34%), Positives = 303/588 (51%), Gaps = 28/588 (4%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           +W L++LY + D  +I  D+  +E    AF  ++ G L+          LGAA+   E +
Sbjct: 9   QWRLDNLYENLDDPQIEADLLDLEQRYAAFFRQFRGQLSS--------DLGAAVRANEAL 60

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKL-ADFEKVLIFFALEINTLDEALLEQ 156
            E  G++  Y  L    +L+   ++K   ++  +L   F +   FF +EI  + E    Q
Sbjct: 61  SERSGKLYLYLHLRMYADLNDEAVKKRLFEVKTRLDRTFGEHASFFTIEIAQMAEERF-Q 119

Query: 157 SYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI 216
           +  Q+P    +  W++ +R+   ++LS ++E  L+  S  G E+   F+ E    LRF  
Sbjct: 120 ARLQEPDCAFFRPWLEQVRRNLPYMLSEEVEGALTKRSAFGAESWAEFYDEVEADLRFDY 179

Query: 217 NDQKIPLTKAYKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFIT-NTLAKDEEIQDRWR 274
             +   LT+   +   S D E R    + ++     +   FS  T N +   + I+DR R
Sbjct: 180 QGRAQTLTEMLHTLNTSQDGEQRAEVQRLVNQGLQGAFSKFSAQTLNMVVGAKRIEDRER 239

Query: 275 KYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPL 334
            Y     +R+LSN V   V+EAL Q+V       + RYY LK   L   T+ + DR APL
Sbjct: 240 GYSHPMQARNLSNKVPDAVVEALHQAVTTQAAPLAQRYYRLKATLLGQKTLRWSDRNAPL 299

Query: 335 PGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTI- 393
           P T+   IP+    DLVLQ+Y  FSP ++ + E F      D     GK SGAF +  + 
Sbjct: 300 PFTANVEIPYHEGLDLVLQAYHSFSPTLAQMVEAFQQQGRFDVAPRPGKQSGAFNYSVVL 359

Query: 394 PSVHP--YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE 451
           P   P  YILLN+ G  +DVMTLAHE+GHG+H +L+   QG L  ++ +  AETASIFGE
Sbjct: 360 PGGEPVSYILLNHQGSMRDVMTLAHEVGHGVHGMLAGHAQGALMASAPMAYAETASIFGE 419

Query: 452 TLTFDSL---LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPT 508
             TF+ L   LQ A        LL  KIED+LNS+VRQI F +FE ++H    +   +  
Sbjct: 420 MTTFNFLRERLQQAGDHIGLLALLTGKIEDILNSVVRQIGFSNFERRVHG---ADSRLSA 476

Query: 509 HRINEIWLETQKE---SLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLY 565
           H ++ IW+ET +    + G  F  +D    + W  + HF    FYVYAYAFG  L  SLY
Sbjct: 477 HELDAIWMETTQALYGAEGEVFTYAD--SNALWSYISHF-HRPFYVYAYAFGELLTQSLY 533

Query: 566 DIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
              ++     F+  YL++LRAG +K   ELL P  ++ +D +FW+ G+
Sbjct: 534 -ASRAGVGAVFEASYLDLLRAGGTKDVVELLKPFALDPTDMDFWQHGI 580


>gi|255321482|ref|ZP_05362640.1| putative oligoendopeptidase F [Campylobacter showae RM3277]
 gi|255301338|gb|EET80597.1| putative oligoendopeptidase F [Campylobacter showae RM3277]
          Length = 573

 Score =  308 bits (790), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 185/584 (31%), Positives = 304/584 (52%), Gaps = 19/584 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  L+ +    EIS     ++ E   F+ ++     + ++++      +A+ EYE + 
Sbjct: 4   WDLTPLFKNEKELEIS--ALSLQKECEKFEAKYSDKFLNLSDEE----FFSALNEYENLL 57

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           E I R+  Y  L ++ + S      FY   +   +  +  L+FF L+ N  DEA   +  
Sbjct: 58  ENIARVQIYVSLVFSKDTSKGA---FYAKFDELSSKAQNHLLFFELKFNEFDEARQNKII 114

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
           A+   + +   ++ +I K K H LS   E +L  T+  G E   R F E + +L+FK   
Sbjct: 115 AK---SARLGYYLDSIAKEKAHQLSLKEEQILLRTANTGAEGFSRLFDETLSALKFKFKG 171

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           + +   +        DR  RK+AAK+LS       H+ S+I N +    +     RK++ 
Sbjct: 172 KMLGEEEILSKLHSPDRAERKAAAKSLSGGLAPQQHLLSYIYNMIKTSLKTSCELRKFDL 231

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
               RH SN      ++AL+++ +  +     ++YE K+K L    +Y +DR APL G S
Sbjct: 232 PESPRHFSNQTTKASVDALIKAAETSFD-LPIKFYEKKRKILGFKKLYDYDRYAPL-GES 289

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
           + I  F+  + +VL++++KFSP+   IA + F   WID    + K  GAF+   +   HP
Sbjct: 290 KSIYKFDECKKIVLETFSKFSPKFGEIAARAFKEGWIDVYPAENKRGGAFSQSGVAKAHP 349

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           Y+LLN+  + +D+ TLAHELGH  H  L+ E+ G L  ++ LT AETAS+F E L FD +
Sbjct: 350 YVLLNHTDERRDLFTLAHELGHAAHQNLAYESVGFLNADTPLTTAETASVFCEMLVFDHV 409

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
                 + E+  LLA KIED+  ++ RQI+F  FE ++H      G+I    +N+IWLE 
Sbjct: 410 KSTLKGR-EKTALLAGKIEDIFATLYRQINFTTFERRVHAHE---GEISAEELNKIWLEE 465

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
             +  G +  L+D  Y  +W  +PHFI + FY YAY++   LV +++ +YKS   + F +
Sbjct: 466 SAKMFGQSVALNDY-YKIWWSYIPHFIHTPFYCYAYSYAQLLVLAIFGLYKSGKCENFTQ 524

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
            Y   L AG S+   EL+     ++ D  FW+ G+  V K++++
Sbjct: 525 IYTKFLSAGGSRSPKELVGMFGFDIEDAAFWQIGINEVRKLVEE 568


>gi|118474498|ref|YP_891894.1| oligoendopeptidase F, putative [Campylobacter fetus subsp. fetus
           82-40]
 gi|118413724|gb|ABK82144.1| oligoendopeptidase F, putative [Campylobacter fetus subsp. fetus
           82-40]
          Length = 569

 Score =  308 bits (789), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 193/585 (32%), Positives = 315/585 (53%), Gaps = 21/585 (3%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           +W+L   + + D  E+    + +E ++  F  ++  NL     Q N     A+I EYE I
Sbjct: 2   QWDLTLFFKNSD--ELDKFSKNLEKKAKNFNQKYSKNL----EQLNDSEFLASIQEYENI 55

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQS 157
              I +I SYA L +  + ++ +    Y +I  K+   E+ L+FF +E N + +   EQ 
Sbjct: 56  LAGINKIMSYAYLKFAKDTTNGSFLAKYEEICTKI---EENLLFFTIEFNEISK---EQQ 109

Query: 158 YAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIN 217
            +    +  YS ++  I K K H LS   E +L  T+  G  A  R F E++  L+F   
Sbjct: 110 DSFIAYSRPYSYYLNLIAKQKSHQLSFLEERVLLKTANTGANAFSRLFDESMARLKFDFR 169

Query: 218 DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYE 277
              +   +      DSDR VRK AA +LS T  ++ HI ++I N +  D + +   R YE
Sbjct: 170 GLVLSEEEILSKMLDSDRSVRKDAALSLSKTLEQNKHILTYIYNMIKTDLKNECELRNYE 229

Query: 278 KIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGT 337
               SRH SN +E   ++AL+++ ++ +   S ++Y  K++ L  + +Y +DR APL   
Sbjct: 230 LAESSRHESNQIEKQSVDALIKATESSFDLVS-KFYHKKRELLGYEKLYDYDRYAPLNNE 288

Query: 338 SQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVH 397
           S+    +E A++++L+++  F+P  + +A++ F  NW D      K SGAF+H      H
Sbjct: 289 SE--FNYEEAKEIILKAFNSFNPLFAKLAKRAFDENWCDVYPAKNKQSGAFSHSASSDTH 346

Query: 398 PYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDS 457
           P++LLNY  K +D+ T+AHELGH IH  LS +  G L +N+ LT AETAS+F E L F+ 
Sbjct: 347 PFVLLNYTNKRRDLFTVAHELGHAIHQFLSYKV-GFLNSNTPLTTAETASVFCEMLVFE- 404

Query: 458 LLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLE 517
            ++  +S  +   LLA KIED+ +++ RQI+F  FE ++H      G+I    +N+IW E
Sbjct: 405 YVKNRTSDTKLSGLLAGKIEDIFSTLYRQINFTTFERRVHA---FEGEISNENLNDIWYE 461

Query: 518 TQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFK 577
             K+  G +  L+D  Y  +W  +PHFI S FY YAY++   LV +L+ +YKS   + F 
Sbjct: 462 ESKKMFGDSLVLNDY-YKIWWSYIPHFIHSPFYCYAYSYAQLLVLALFGLYKSGKCENFV 520

Query: 578 EKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
           E Y   L  G S+   +++     +++   FW+ GL  V  ++++
Sbjct: 521 EIYTEFLSLGGSRSPKDMVAMFGFDINKEEFWQIGLDEVRNLVNE 565


>gi|157415360|ref|YP_001482616.1| M3 family peptidase [Campylobacter jejuni subsp. jejuni 81116]
 gi|157386324|gb|ABV52639.1| peptidase (M3 family) [Campylobacter jejuni subsp. jejuni 81116]
 gi|307748001|gb|ADN91271.1| oligoendopeptidase F [Campylobacter jejuni subsp. jejuni M1]
 gi|315932237|gb|EFV11180.1| oligoendopeptidase, pepF/M3 family protein [Campylobacter jejuni
           subsp. jejuni 327]
          Length = 573

 Score =  306 bits (785), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 197/584 (33%), Positives = 309/584 (52%), Gaps = 21/584 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  L+  HD + + N  +    +SL FK  +E  L       N +    A+ +YE + 
Sbjct: 4   WDLSALF--HDKEALQNFTQDQIQQSLNFKKNYENKLYAL----NANEFLQALKDYENLN 57

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           + +G+I +YA L +  N  + +   FY     +    E+ L+FF LE   L     E+S 
Sbjct: 58  QALGKIMTYAYLLFAKNTQNGS---FYAQYEEECKKIEENLLFFELEFCELAP---EKSQ 111

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
                   Y  ++ N+ + K++ LS + E ++   S  G  A  R F E++ +L+     
Sbjct: 112 EFTTFCKDYDFYLSNLLQNKRYNLSKNEERIMLYLSNTGANAFSRLFDESMSALKIPFEG 171

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           +K+   +     +D DR+ RK AAK  S    K+S + SFI N +  + +     R YE 
Sbjct: 172 KKLSEEEILSKMYDEDRKTRKKAAKKFSKVLQKNSRLLSFIINMIKTERKNISLLRGYEN 231

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
              SRH+SN +    +++L+ S + ++   S ++Y+ KK+ L  D +  +DR AP+   +
Sbjct: 232 AEISRHISNQISQKSVDSLIASAQKHFNLVS-QFYKRKKQILGYDELKDYDRYAPIGKEA 290

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
                F+ ++++VL+++  FSPQ   IA+  F   WID    + K  GAF+H      HP
Sbjct: 291 S--FDFKTSKNIVLEAFQAFSPQFYDIAKNAFNQGWIDVYPQENKQGGAFSHSATSDAHP 348

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           ++LLNY  K +D+ TLAHELGH IH  LS      L  N+ LT AETAS+F E L FD  
Sbjct: 349 FVLLNYTDKRRDLFTLAHELGHTIHQKLSYNV-SYLNQNTPLTTAETASVFAEMLVFD-F 406

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
           ++    KEE   L ANKIED+  +  RQI+F  FE +LH +     ++ T  IN+IW+E 
Sbjct: 407 IKDKLKKEELLSLYANKIEDIFATFYRQINFTCFERRLHAQE---NELSTEEINKIWMEE 463

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
            ++    +  L+   Y S+W  +PHFI S FY YAYA+   LV +LY +YKS   + FKE
Sbjct: 464 SQKMFQDSVKLTK-NYASWWSYIPHFIHSPFYCYAYAYAQLLVLALYGLYKSKKCENFKE 522

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
            Y+ +L  G S    EL+     ++ D NFWE G++ ++K+I++
Sbjct: 523 LYIKMLSLGGSVSPKELVGMFGFDIEDENFWEIGIKEIQKLINE 566


>gi|223040446|ref|ZP_03610720.1| putative oligoendopeptidase F [Campylobacter rectus RM3267]
 gi|222878296|gb|EEF13403.1| putative oligoendopeptidase F [Campylobacter rectus RM3267]
          Length = 573

 Score =  306 bits (784), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 185/584 (31%), Positives = 302/584 (51%), Gaps = 19/584 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  L+ +    EIS     +++E   F+ ++     + ++++  ++L     EYE + 
Sbjct: 4   WDLTPLFKNEKELEIS--ALSLQNECEKFEAKYSDKFLNLSDEEFLNALN----EYEILL 57

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           E I R+  Y  L ++ + S      FY   +   +  +  L+FF L+ N  DE    +  
Sbjct: 58  ENIARVQIYVGLVFSKDTSKGA---FYAKFDELSSKAQNHLLFFELKFNEFDEDRQNKII 114

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
           A+ P   +   ++ NI K K H LS   E +L  T+  G E   R F E + +L+FK   
Sbjct: 115 AKSP---RLGYYLGNIAKEKAHQLSLKEEQILLRTANTGAEGFSRLFDETLSALKFKFKG 171

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           + +   +        DR  RK+AAK+LS       H+ S+I N +    +     RK++ 
Sbjct: 172 KMLGEEEILSKLHSPDRAERKAAAKSLSDGLAPQQHLLSYIYNMIKTSLKTSCELRKFDL 231

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
               RH SN      ++AL+++ +  +     ++YE K+K L    +Y +DR APL   S
Sbjct: 232 PESPRHFSNQTTKASVDALIKAAETSFD-LPIKFYEKKRKILGFKKLYDYDRYAPLE-QS 289

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
           + +  F+  + +VL+++AKFSP+   IA + F   WID      K  GAF+   +   HP
Sbjct: 290 KSVYKFKECKKIVLETFAKFSPKFGEIAARAFKEGWIDVYPAQNKRGGAFSQSGVAKAHP 349

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           Y+LLN+  + +D+ TLAHELGH  H  L+ E+ G L  ++ LT AETAS+F E L FD +
Sbjct: 350 YVLLNHTDERRDLFTLAHELGHAAHQNLAYESVGFLNADTPLTTAETASVFCEMLVFDHV 409

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
                 + E+  LLA KIED+  ++ RQI+F  FE ++H      G+I    +N+IWLE 
Sbjct: 410 KNTLKGR-EKTALLAGKIEDIFATLYRQINFTTFERRVHAH---DGEIGAEELNKIWLEE 465

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
             +  G +  L+D  Y  +W  +PHFI + FY YAY++   LV +++ +YKS   + F +
Sbjct: 466 SAKMFGKSVALNDY-YKIWWSYIPHFIHTPFYCYAYSYAQLLVLAIFGLYKSGKCENFVQ 524

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
            Y   L AG S+   EL+     ++ D  FW+ G+  V K++++
Sbjct: 525 IYTEFLSAGGSRSPKELVGMFGFDIEDAAFWQIGINEVRKLVEE 568


>gi|148926001|ref|ZP_01809687.1| peptidase (M3 family) [Campylobacter jejuni subsp. jejuni CG8486]
 gi|145845480|gb|EDK22572.1| peptidase (M3 family) [Campylobacter jejuni subsp. jejuni CG8486]
          Length = 573

 Score =  305 bits (782), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 197/584 (33%), Positives = 310/584 (53%), Gaps = 21/584 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  L+  HD + + N  +    +SL FK  +E  L       N +    A+ +YE + 
Sbjct: 4   WDLSALF--HDKEALQNFTQDQIQQSLNFKKNYENKLYAL----NANEFLQALKDYENLN 57

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           + +G+I +YA L +  N  + +   FY     +    E+ L+FF LE   L     E+S 
Sbjct: 58  QALGKIMTYAYLLFAKNTQNGS---FYAQYKEECKKIEENLLFFELEFCELAP---EKSR 111

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
                   Y  ++ N+ + K++ LS + E ++   S  G  A  R F E++ +L+     
Sbjct: 112 EFTTFCKDYDFYLSNLLQNKRYNLSKNEERIMLYLSNTGANAFSRLFDESMSALKIPFEG 171

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           +K+   +     +D DR++RK AAK  S    K+S + SFI N +  + +     R YE 
Sbjct: 172 KKLSEEEILSKMYDEDRKIRKKAAKKFSKVLQKNSRLLSFIINMIKTERKNISLLRGYEN 231

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
              SRH+SN +    +++L+ S + ++   S ++Y+ KK+ L  D +  +DR AP+   +
Sbjct: 232 AEISRHISNQISQKSVDSLIASAQKHFDLVS-QFYKRKKQILGYDELKDYDRYAPIGKEA 290

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
                F+ ++++VL+++  FSPQ   IA+  F   WID    + K  GAF+H      HP
Sbjct: 291 S--FDFKTSKNIVLEAFQAFSPQFYDIAKNAFDQGWIDVYPQENKQGGAFSHSATSDAHP 348

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           ++LLNY  K +D+ TLAHELGH IH  LS      L  N+ LT AETAS+F E L FD  
Sbjct: 349 FVLLNYTDKRRDLFTLAHELGHTIHQKLSYNV-SYLNQNTPLTTAETASVFAEMLVFD-F 406

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
           ++    KEE   L ANKIED+  +  RQI+F  FE +LH +     ++ T  IN+IW+E 
Sbjct: 407 IKDKLKKEELLSLYANKIEDIFATFYRQINFTCFERRLHAQE---NELNTEEINKIWMEE 463

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
            ++    +  L+   Y S+W  +PHFI S FY YAYA+   LV +LY +YKS   + FKE
Sbjct: 464 SQKMFQDSVKLTK-NYASWWSYIPHFIHSPFYCYAYAYAQLLVLALYGLYKSKKCENFKE 522

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
            Y+ +L  G S    EL+     ++ D NFWE G++ ++K+I++
Sbjct: 523 LYIKMLSLGGSVSPKELVGMFGFDIEDENFWEIGIKEIQKLINE 566


>gi|268680255|ref|YP_003304686.1| oligoendopeptidase, pepF/M3 family [Sulfurospirillum deleyianum DSM
           6946]
 gi|268618286|gb|ACZ12651.1| oligoendopeptidase, pepF/M3 family [Sulfurospirillum deleyianum DSM
           6946]
          Length = 573

 Score =  305 bits (782), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 187/588 (31%), Positives = 303/588 (51%), Gaps = 20/588 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  LY   +   +  D+      + +F+T ++G L     +   +    +I EYE + 
Sbjct: 3   WDLNALY--ENEMALDADLSDASVRAKSFETVYKGKL----KELQVNEFLESIREYEALN 56

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           E +GRI +YA L +  N         Y    +K+A+    L+FF LE N L +   E+  
Sbjct: 57  EKLGRIMTYAFLRFATNSEQGAFYAKYQHEQSKIAE---NLLFFELEFNKLSKVKQEEFI 113

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
           A  P+   Y  +++++ + K + LS   E +L         A  R F E+   L F    
Sbjct: 114 ASVPM---YKFYLESLMEEKPYQLSQKEERILLKKEMTSASAFSRLFDEHFSRLTFAYEG 170

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           +K+   +      D++REVRK AA   +    +   +  +I N +  D   +   R Y+ 
Sbjct: 171 EKLSEEEILSKLQDANREVRKKAAHVFTKGIKEHQPLLGYIFNMIKTDLASECELRGYKN 230

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
               RH+ N +    ++AL+ S +  +      YY  K K L L+ ++ +DR APL   S
Sbjct: 231 AEQPRHMDNKITQKSVDALVNSAERSF-HLVQNYYTQKAKLLGLEELFEYDRYAPLE-DS 288

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
             +  FE ++ +VL+++AKF+P+   IA   F   WID    + K  GAF+H   PS HP
Sbjct: 289 NALYDFETSQKIVLEAFAKFNPKFHEIASMAFEKGWIDVFPKERKRGGAFSHPATPSTHP 348

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           Y+LLN+    +D+ TLAHELGH IH  LS +  G L +++ LT +ETAS+F E L FD+ 
Sbjct: 349 YVLLNHTNTRRDLFTLAHELGHAIHQYLSRDV-GYLGSDTPLTTSETASVFAEMLVFDA- 406

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
           ++   SKEE++ L A+KIED+ +++ RQI+F  FE K+H      G++     N  W+E 
Sbjct: 407 IKDGLSKEEKRSLYASKIEDVFSTLYRQINFTTFERKVHAHE---GELDLETFNRYWMEE 463

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
            ++  G +  LS  +Y  +W  +PHFI S FY YAY++G  LV +LY +YK +  + F  
Sbjct: 464 SQKMFGKSITLSK-DYALWWSYIPHFIHSPFYCYAYSYGQLLVLALYGLYKRSDKEAFVH 522

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            Y   L AG S+    L+     ++ D  FW+ G+  +E ++++ + +
Sbjct: 523 NYTQFLSAGGSQSPKALIKKFGFDIEDEGFWQLGIGEIEILLEEFKGL 570


>gi|57237981|ref|YP_179230.1| oligoendopeptidase F [Campylobacter jejuni RM1221]
 gi|57166785|gb|AAW35564.1| oligoendopeptidase F [Campylobacter jejuni RM1221]
 gi|315058540|gb|ADT72869.1| Oligoendopeptidase F [Campylobacter jejuni subsp. jejuni S3]
          Length = 573

 Score =  304 bits (779), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 196/584 (33%), Positives = 309/584 (52%), Gaps = 21/584 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  L+  HD + + N  +    +SL FK  +E  L       N +    A+ +YE + 
Sbjct: 4   WDLSALF--HDKEALQNFTQDQIQQSLNFKKNYENKLYTL----NANEFLQALKDYEILN 57

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           + +G+I +Y  L +  N  + +   FY     +    E+ L+FF LE   L     E+S 
Sbjct: 58  QALGKIMTYTYLLFAKNTQNGS---FYAQYEEECKKIEENLLFFELEFCELAP---EKSQ 111

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
                   Y  ++ N+ + K++ LS + E ++   S  G  A  R F E++ +L+     
Sbjct: 112 KFTTFCKDYDFYLSNLLQNKRYNLSKNEERIMLYLSNTGANAFSRLFDESMSALKIPFEG 171

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           +K+   +     +D DR++RK AAK  S    K+S + SFI N +  + +     R YE 
Sbjct: 172 KKLSEEEVLSKMYDEDRKIRKKAAKKFSKVLQKNSRLLSFIINMIKTERKNISLLRGYEN 231

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
              SRH+SN +    +++L+ S + ++   S ++Y+ KK+ L  D +  +DR AP+   +
Sbjct: 232 TEISRHISNQISQKSVDSLIASAQKHFNLVS-QFYKRKKQILGYDELKDYDRYAPIGKEA 290

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
                F+ ++++VL+++  FSPQ   IA+  F   WID    + K  GAF+H      HP
Sbjct: 291 S--FDFKTSKNIVLEAFQAFSPQFYDIAKNAFDQGWIDVYPQENKQGGAFSHSATSDAHP 348

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           ++LLNY  K +D+ TLAHELGH IH  LS      L  N+ LT AETAS+F E L FD  
Sbjct: 349 FVLLNYTNKRRDLFTLAHELGHTIHQKLSYNV-SYLNQNTPLTTAETASVFAEMLVFD-F 406

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
           ++    KEE   L ANKIED+  +  RQI+F  FE +LH +     ++ T  IN+IW+E 
Sbjct: 407 IKDKLKKEELLSLYANKIEDIFATFYRQINFTCFERRLHAQE---NELSTEEINKIWMEE 463

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
            ++    +  L+   Y S+W  +PHFI S FY YAYA+   LV +LY +YKS   + FKE
Sbjct: 464 SQKMFQDSVKLTK-NYASWWSYIPHFIHSPFYCYAYAYAQLLVLALYGLYKSKKCENFKE 522

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
            Y+ +L  G S    EL+     ++ D NFWE G++ ++K+I++
Sbjct: 523 LYIKMLSLGGSVSPKELVGMFGFDIEDENFWEIGIKEIQKLINE 566


>gi|153951528|ref|YP_001397788.1| oligoendopeptidase F [Campylobacter jejuni subsp. doylei 269.97]
 gi|152938974|gb|ABS43715.1| oligoendopeptidase F [Campylobacter jejuni subsp. doylei 269.97]
          Length = 573

 Score =  304 bits (779), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 197/584 (33%), Positives = 309/584 (52%), Gaps = 21/584 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  L+  HD + + N  +    +SL FK  +E  L       N +    A+ +YE + 
Sbjct: 4   WDLSALF--HDKEALQNFTQDQIQQSLNFKKNYENKLYAL----NANEFLQALKDYEHLN 57

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           + +G+I +YA L +  N  + +   FY     +    E+ L+FF LE   L     E+S 
Sbjct: 58  QALGKIMTYAYLLFAKNTQNGS---FYAQYEEECKKIEENLLFFELEFCELAP---EKSQ 111

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
                   Y  ++ N+ + K++ LS + E ++   S  G  A  R F E++ +L+     
Sbjct: 112 EFTTFCKDYDFYLSNLLQNKRYNLSKNEERIILYLSNTGANAFSRLFDESMSALKIPFKG 171

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           +K+   +     +D DR++RK AAK  S    K+S + SFI N +  + +     R YE 
Sbjct: 172 KKLSEEEILSKMYDEDRKIRKKAAKKFSKVLQKNSRLLSFIINMIKTERKNISLLRGYEN 231

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
              SRH+SN +    +++L+ S + ++   S ++Y+ KK+ L  D +  +DR AP+   +
Sbjct: 232 AEISRHISNQISQKSVDSLIASAQKHFDLVS-QFYKRKKQILGYDELKDYDRYAPIGKEA 290

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
                F+ ++++VL+++  FSPQ   IA+  F   WID    + K  GAF+H      HP
Sbjct: 291 S--FDFKTSKNIVLEAFQAFSPQFYDIAKNAFDQGWIDVYPQENKQGGAFSHSATSDAHP 348

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           ++LLNY  K +D+ TLAHELGH IH  LS      L  N+ LT AETAS+F E L FD  
Sbjct: 349 FVLLNYTDKRRDLFTLAHELGHTIHQKLSYNV-SYLNQNTPLTTAETASVFAEMLVFD-F 406

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
            +    KEE   L ANKIED+  +  RQI+F  FE +LH +     ++ T  IN+IW+E 
Sbjct: 407 TKDKLKKEELLSLYANKIEDIFATFYRQINFTCFERRLHAQE---NELNTEEINKIWMEE 463

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
            ++    +  L+   Y S+W  +PHFI S FY YAYA+   LV +LY +YKS   + FKE
Sbjct: 464 SQKMFQDSVKLTK-NYASWWSYIPHFIHSPFYCYAYAYAQLLVLALYGLYKSKKCENFKE 522

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
            Y+ +L  G S    EL+     ++ D NFWE G++ ++K+I++
Sbjct: 523 LYIKMLSLGGSVSPKELVGMFGFDIEDENFWEIGIKEIQKLINE 566


>gi|88596457|ref|ZP_01099694.1| oligoendopeptidase F [Campylobacter jejuni subsp. jejuni 84-25]
 gi|88191298|gb|EAQ95270.1| oligoendopeptidase F [Campylobacter jejuni subsp. jejuni 84-25]
 gi|284926328|gb|ADC28680.1| oligoendopeptidase F [Campylobacter jejuni subsp. jejuni IA3902]
          Length = 573

 Score =  304 bits (779), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 196/584 (33%), Positives = 310/584 (53%), Gaps = 21/584 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  L+  HD + + N  +    +SL FK  +E  L       N +    A+ +YE + 
Sbjct: 4   WDLSALF--HDKEALQNFTQDQIQQSLNFKKNYENKLYTL----NANEFLQALKDYENLN 57

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           + +G+I +YA L +  N  + +   FY     +    E+ L+FF LE   L     E+S 
Sbjct: 58  QALGKIMTYAYLLFAKNTQNGS---FYAQYEEECKKIEENLLFFELEFCELAP---EKSR 111

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
                   Y  ++ N+ + K++ LS + E ++   S  G  A  R F E++ +L+     
Sbjct: 112 EFTTFCKDYDFYLSNLLQNKRYNLSKNEERIMLYLSNTGANAFSRLFDESMSALKIPFEG 171

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           +K+   +     +D +R++RK AAK  S    K+S + SFI N +  + +     R YE 
Sbjct: 172 KKLSEEEILSKMYDENRKIRKKAAKKFSKVLQKNSRLLSFIINMIKTERKNISLLRGYEN 231

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
              SRH+SN +    +++L+ S + ++   S ++Y+ KK+ L  D +  +DR AP+   +
Sbjct: 232 AEISRHISNQISQKSVDSLIASAQKHFNLVS-QFYKRKKQILGYDELKDYDRYAPIGKEA 290

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
                F+ ++++VL+++  FSPQ   IA+  F   WID    + K  GAF+H      HP
Sbjct: 291 S--FDFKTSKNIVLEAFQAFSPQFYDIAKNAFDQGWIDVYPQENKQGGAFSHSATSDAHP 348

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           ++LLNY  K +D+ TLAHELGH IH  LS      L  N+ LT AETAS+F E L FD  
Sbjct: 349 FVLLNYTNKRRDLFTLAHELGHTIHQKLSYNV-SYLNQNTPLTTAETASVFAEMLVFD-F 406

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
           ++    KEE   L ANKIED+  +  RQI+F  FE +LH +     ++ T  IN+IW+E 
Sbjct: 407 IKDKLKKEELLSLYANKIEDIFATFYRQINFTCFERRLHAQE---NELSTEEINKIWMEE 463

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
            ++    +  L+   Y S+W  +PHFI S FY YAYA+   LV +LY +YKS   + FKE
Sbjct: 464 SQKMFQDSVKLTK-NYASWWSYIPHFIHSPFYCYAYAYAQLLVLALYGLYKSKKCENFKE 522

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
            Y+ +L  G S    EL+     ++ D NFWE G++ ++K+I++
Sbjct: 523 LYIKMLSLGGSVSPKELVGMFGFDIEDENFWEIGIKEIQKLINE 566


>gi|205355845|ref|ZP_03222614.1| peptidase (M3 family) [Campylobacter jejuni subsp. jejuni CG8421]
 gi|205346279|gb|EDZ32913.1| peptidase (M3 family) [Campylobacter jejuni subsp. jejuni CG8421]
          Length = 573

 Score =  304 bits (778), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 196/584 (33%), Positives = 308/584 (52%), Gaps = 21/584 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  L+  HD + + N  +    +SL FK  +E  L       N +    A+ +YE + 
Sbjct: 4   WDLSALF--HDKEALQNFTQDQIQQSLNFKKNYENKLYAL----NANEFLQALKDYEHLN 57

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           + +G+I +Y  L +  N  + +   FY     +    E+ L+FF LE   L     E+S 
Sbjct: 58  QALGKIMTYVYLLFAKNTQNGS---FYAQYEEECKKIEENLLFFELEFCELAP---EKSQ 111

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
                   Y  ++ N+ + K++ LS + E ++   S  G  A  R F E++ +L+     
Sbjct: 112 EFTTFCKDYDFYLSNLLQNKRYNLSKNEERIILYLSNTGANAFSRLFDESMSALKIPFEG 171

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           +K+   +     +D DR+ RK AAK  S    K+S + SFI N +  + +     R YE 
Sbjct: 172 KKLSEEEILSKMYDEDRKTRKKAAKKFSKVLRKNSRLLSFIINMIKTERKNISLLRGYEN 231

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
              SRH+SN +    +++L+ S + ++   S ++Y+ KK+ L  D +  +DR AP+   +
Sbjct: 232 AEISRHISNQISQKSVDSLIASAQKHFDLVS-QFYKRKKQILGYDELKDYDRYAPIGKEA 290

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
                F+ ++++VL+++  FSPQ   IA+  F   WID    + K  GAF+H      HP
Sbjct: 291 S--FDFKTSKNIVLEAFQAFSPQFYDIAKNAFDQGWIDVYPQENKQGGAFSHSATSDAHP 348

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           ++LLNY  K +D+ TLAHELGH IH  LS      L  N+ LT AETAS+F E L FD  
Sbjct: 349 FVLLNYTDKRRDLFTLAHELGHTIHQKLSYNV-SYLNQNTPLTTAETASVFAEMLVFD-F 406

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
           ++    KEE   L ANKIED+  +  RQI+F  FE +LH +     ++ T  IN+IW+E 
Sbjct: 407 IKDKLKKEELLSLYANKIEDIFATFYRQINFTCFERRLHAQE---NELNTEEINKIWMEE 463

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
            ++    +  L+   Y S+W  +PHFI S FY YAYA+   LV +LY +YKS   + FKE
Sbjct: 464 SQKMFQDSVKLTK-NYASWWSYIPHFIHSPFYCYAYAYAQLLVLALYGLYKSKKCENFKE 522

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
            Y+ +L  G S    EL+     ++ D NFWE G++ ++K+I++
Sbjct: 523 LYIKMLSLGGSVSPKELVGMFGFDIEDENFWEIGIKEIQKLINE 566


>gi|222824053|ref|YP_002575627.1| oligoendopeptidase F [Campylobacter lari RM2100]
 gi|222539275|gb|ACM64376.1| oligoendopeptidase F [Campylobacter lari RM2100]
          Length = 573

 Score =  304 bits (778), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 194/591 (32%), Positives = 305/591 (51%), Gaps = 21/591 (3%)

Query: 36  LPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYE 95
           +  WNL  L+   D QE++  ++  + E+  FK ++E NL    N++       A+  YE
Sbjct: 1   MQNWNLSTLFK--DEQELNLFLQKTQDEACEFKKQYENNLHSLDNEQ----FLQALKNYE 54

Query: 96  RICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLE 155
            +   +  I +Y  L++  + +       Y +++ K+   E+ L+FF LE   L E   E
Sbjct: 55  ELILKLSHILTYVYLNFAQDTTKGAFYAKYENLSKKI---EENLLFFELEFCELKE---E 108

Query: 156 QSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFK 215
           +S         Y  ++ N+ K KKH LS   E ++   S  G  A  R F E   +L+F 
Sbjct: 109 KSKTFITFCKDYEFYLNNLIKHKKHNLSKKEERVILALSSTGSNAFARLFDETFSALKFN 168

Query: 216 INDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRK 275
              QK+   +     +D DR +RK A+K  S T  K + +  +I N +  +       R 
Sbjct: 169 FEGQKLSEEEILSKLYDKDRSIRKKASKCFSKTLKKQNKLLVYIFNMIKSELASICELRS 228

Query: 276 YEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLP 335
           YE     RH+ N +    ++AL+ + +N +   S ++Y  KKK L    +  +DR AP+ 
Sbjct: 229 YENPETPRHIRNQISKKSVDALISASENSFDIVS-KFYNTKKKILGYKKLKDYDRYAPIG 287

Query: 336 GTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPS 395
              Q  + F+  +D+VL+++ KFS     IA++ F +NWID    + K SGAF+H + P 
Sbjct: 288 KEMQ--VDFDQGKDIVLKAFEKFSKDFYKIAKEAFENNWIDVYPKEFKQSGAFSHSSTPL 345

Query: 396 VHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTF 455
            HP+ILLNY  + +D+ TLAHELGH IH  LS +    L  ++ LT AETAS+F E L F
Sbjct: 346 SHPFILLNYTNQRRDLFTLAHELGHTIHQKLSYKV-SFLNQDTPLTTAETASVFAEMLIF 404

Query: 456 DSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIW 515
           D  ++    KEE   L A KIED+  ++ RQI+F  FE + H ++    ++    ++EIW
Sbjct: 405 D-YIKENLDKEELLSLYAAKIEDIFATLYRQINFTTFERRFHAKKE---ELSAQELSEIW 460

Query: 516 LETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDC 575
           LE  ++    +  L+   YG ++  +PHFI S FY YAYA+   LV +LY +YKS     
Sbjct: 461 LEESRKMFQDSVVLTK-NYGLWYSYIPHFIHSPFYCYAYAYAQLLVLALYGLYKSGKCPD 519

Query: 576 FKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           F   Y+  L +G SK   EL+     ++    FW  GL+ V  ++DD  ++
Sbjct: 520 FTSIYIEFLSSGGSKSPKELVAMFGFDIESDEFWNIGLEQVRILVDDFLRL 570


>gi|283956496|ref|ZP_06373976.1| oligoendopeptidase F [Campylobacter jejuni subsp. jejuni 1336]
 gi|283792216|gb|EFC31005.1| oligoendopeptidase F [Campylobacter jejuni subsp. jejuni 1336]
          Length = 573

 Score =  304 bits (778), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 196/584 (33%), Positives = 309/584 (52%), Gaps = 21/584 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  L+  HD + + N  +    +SL FK  +E  L       N +    A+ +YE + 
Sbjct: 4   WDLSALF--HDKEALQNFTQDQIQQSLNFKKNYENKLYTL----NANEFLQALKDYEILN 57

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           + +G+I +Y  L +  N  + +   FY     +    E+ L+FF LE   L     E+S 
Sbjct: 58  QALGKIMTYTYLLFAKNTQNGS---FYAQYEEECKKIEENLLFFELEFCELAP---EKSQ 111

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
                   Y  ++ N+ + K++ LS + E ++   S  G  A  R F E++ +L+     
Sbjct: 112 KFTTFCKDYDFYLSNLLQNKRYNLSKNEERIMLYLSNTGANAFSRLFDESMSALKIPFEG 171

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           +K+   +     +D DR++RK AAK  S    K+S + SFI N +  + +     R YE 
Sbjct: 172 KKLSEEEVLSKMYDEDRKIRKKAAKKFSKVLQKNSRLLSFIINMIKTERKNISLLRGYEN 231

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
              SRH+SN +    +++L+ S + ++   S ++Y+ KK+ L  D +  +DR AP+   +
Sbjct: 232 AEISRHISNQISQKSVDSLIASAQKHFNLVS-QFYKRKKQILGYDELKDYDRYAPIGKEA 290

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
                F+ ++++VL+++  FSPQ   IA+  F   WID    + K  GAF+H      HP
Sbjct: 291 S--FDFKTSKNIVLEAFQAFSPQFYDIAKNAFDQGWIDVYPQENKQGGAFSHSATSDAHP 348

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           ++LLNY  K +D+ TLAHELGH IH  LS      L  N+ LT AETAS+F E L FD  
Sbjct: 349 FVLLNYTDKRRDLFTLAHELGHTIHQKLSYNV-SYLNQNTPLTTAETASVFAEMLVFD-F 406

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
           ++    KEE   L ANKIED+  +  RQI+F  FE +LH +     ++ T  IN+IW+E 
Sbjct: 407 IKDKLKKEELLSLYANKIEDIFATFYRQINFTCFERRLHAQE---NELSTEEINKIWMEE 463

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
            ++    +  L+   Y S+W  +PHFI S FY YAYA+   LV +LY +YKS   + FKE
Sbjct: 464 SQKMFQDSVKLTK-NYASWWSYIPHFIHSPFYCYAYAYAQLLVLALYGLYKSKKCENFKE 522

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
            Y+ +L  G S    EL+     ++ D NFWE G++ ++K+I++
Sbjct: 523 LYIKMLSLGGSVSPKELVGMFGFDIEDENFWEIGIKEIQKLINE 566


>gi|297566476|ref|YP_003685448.1| PepF/M3 family oligoendopeptidase [Meiothermus silvanus DSM 9946]
 gi|296850925|gb|ADH63940.1| oligoendopeptidase, pepF/M3 family [Meiothermus silvanus DSM 9946]
          Length = 603

 Score =  303 bits (777), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 182/592 (30%), Positives = 307/592 (51%), Gaps = 16/592 (2%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L DLY S    E+ +D+E  + E+ +F+ R+ GN+A  +  +    L AA+  YE I 
Sbjct: 23  WDLSDLYASPTDPELIHDLEAAKAEARSFRERYAGNMATLSPTQ----LEAAMRSYEAIL 78

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           E   +  ++A L++  +  +  I+K        L +   +L+F  +E+  + E    + +
Sbjct: 79  ERAYKPLTFASLAFATDTQNDIIKKVQDQARQALTEVHNLLLFVEIELKAMPEEEFAK-F 137

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIN- 217
            Q P       W+  +R    H LS   E +L+  S  GR A  +F+ E     RF++  
Sbjct: 138 LQAPELAPLHHWLARLRAYAPHTLSEKEERVLNLKSLTGRMAWSQFYTEYTSRFRFRVQV 197

Query: 218 ---DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWR 274
              ++++   +        D  VR++A  AL   + + +   ++I NT+ +D       R
Sbjct: 198 DGEEKELNDPQTRSLLRHPDPAVRRNAHAALYGKYAEEAPTLTYIFNTVLQDRLTDLELR 257

Query: 275 KYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPL 334
            Y        L + + P  IE L+ + + +YP    RY+ LK + L  + +   DRLAP 
Sbjct: 258 GYTHPLGQTALDDELTPEEIERLLAATEAHYPLVE-RYHRLKARRLGFERLPSADRLAPW 316

Query: 335 PGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIP 394
               +  + +  A+++ L++  +FSP++  IA++FF   WID     GK  GAF  G +P
Sbjct: 317 --GQEPKVSYLEAKEMTLEALGRFSPKLRQIAQEFFDKRWIDVFPKKGKRGGAFCSGGLP 374

Query: 395 SVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLT 454
           S HPY+LLN+        TLAHE+GHG+H++L    Q +L   ++  LAETAS+F E L 
Sbjct: 375 STHPYLLLNHTDDLDSAHTLAHEMGHGLHYMLMRH-QRLLNFGATTPLAETASVFAEILL 433

Query: 455 FDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEI 514
            D +L+  +S+EER  LLAN++ED +N+  RQ+ +  +EL+    R+  G  P    N++
Sbjct: 434 DDLILERLNSEEERAALLANRLEDAVNTAFRQVMYTRWELEAQQARKD-GIQPAELYNQL 492

Query: 515 WLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVD 574
           W +  ++  G + + ++L++ + W  +PHF+   FY Y+YA+G  LV +LY+ Y+     
Sbjct: 493 WRQENQKLYGQSMEFTELDWVA-WSGIPHFVHYRFYCYSYAYGYLLVLALYNRYREEG-Q 550

Query: 575 CFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            F  KYL IL AG S     +L    IN +DP FWE   + +E  + ++E +
Sbjct: 551 AFVPKYLEILAAGESDSPQGILAKAGINPADPGFWEGSFKVIESWLSELEAL 602


>gi|154174341|ref|YP_001408532.1| putative oligoendopeptidase F [Campylobacter curvus 525.92]
 gi|112803050|gb|EAU00394.1| putative oligoendopeptidase F [Campylobacter curvus 525.92]
          Length = 571

 Score =  303 bits (777), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 178/533 (33%), Positives = 285/533 (53%), Gaps = 15/533 (2%)

Query: 94  YERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEAL 153
           YE +   I ++++YA L +  ++S       + DI  K    ++ L+FF +  N  D+A 
Sbjct: 53  YESLLMRISKVSTYAFLVFAKDMSKGAFYAKFEDICTKA---QENLLFFEIMFNEFDDAK 109

Query: 154 LEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLR 213
            +Q+  +   T  Y  ++ N+ K K H LS   E +L  T+  G +   R F E + +++
Sbjct: 110 -QQNIIKASKTHGY--YLSNVAKAKAHQLSVKEEQILLRTANTGSDGFARLFDETMSAMK 166

Query: 214 FKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRW 273
           FK   +++   +      D DR VRK AAK+LS T  K+ H+F +I N +    +     
Sbjct: 167 FKFKGERLGEEEILSKLHDKDRNVRKLAAKSLSDTLAKNQHLFGYIYNMIKTSLKTSCEL 226

Query: 274 RKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAP 333
           R ++   + RHL N      ++AL++  +  +   S ++Y+ K+K L L  +Y +DR AP
Sbjct: 227 RNFKLPEEPRHLENQTSKKSVDALIKVTEANFDLVS-KFYDKKRKILGLKKLYDYDRYAP 285

Query: 334 LPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTI 393
           L G S+    F+  +++VL+++  FSP+   IA++ F   WID      K  GAF+H   
Sbjct: 286 LEGESE--YKFQKCKNIVLKAFRDFSPKFGAIAQRAFDEGWIDVYPTPNKRGGAFSHSGS 343

Query: 394 PSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETL 453
           P  HPY+LLN+    +D+ TLAHELGH IH  LS    G L   + LT AETAS+F E L
Sbjct: 344 PDAHPYVLLNHTDGRRDLFTLAHELGHAIHQNLSYGV-GFLNAETPLTTAETASVFCEML 402

Query: 454 TFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINE 513
            FD +      K E+  LLA KIED+  ++ RQI+F  FE ++H      G+I    IN+
Sbjct: 403 VFDYVKNTLKGK-EKISLLAGKIEDIFATLYRQINFTTFERRIHAYE---GEISLETINQ 458

Query: 514 IWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTV 573
           IW +   +  G +  L+D  Y  +W  +PHFI + FY YAY++   LV +++ ++KS   
Sbjct: 459 IWQQESAKMFGKSVVLNDY-YKIWWSYIPHFIHTPFYCYAYSYAQLLVLAIFGLFKSGKC 517

Query: 574 DCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           + F + Y   L  G S+   EL+     ++ D  FW+ G+  V+K++D+ E +
Sbjct: 518 ENFVQIYTEFLSLGGSRSPKELVAKFGFDIEDAKFWQIGINEVKKLVDEFEGL 570


>gi|86150304|ref|ZP_01068530.1| oligoendopeptidase F [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|85839129|gb|EAQ56392.1| oligoendopeptidase F [Campylobacter jejuni subsp. jejuni CF93-6]
          Length = 573

 Score =  303 bits (777), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 196/584 (33%), Positives = 309/584 (52%), Gaps = 21/584 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  L+  HD + + N  +    +SL FK  +E  L       N +    A+ +YE + 
Sbjct: 4   WDLSALF--HDKEALQNFTQDQIQQSLNFKKNYENKLYTL----NANEFLQALKDYENLN 57

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           + +G+I +YA L +  N  + +   FY     +    E+ L+FF LE   L     E+S 
Sbjct: 58  QALGKIMTYAYLLFAKNTQNGS---FYAQYEEECKKIEENLLFFELEFCELAP---EKSR 111

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
                   Y  ++ N+ + K++ LS + E ++   S  G  A  R F E++ +L+     
Sbjct: 112 EFTTFCKDYDFYLSNLLQNKRYNLSKNEERIMLYLSNTGANAFSRLFDESMSALKIPFEG 171

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           +K+   +     +D +R++RK AAK  S    K+S + SFI N +  + +     R YE 
Sbjct: 172 KKLSEEEILSKMYDENRKIRKKAAKKFSKVLQKNSRLLSFIINMIKTERKNISLLRGYEN 231

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
              SRH+SN +    ++ L+ S + ++   S ++Y+ KK+ L  D +  +DR AP+   +
Sbjct: 232 AEISRHISNQISQKSVDFLIASAQKHFNLVS-QFYKRKKQILGYDELKDYDRYAPIGKEA 290

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
                F+ ++++VL+++  FSPQ   IA+  F   WID    + K  GAF+H      HP
Sbjct: 291 S--FDFKTSKNIVLEAFQAFSPQFYDIAKNAFDQGWIDVYPQENKQGGAFSHSATSDAHP 348

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           ++LLNY  K +D+ TLAHELGH IH  LS      L  N+ LT AETAS+F E L FD  
Sbjct: 349 FVLLNYTNKRRDLFTLAHELGHTIHQKLSYNV-SYLNQNTPLTTAETASVFAEMLVFD-F 406

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
           ++    KEE   L ANKIED+  +  RQI+F  FE +LH +     ++ T  IN+IW+E 
Sbjct: 407 IKDKLKKEELLSLYANKIEDIFATFYRQINFTCFERRLHAQE---NELSTEEINKIWMEE 463

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
            ++    +  L+   Y S+W  +PHFI S FY YAYA+   LV +LY +YKS   + FKE
Sbjct: 464 SQKMFQDSVKLTK-NYASWWSYIPHFIHSPFYCYAYAYAQLLVLALYGLYKSKKCENFKE 522

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
            Y+ +L  G S    EL+     ++ D NFWE G++ ++K+I++
Sbjct: 523 LYIKMLSLGGSVSPKELVGMFGFDIEDENFWEIGIKEIQKLINE 566


>gi|283954664|ref|ZP_06372182.1| peptidase (M3 family) [Campylobacter jejuni subsp. jejuni 414]
 gi|283793856|gb|EFC32607.1| peptidase (M3 family) [Campylobacter jejuni subsp. jejuni 414]
          Length = 573

 Score =  303 bits (776), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 198/587 (33%), Positives = 310/587 (52%), Gaps = 21/587 (3%)

Query: 36  LPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYE 95
           +  W+L  L+  HD + + N  +    +SL FK  +E  L H  N    +    A+  YE
Sbjct: 1   MLEWDLSALF--HDKETLQNFTQDQIQQSLNFKKNYENKL-HTLN---ANDFLQALKNYE 54

Query: 96  RICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLE 155
            + +  G+I +YA L +  N  + +   FY     +    E+ L+FF LE   L     E
Sbjct: 55  NLNQAFGKIMTYAYLLFAKNTQNGS---FYAKYEEECKKIEENLLFFELEFCELSS---E 108

Query: 156 QSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFK 215
           +S         YS ++ N+ + K + LS + E ++   S  G  A  R F E++ +L+  
Sbjct: 109 KSQEFITFCKDYSFYLSNLLQNKLYNLSKNEERIMLYLSNTGANAFSRLFDESMSALKIP 168

Query: 216 INDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRK 275
              +K+   +     +D DR++RK AAK  S    K+S + SFI N +  + +     R 
Sbjct: 169 FEGKKLSKEEILSKMYDEDRKIRKKAAKKFSKVLQKNSRLLSFIINMIKTERKNISSLRG 228

Query: 276 YEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLP 335
           Y+    SRH+SN +    +++L+ S + ++   S ++Y+ KK+ L  D +  +DR AP+ 
Sbjct: 229 YKNAEISRHISNQISQKSVDSLIISAQKHFDLVS-QFYKRKKQILGYDDLKDYDRYAPIG 287

Query: 336 GTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPS 395
             +     F+ ++++VL+++  FSPQ   IA+  F   WID    + K  GAF+H     
Sbjct: 288 KEAS--FDFKTSKNIVLEAFQAFSPQFYDIAKNAFDKGWIDVYPQENKQGGAFSHSATSD 345

Query: 396 VHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTF 455
            HP++LLNY  K +D+ TLAHELGH IH  LS      L  N+ LT AETAS+F E L F
Sbjct: 346 AHPFVLLNYTDKRRDLFTLAHELGHTIHQKLSYSV-SYLNQNTPLTTAETASVFAEMLVF 404

Query: 456 DSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIW 515
           D  ++    KEE   L ANKIED+  +  RQI+F  FE +LH +     ++ T  IN+IW
Sbjct: 405 D-FIKDKLKKEELLSLYANKIEDIFATFYRQINFTCFERRLHAQE---NELSTEEINKIW 460

Query: 516 LETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDC 575
           +E  ++    +  L+   Y S+W  +PHFI S FY YAYA+   LV +LY +Y+S   + 
Sbjct: 461 MEESQKMFQNSVKLTK-NYASWWSYIPHFIHSPFYCYAYAYAQLLVLALYGLYRSKKCEN 519

Query: 576 FKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
           FKE Y+ +L  G S    EL+     ++ D NFWE G++ ++K+ID+
Sbjct: 520 FKELYIKMLSLGGSVSPKELVGMFGFDIEDENFWEIGIKEIQKLIDE 566


>gi|86151092|ref|ZP_01069308.1| oligoendopeptidase F [Campylobacter jejuni subsp. jejuni 260.94]
 gi|315124579|ref|YP_004066583.1| oligoendopeptidase F [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
 gi|85842262|gb|EAQ59508.1| oligoendopeptidase F [Campylobacter jejuni subsp. jejuni 260.94]
 gi|315018301|gb|ADT66394.1| oligoendopeptidase F [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
          Length = 573

 Score =  303 bits (775), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 195/584 (33%), Positives = 308/584 (52%), Gaps = 21/584 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  L+  HD + + N  +    +SL FK  +E  L       + +    A+ +YE + 
Sbjct: 4   WDLSALF--HDKEALQNFTQDQIQQSLNFKKNYENKLYTL----DANEFLQALKDYENLN 57

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           + +G+I +Y  L +  N  + +   FY     +    E+ L+FF LE   L     E+S 
Sbjct: 58  QALGKIMTYVYLLFAKNTQNGS---FYAQYEEECKKIEENLLFFELEFCELTP---EKSQ 111

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
                   Y  ++ N+ + K++ LS + E ++   S  G  A  R F E++ +L+     
Sbjct: 112 EFTTFCKDYDFYLSNLLQNKRYNLSKNEERIMLYLSNTGANAFSRLFDESMSALKIPFEG 171

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           +K+   +     +D DR++RK AAK  S    K+S + SFI N +  + +     R YE 
Sbjct: 172 KKLSEEEILSKMYDEDRKIRKKAAKKFSKVLQKNSRLLSFIINMIKTERKNISLLRGYEN 231

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
              SRH+SN +    +++L+ S + ++   S ++Y+ KK+ L  D +  +DR AP+    
Sbjct: 232 AEISRHISNQISQKSVDSLIASAQKHFNLVS-QFYKRKKQILGYDELKDYDRYAPIGKEV 290

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
                F+ ++++VL+++  FSPQ   IA+  F   WID    + K  GAF+H      HP
Sbjct: 291 S--FDFKTSKNIVLEAFQAFSPQFYDIAKNAFNQGWIDVYPQENKQGGAFSHSATSDAHP 348

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           ++LLNY  K +D+ TLAHELGH IH  LS      L  N+ LT AETAS+F E L FD  
Sbjct: 349 FVLLNYTNKRRDLFTLAHELGHTIHQKLSYNV-SYLNQNTPLTTAETASVFAEMLVFD-F 406

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
           ++    KEE   L ANKIED+  +  RQI+F  FE +LH +     ++ T  IN+IW+E 
Sbjct: 407 IKDKLKKEELLSLYANKIEDIFATFYRQINFTCFERRLHAQE---NELSTEEINKIWMEE 463

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
            ++    +  L+   Y S+W  +PHFI S FY YAYA+   LV +LY +YKS   + FKE
Sbjct: 464 SQKMFQDSVKLTK-NYASWWSYIPHFIHSPFYCYAYAYAQLLVLALYGLYKSKKCENFKE 522

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
            Y+ +L  G S    EL+     ++ D NFWE G++ ++K+I++
Sbjct: 523 LYIKMLSLGGSVSPKELVGMFGFDIEDENFWEIGIKEIQKLINE 566


>gi|218562713|ref|YP_002344492.1| peptidase [Campylobacter jejuni subsp. jejuni NCTC 11168]
 gi|112360419|emb|CAL35216.1| peptidase [Campylobacter jejuni subsp. jejuni NCTC 11168]
          Length = 573

 Score =  302 bits (774), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 195/584 (33%), Positives = 310/584 (53%), Gaps = 21/584 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  L+  HD + + N  +    +SL FK  +E  L       N +    A+ +YE + 
Sbjct: 4   WDLSALF--HDKEALQNFTQDQIQQSLNFKKNYENKLYTL----NANEFLQALKDYENLN 57

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           + +G+I +YA L +  N  + +   FY     +    E+ L+FF LE   L     E+S 
Sbjct: 58  QALGKIMTYAYLLFAKNTQNGS---FYAQYEEECKKIEENLLFFELEFCELAP---EKSR 111

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
                   Y  ++ N+ + K++ LS + E ++   S  G  A  R F E++ +L+     
Sbjct: 112 EFTTFCKDYDFYLSNLLQNKRYNLSKNEERIMLYLSNTGANAFSRLFDESMSALKIPFEG 171

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           +K+   +     +D +R++RK AAK  S    K+S + SFI N +  + +     R YE 
Sbjct: 172 KKLSEEEILSKMYDENRKIRKKAAKKFSKVLQKNSRLLSFIINMIKTERKNISLLRGYEN 231

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
              SRH+SN +    +++L+ S + ++   S ++Y+ KK+ L  D +  +DR AP+   +
Sbjct: 232 AEISRHISNQISQKSVDSLIASAQKHFNLVS-QFYKRKKQILGYDELKDYDRYAPIGKEA 290

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
                F+ ++++VL+++  FSPQ   IA+  F   WID    + K  GAF+H      HP
Sbjct: 291 S--FDFKTSKNIVLEAFQAFSPQFYDIAKNAFDQGWIDVYPQENKQGGAFSHSATSDAHP 348

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           ++LLN+  K +D+ TLAHELGH IH  LS      L  N+ LT AETAS+F E L FD  
Sbjct: 349 FVLLNHTNKRRDLFTLAHELGHTIHQKLSYNV-SYLNQNTPLTTAETASVFAEMLVFD-F 406

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
           ++    KEE   L ANKIED+  +  RQI+F  FE +LH +     ++ T  IN+IW+E 
Sbjct: 407 IKDKLKKEELLSLYANKIEDIFATFYRQINFTCFERRLHAQE---NELSTEEINKIWMEE 463

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
            ++    +  L+   Y S+W  +PHFI S FY YAYA+   LV +LY +YKS   + FKE
Sbjct: 464 SQKMFQDSVKLTK-NYASWWSYIPHFIHSPFYCYAYAYAQLLVLALYGLYKSKKCENFKE 522

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
            Y+ +L  G S    EL+     ++ D NFWE G++ ++K+I++
Sbjct: 523 LYIKMLSLGGSVSPKELVGMFGFDIEDENFWEIGIKEIQKLINE 566


>gi|315453336|ref|YP_004073606.1| Oligoendopeptidase F [Helicobacter felis ATCC 49179]
 gi|315132388|emb|CBY83016.1| Oligoendopeptidase F, peptidase (M3 family) [Helicobacter felis
           ATCC 49179]
          Length = 593

 Score =  301 bits (771), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 186/593 (31%), Positives = 309/593 (52%), Gaps = 25/593 (4%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           RW+L  L+ S   +++   M  ++ +  A++ ++  + A    Q        A+ +YE +
Sbjct: 21  RWDLSALFKS--VEDLDAHMASLDKKIKAYEKKYANSFA----QLEAGGFKKAMEDYEEL 74

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQS 157
            E I R  SY  L  + ++    +   Y  + ++L      L+F   E   LD A  E  
Sbjct: 75  SEGISRAMSYVFLILSTDMEKSDLASKYQLLCSELGQH---LLFVENEFCALDSAKQEAL 131

Query: 158 YAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIN 217
               P   KY+  ++ + + K H+LS   E +L  TS VG +A  + F + + +L+    
Sbjct: 132 IQATP---KYAYTLRVLLQQKAHILSLAEEKVLLATSSVGVDAFSQLFDKTLTALKIPFQ 188

Query: 218 DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYE 277
           D+ +   +      + DR++RK A KAL+    K+  + +++ N + KD  I  + R YE
Sbjct: 189 DRLVSEEEILSELHNPDRKLRKKAQKALTKALKKNEMVLTYVLNMVRKDLHIDTKLRHYE 248

Query: 278 KIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGT 337
           K    RHLSN +    ++++++ V + Y     RYY++K K L    +  +DR AP+  T
Sbjct: 249 KPESFRHLSNQIPQASVDSMLEIVNDNYALV-QRYYKIKSKLLGYK-LKDYDRYAPI-DT 305

Query: 338 SQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVH 397
            ++ I ++ A DLVL++Y  FSP+   IAE+   H W+D+     K  GAF+  T+PS H
Sbjct: 306 KENPITYQEALDLVLKAYKDFSPKFHSIAEQALAHGWVDSHPRPLKRGGAFSDSTVPSAH 365

Query: 398 PYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDS 457
           P++LLN+    +   T+AHE GH IH  LS +  G L  N+ LT +ETAS+FGE L F+S
Sbjct: 366 PFVLLNFTNNRRSAFTIAHEFGHMIHQTLSKQV-GYLNANTPLTTSETASVFGEMLLFES 424

Query: 458 LLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLE 517
           L  + + KE R I  A K+EDM +++ RQ+   +FE ++H+   +  ++     + IW E
Sbjct: 425 LKPSLNKKELRNI-YAGKLEDMFSTMFRQVVMTNFERRIHS---TENELKAEDFDTIWQE 480

Query: 518 TQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTV---- 573
              +  G +  L+   Y  +W  +PHFI S FY YAY++G  LV +L+ +Y+        
Sbjct: 481 ENAKMFGKSVKLTK-NYARWWSYIPHFIHSPFYCYAYSYGQLLVLALFGLYRQKQTPSEK 539

Query: 574 DCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
             F E Y   L  G S+   EL+    ++++D  FW+ G+  VEKM+ + E +
Sbjct: 540 KAFVETYTEFLSKGGSQSPEELVGMFGLDIADKEFWKIGMGEVEKMLGEFEDL 592


>gi|57242256|ref|ZP_00370195.1| oligoendopeptidase F [Campylobacter upsaliensis RM3195]
 gi|57016936|gb|EAL53718.1| oligoendopeptidase F [Campylobacter upsaliensis RM3195]
          Length = 574

 Score =  299 bits (765), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 196/587 (33%), Positives = 302/587 (51%), Gaps = 21/587 (3%)

Query: 36  LPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYE 95
           +  W+L  L+ + +  E        + E   FK ++E  +AH + ++   SL     +YE
Sbjct: 1   MLEWDLSALFKNEEELEAFTCENIRQAEE--FKQKYEKKIAHLSKEEFLSSL----KQYE 54

Query: 96  RICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLE 155
            + E   +I +YA L +  N S+     FY     K    E+ L+FF LE   L E L  
Sbjct: 55  NLNENATKIMTYAYLCFTKNTSNGD---FYARYEEKCKKIEENLLFFELEFCEL-ETLKS 110

Query: 156 QSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFK 215
             +        Y  +++ + K K+  LS   E +L   S  G  A  R F E++ +LR  
Sbjct: 111 SEFV--AFCEDYRFYLETLLKNKEFNLSQKEERILLYLSNTGANAFSRLFDESMSALRIN 168

Query: 216 INDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRK 275
              QK+   +     + +DR+VRK AAK  +   NK++ + SFI N +  + +     R 
Sbjct: 169 FEGQKLSEEEILSKLYHNDRKVRKKAAKNFTKALNKNASLLSFILNMIKTELKNICHLRG 228

Query: 276 YEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLP 335
           YE     RHLSN +    ++AL+ SV+  Y      +Y LKK+ L    +  +DR APL 
Sbjct: 229 YENAEMPRHLSNQISQKSVDALILSVEKSYHLVED-FYLLKKQILGFKELKDYDRYAPLG 287

Query: 336 GTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPS 395
             +     FE ++D+VL+++  FS +   IA++ F + WID      K  GAF+H    +
Sbjct: 288 KEAN--FSFEKSKDIVLKAFKSFSSEFEDIAKEAFENGWIDVYPQKNKQGGAFSHSATST 345

Query: 396 VHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTF 455
            HP++LLN+  + +D+ TLAHELGH IH  LS +    L  N+ LT AETAS+F E L F
Sbjct: 346 AHPFVLLNFTNQRRDLFTLAHELGHTIHQKLSYKV-SFLNQNTPLTTAETASVFAEMLVF 404

Query: 456 DSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIW 515
           D +     S EE   L A KIED+  ++ RQI+F  FE ++H E     ++   +I+ IW
Sbjct: 405 DYVKNKLKS-EELIALYAAKIEDIFATLYRQINFTCFERRVHKEE---NELKKEQIDAIW 460

Query: 516 LETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDC 575
           +E   +  G +  L+   Y S+W  +PHFI S FY YAY++   LV +LY +YKS   + 
Sbjct: 461 MEESVKMFGKSVKLTK-NYASWWSYIPHFIHSPFYCYAYSYAQLLVLALYGLYKSGKCEN 519

Query: 576 FKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
           FKE Y+ +L  G S    EL+     ++ D NFW+ G+  +EK++ +
Sbjct: 520 FKELYIKMLSLGGSVSPKELISVFGFDVEDENFWQFGICEIEKLLKE 566


>gi|157163913|ref|YP_001467055.1| rhomboid family protein [Campylobacter concisus 13826]
 gi|112800442|gb|EAT97786.1| putative oligoendopeptidase F [Campylobacter concisus 13826]
          Length = 573

 Score =  298 bits (764), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 190/584 (32%), Positives = 303/584 (51%), Gaps = 21/584 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L+ L+   + +E   +   ++ E   FK ++   L    N K    L  A  EYE + 
Sbjct: 4   WDLKALFA--NEKECEQNALNLQKECEKFKDKY---LEIYENLKTDQFL-KAFGEYESLI 57

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
             I ++ +YA L++  + S      FY  I+       + LIFF ++ N       E+  
Sbjct: 58  AKISKVMTYAFLNFAKDTSKGA---FYAKIDEIATKANENLIFFEIKFNEFAPEKQEEII 114

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
                  KY  ++ N+ K K H LS   E +L  T+  G E   R F E++  +RFK   
Sbjct: 115 KSSK---KYGYYLSNLAKAKPHQLSVAEERVLLRTASTGAEGFSRLFDESMSKMRFKFKG 171

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           + +   +      +SD+ VRK AAK+LS+  +K  H+  +I N +  D +     R ++ 
Sbjct: 172 ELLSEEEILAKLHESDQSVRKLAAKSLSNELSKHQHLLGYIYNMIKTDLKTSCELRNFKL 231

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
             + RHL N +    +++L+   +  +   S ++YE K++ L L  +Y +DR APL  +S
Sbjct: 232 PEEPRHLENQITKKSVDSLIAVTEKNFDLVS-KFYERKREILGLKKLYDYDRYAPL--SS 288

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
           +    F+  + +VL+++  FSP+   IA+  F+  WID      K  GAF+H      HP
Sbjct: 289 EGEYKFDECKKVVLKAFGTFSPKFGDIAKSAFSDGWIDVYPAPNKRGGAFSHSGSSDTHP 348

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           Y+LLN+  + +D+ TLAHELGH +H  LS      L +++ LT AETAS+F E L FD  
Sbjct: 349 YVLLNHTNQRRDLFTLAHELGHAVHQKLSYSV-SYLNSDTPLTTAETASVFCEMLVFDH- 406

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
           ++   SK+E+  LLA KIED+  ++ RQI+F  FE  +H      G+I    +N+IWL  
Sbjct: 407 IKDGLSKKEKISLLAGKIEDIFATLYRQINFTTFERAVHAHE---GEIGLDELNKIWLRE 463

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
            K+  G +  L+D  Y  +W  +PHFI + FY YAY++   LV +L+ +YKS   + F E
Sbjct: 464 SKKMFGKSVTLNDY-YKIWWSYIPHFIHTPFYCYAYSYAQLLVLALFGLYKSGKCENFVE 522

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
            Y   L  G S    EL+     ++ D NFW+ G+  V+K++D+
Sbjct: 523 IYTEFLSLGGSLSPRELVGKFGFDIDDKNFWQIGINEVKKLVDE 566


>gi|121612359|ref|YP_001000777.1| oligoendopeptidase F [Campylobacter jejuni subsp. jejuni 81-176]
 gi|167005693|ref|ZP_02271451.1| oligoendopeptidase F [Campylobacter jejuni subsp. jejuni 81-176]
 gi|87249215|gb|EAQ72176.1| oligoendopeptidase F [Campylobacter jejuni subsp. jejuni 81-176]
          Length = 572

 Score =  298 bits (764), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 195/584 (33%), Positives = 310/584 (53%), Gaps = 22/584 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  L+  HD + + N  +    +SL FK  +E  L       + +    A+ +YE + 
Sbjct: 4   WDLSALF--HDKEALQNFTQDQIQQSLNFKKNYENKLYTL----DANEFLQALKDYENLN 57

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           + +G+I +YA L +  N  + +   FY     +    E+ L+FF LE   L     E+S 
Sbjct: 58  QALGKIMTYAYLLFAKNTQNGS---FYAQYEEECKKIEENLLFFELEFCELAP---EKSQ 111

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
                   Y  ++ N+ + K++ LS + E ++   S  G  A  R F E++ +L+     
Sbjct: 112 EFTTFCKDYDFYLSNLLQNKRYNLSKNEERIMLYLSNTGANAFSRLFDESMSALKIPFEG 171

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           +K+   +     +D DR++RK AAK  S    K+S + SFI N +  + +     R YE 
Sbjct: 172 KKLSEEEILSKMYDEDRKIRKKAAKKFSKVLQKNSRLLSFIINMIKTERKNISLLRGYEN 231

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
              SRH+SN +    +++L+ S + ++   S ++Y+ KK+ L  + +  +DR AP+   +
Sbjct: 232 AEISRHISNQISQKSVDSLIASAQKHFNLVS-QFYKRKKQILGYE-LKDYDRYAPIGKEA 289

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
                F+ ++++VL+++  FSPQ   IA+  F   WID    + K  GAF+H      HP
Sbjct: 290 S--FDFKTSKNIVLEAFQAFSPQFYDIAKNAFDQGWIDVYPQENKQGGAFSHSATSDAHP 347

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           ++LLNY  K +D+ TLAHELGH IH  LS      L  N+ LT AETAS+F E L FD  
Sbjct: 348 FVLLNYTNKRRDLFTLAHELGHTIHQKLSYHV-SYLNQNTPLTTAETASVFAEMLVFD-F 405

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
           ++    KEE   L ANKIED+  +  RQI+F  FE +LH +     ++ T  IN+IW+E 
Sbjct: 406 IKDKLKKEELLSLYANKIEDIFATFYRQINFTCFERRLHAQE---NELSTEEINKIWMEE 462

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
            ++    +  L+   Y S+W  +PHFI S FY YAYA+   LV +LY +YKS   + FKE
Sbjct: 463 SQKMFQDSVKLTK-NYASWWSYIPHFIHSPFYCYAYAYAQLLVLALYGLYKSKKCENFKE 521

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
            Y+ +L  G S    EL+     ++ D NFWE G++ ++K+I++
Sbjct: 522 LYIKMLSLGGSVSPKELVGMFGFDIEDENFWEIGIKEIQKLINE 565


>gi|239618377|ref|YP_002941699.1| peptidase M3A and M3B thimet/oligopeptidase F [Kosmotoga olearia
           TBF 19.5.1]
 gi|239507208|gb|ACR80695.1| peptidase M3A and M3B thimet/oligopeptidase F [Kosmotoga olearia
           TBF 19.5.1]
          Length = 593

 Score =  298 bits (763), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 184/585 (31%), Positives = 311/585 (53%), Gaps = 15/585 (2%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           +W+L  LY   ++ E++ D+E ++  S     ++EG +    N+ +         + E+I
Sbjct: 9   KWDLSKLYKGPEAAELAEDIEYVKKHSQRISRKFEGRI----NELSTEEFAELFTDVEKI 64

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQS 157
            E+ G++  YA L  + + S+P   K ++ I    ++ E  L+   LE+  +   L E+ 
Sbjct: 65  YEITGKMMMYAYLFLSGDTSNPEANKLFSKIQDVASEVENNLVSLKLELARMPNELFEKQ 124

Query: 158 YAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI- 216
           +   P    Y+ +++  R+ +K+ LS   E L++  +  GREA  + + E   S R++I 
Sbjct: 125 FKM-PQLKDYAHFVQKQREARKYFLSEAEEKLINIKNLTGREAFVKLYTEFTSSFRYEIE 183

Query: 217 -NDQKIPLTKAYKSFFDS--DREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRW 273
            + +K   T++         D E+RK A + L     ++  + + I N++ KD  ++ + 
Sbjct: 184 IDGEKKLFTRSEVDTLKRHPDPEIRKKAFEVLLTKLKENEIVLTNIYNSIVKDWVVESKK 243

Query: 274 RKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAP 333
           RKY      R++ N +   V+++L++ V     K  H YY LK K +K D +   D  AP
Sbjct: 244 RKYPSPISPRNVGNEISDEVVKSLIE-VTTENNKLVHAYYRLKAKIMKKDKLKHSDIYAP 302

Query: 334 LPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTI 393
           L  T ++   ++ A+DLVL+   +F P++  I  +FF   +I AP    K SGAF +   
Sbjct: 303 LETTEKNYT-WKEAKDLVLKVMGEFDPKVEEIIREFFEGEYIHAPVLPNKRSGAFCYYVG 361

Query: 394 PSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETL 453
           P+VHPY+++N+ GK  DV+TLAHELGHG+H VL S+TQ +L  ++ LT+AE AS+F E L
Sbjct: 362 PNVHPYVMVNFTGKQDDVLTLAHELGHGLHGVL-SQTQNLLNYHTPLTMAEVASVFSEML 420

Query: 454 TFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINE 513
             D +L   ++K+E+   +A+++E M  ++ RQ  F  FELK H E+          ++ 
Sbjct: 421 MIDYILNNMTNKDEKIAFIASQLEGMFATMNRQNMFTRFELKAH-EKIEKQYQTFDELSS 479

Query: 514 IWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTV 573
           I+ E  K   G + D  D   G  W  +PH   + FY YAY F   +V +LY+ Y     
Sbjct: 480 IYFEELKNMFGDSIDYFDFS-GYEWAGIPHMFHTPFYCYAYDFAQLMVVALYEKYLEEG- 537

Query: 574 DCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
           + FK+KYL +L +G S     LL  + ++LSDP FW++G   + +
Sbjct: 538 EPFKKKYLELLSSGGSDKPERLLEKVGVDLSDPAFWQKGFDFINR 582


>gi|86153117|ref|ZP_01071322.1| peptidase [Campylobacter jejuni subsp. jejuni HB93-13]
 gi|85844002|gb|EAQ61212.1| peptidase [Campylobacter jejuni subsp. jejuni HB93-13]
          Length = 572

 Score =  297 bits (761), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 194/584 (33%), Positives = 310/584 (53%), Gaps = 22/584 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  L+  HD + + N  +    +SL FK  +E  L       + +    A+ +YE + 
Sbjct: 4   WDLSALF--HDKEALQNFTQDQIQQSLNFKKNYENKLYTL----DANEFLQALKDYENLN 57

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           + +G+I +YA L +  N  + +   FY     +    E+ L+FF LE   L     E+S 
Sbjct: 58  QALGKIMTYAYLLFAKNTQNGS---FYAQYEEECKKIEENLLFFELEFCELAP---EKSQ 111

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
                   Y  ++ N+ + K++ LS + E ++   S  G  A  R F E++ +L+     
Sbjct: 112 EFTTFCKDYDFYLSNLLQNKRYNLSKNEERIMLYLSNTGANAFSRLFDESMSALKIPFEG 171

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           +K+   +     +D DR++RK AAK  S    K+S + SFI N +  + +     R YE 
Sbjct: 172 KKLSEEEILSKMYDEDRKIRKKAAKKFSKVLQKNSRLLSFIINMIKTERKNISLLRGYEN 231

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
              SRH+SN +    +++L+ S + ++   S ++Y+ KK+ L  + +  +DR AP+   +
Sbjct: 232 AEISRHISNQISQKSVDSLIASAQKHFNLVS-QFYKRKKQILGYE-LKDYDRYAPIGKEA 289

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
                F+ ++++VL+++  FSPQ   IA+  F   WID    + K  GAF+H      HP
Sbjct: 290 S--FDFKTSKNIVLEAFQAFSPQFYDIAKNAFDQGWIDVYPQENKQGGAFSHSATSDAHP 347

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           ++LLNY  K +D+ TLAHELGH IH  LS      L  N+ LT AETAS+F E L FD  
Sbjct: 348 FVLLNYTNKRRDLFTLAHELGHTIHQKLSYHV-SYLNQNTPLTTAETASVFAEMLVFD-F 405

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
           ++    KEE   L ANKIED+  +  RQI+F  FE +LH +     ++ T  I++IW+E 
Sbjct: 406 IKDKLKKEELLSLYANKIEDIFATFYRQINFTCFERRLHAQE---NELSTEEIDKIWMEE 462

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
            ++    +  L+   Y S+W  +PHFI S FY YAYA+   LV +LY +YKS   + FKE
Sbjct: 463 SQKMFQDSVKLTK-NYASWWSYIPHFIHSPFYCYAYAYAQLLVLALYGLYKSKKCENFKE 521

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
            Y+ +L  G S    EL+     ++ D NFWE G++ ++K+I++
Sbjct: 522 LYIKMLSLGGSVSPKELVAMFGFDIEDENFWEIGIKEIQKLINE 565


>gi|224437683|ref|ZP_03658630.1| oligoendopeptidase PepF [Helicobacter cinaedi CCUG 18818]
 gi|313144130|ref|ZP_07806323.1| oligoendopeptidase PepF [Helicobacter cinaedi CCUG 18818]
 gi|313129161|gb|EFR46778.1| oligoendopeptidase PepF [Helicobacter cinaedi CCUG 18818]
          Length = 612

 Score =  295 bits (755), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 198/616 (32%), Positives = 307/616 (49%), Gaps = 49/616 (7%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L+ L+ S +  ++   M  ++  +  F   +EG L+   +Q  C    A I EYE I 
Sbjct: 7   WDLKALFRSEE--QLERFMSSLKRNARQFAKAYEGKLSEIKSQDFC----AVIREYEEIL 60

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           E IGR+ +Y  L +  + +   +   Y     +      +++FF LE   L +   ++  
Sbjct: 61  EGIGRVMTYVFLGFAKDSTQGDV---YAKYEMQTTQIHNLVLFFELEFCKLSQNQQKECI 117

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFK--- 215
              P   +Y+ +++ + +  +  LS   E +L  TS VG  A  R F E++  L FK   
Sbjct: 118 ESSP---QYAYFLQKLIEQDEFSLSLKEEKVLLVTSPVGVGAFSRLFDEHLSHLSFKNPV 174

Query: 216 ----INDQKIPLTKAYKS-----------------FFDSDREVRKSAAKALSHTFNKSSH 254
                ND K PL K  K                       R VRK A K  +    KS H
Sbjct: 175 SNLKAND-KSPLQKKIKKSKASLKTTISEEEILSLLHHCKRNVRKEAQKIFTKKLKKSRH 233

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
           + S+I N + KD  I    R Y+     RHLSN      ++ L+  V ++Y      YY 
Sbjct: 234 LLSYILNMVRKDLSIMQSLRGYKLPESFRHLSNAATQKSVDKLVDVVSSHYGLVG-EYYT 292

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           +K K L +  +  +DR APL  +SQ  + +  A  LVL+++  FS +   IA K     W
Sbjct: 293 IKAKLLGIKQLKDYDRYAPLE-SSQSEVGYNDALKLVLKAFGDFSKEFKDIATKALKKGW 351

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D+     K  GAF+HG++P+ HPY+LLNY    +DV T+AHE GH IH  L S+TQG L
Sbjct: 352 VDSHPTPNKRGGAFSHGSVPTAHPYVLLNYTNSRRDVFTIAHEFGHMIHQEL-SKTQGYL 410

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
             ++ LT AETAS+F E L FD+ L+ + SK+E   L A K+ED+ +++ RQI+   FE 
Sbjct: 411 NMDTPLTTAETASVFAEMLLFDT-LKKSLSKDELIPLYAGKLEDIFSTLFRQITMTHFER 469

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
           ++H    ++ ++     + IW E  +   G +  L+   Y S+W  +PHF+ S FY YAY
Sbjct: 470 RIHA---TSDELKPEDFDRIWREENERMFGDSLILTK-NYESWWCYIPHFVHSPFYCYAY 525

Query: 555 AFGNCLVNSLYDIYKSNTV----DCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWE 610
           ++G  LV +L+ +YK+       + F +KY   L  G SK   EL+     NL    FW 
Sbjct: 526 SYGQLLVLALFGLYKAQKTPRNREKFIQKYTEFLSLGGSKSPKELISAFGFNLESDKFWL 585

Query: 611 RGLQTVEKMIDDVEKM 626
            G+  V+KM+ + +++
Sbjct: 586 IGMNEVQKMLMEFKEL 601


>gi|15645098|ref|NP_207268.1| oligoendopeptidase F (pepF) [Helicobacter pylori 26695]
 gi|2313574|gb|AAD07532.1| oligoendopeptidase F (pepF) [Helicobacter pylori 26695]
          Length = 578

 Score =  295 bits (754), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 188/590 (31%), Positives = 305/590 (51%), Gaps = 25/590 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG--AAIAEYER 96
           W+L  L+ + +S E    ++ ++ E+  F++ ++ NL      KN  + G   A+  YE 
Sbjct: 6   WDLSALFENKESAE--EFLKTLQTEAQEFESAYQNNL------KNLDATGFANALKHYEN 57

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQ 156
           + E I R+ +YA L +  N       KFY+      A+ ++ L+FF +E   LD    ++
Sbjct: 58  LSEKISRVMAYAQLLFAKNTKEA---KFYSQCEMACANIQQHLLFFEIEFKNLDA---KK 111

Query: 157 SYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI 216
             A       ++ ++ N+ + KKH L+ D E +    S VG  A  R F E+  SL+   
Sbjct: 112 QLAFIKKCKDHAFYLNNLIERKKHTLNLDEEKIALALSPVGVGAFSRLFDEHFSSLKIPF 171

Query: 217 NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKY 276
            +Q +   +      +  R++RK + KA S    KS  + ++I N + KD  I+ R RKY
Sbjct: 172 EEQNLSEEEILALLHNPKRKIRKKSQKAFSKALEKSRPLLTYILNMVRKDLLIETRLRKY 231

Query: 277 EKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPG 336
           +K    RH+ N +    ++++++ V   +    HRYY  K + L    +  +DR APL  
Sbjct: 232 DKKESFRHIDNQISQESVDSMIEIVNANFS-LVHRYYHQKAQILG-HKLKDYDRYAPLND 289

Query: 337 TSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSV 396
            S   + +  A + VL++   FSP+   IA K     W+D+   D K  GAF+HG +PS 
Sbjct: 290 ES-ITMTYSQALEEVLKTLKAFSPEFHKIASKAIKEGWVDSHPKDFKQGGAFSHGGVPSA 348

Query: 397 HPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFD 456
           HPY+LLNY G  +D  T+AHE GH IH  LS + QG+L  ++ LT AETAS+F E L F+
Sbjct: 349 HPYVLLNYTGNRRDAFTIAHEFGHMIHQELSKK-QGVLNMDTPLTTAETASVFSEMLFFE 407

Query: 457 SLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWL 516
            L +   S +E   +LA K+ED+ +++ RQ+   +FE ++H       ++ T   + IW 
Sbjct: 408 HLKKGLKS-DELLFMLAGKLEDIFSTLFRQVVMTNFERRIH---EMDEELDTKDFDRIWF 463

Query: 517 ETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCF 576
           E  +     +  L+   Y  +W  +PHFI S FY YAY++G  L  +LY +YK +    F
Sbjct: 464 EENQRMFEKSVKLTK-NYHLWWSYIPHFIHSPFYCYAYSYGQLLTLALYGLYKKSDAKEF 522

Query: 577 KEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + Y   L  G SK   EL+     ++    FWE G+Q V  ++++ E++
Sbjct: 523 VKTYTEFLSLGGSKSPKELVSMFGFDIDSKEFWEIGMQEVRHLLEEFERL 572


>gi|317009092|gb|ADU79672.1| oligoendopeptidase F [Helicobacter pylori India7]
          Length = 578

 Score =  293 bits (749), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 186/590 (31%), Positives = 305/590 (51%), Gaps = 25/590 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG--AAIAEYER 96
           W+L  L+ + +S E    ++ ++ E   F++ ++ NL      KN  + G   A+  YE 
Sbjct: 6   WDLSTLFENKESAE--EFLKTLQTEVQGFESTYQNNL------KNLDATGFANALKRYEN 57

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQ 156
           + E I R  +YA L +  N       KFY+      A+ ++ L+FF +E   LD    ++
Sbjct: 58  LSEKISRAMTYAQLLFAKNTKEA---KFYSQCEMACANIQQHLLFFEIEFKNLDA---KK 111

Query: 157 SYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI 216
             A       ++ ++ N+ + KKH L+ D E +    S VG  A  R F E+  SL+   
Sbjct: 112 QLAFIKKCKDHAFYLNNLIEKKKHTLNLDEEKIALALSPVGVGAFSRLFDEHFSSLKIPF 171

Query: 217 NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKY 276
            +Q +   +      +  R++RK + KA S +  KS  + ++I N + KD  I+ R RKY
Sbjct: 172 EEQNLSEEEILALLHNPKRKIRKKSQKAFSKSLEKSRPLLTYILNMVRKDLLIETRLRKY 231

Query: 277 EKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPG 336
           +K    RH+ N +    ++++++ V   +    HRYY  K + L    +  +DR APL  
Sbjct: 232 DKKESFRHIDNQISQESVDSMIEIVNANFS-LVHRYYHQKAQILG-HKLKDYDRYAPLSD 289

Query: 337 TSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSV 396
            +   + +  A + VL++   FSP+   IA K     W+D+   D K  GAF+HG +PS 
Sbjct: 290 ENT-TMTYSQALEEVLKTLKAFSPEFHKIASKAIKEGWVDSHPKDFKQGGAFSHGGVPSA 348

Query: 397 HPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFD 456
           HPY+LLNY G  +D  T+AHE GH IH  LS + QG+L  ++ LT AETAS+F E L F+
Sbjct: 349 HPYVLLNYTGNRRDAFTIAHEFGHMIHQELSKK-QGVLNMDTPLTTAETASVFSEMLFFE 407

Query: 457 SLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWL 516
             L+    ++E   +LA K+ED+ +++ RQ+   +FE ++H       ++ T   + IW 
Sbjct: 408 H-LKKGLKQDELLFMLAGKLEDIFSTLFRQVVMTNFERRIH---EMDEELDTKDFDRIWF 463

Query: 517 ETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCF 576
           E  +     +  L+   Y  +W  +PHFI S FY YAY++G  L  +LY +YK +    F
Sbjct: 464 EENQRMFEKSVKLTK-NYHLWWSYIPHFIHSPFYCYAYSYGQLLTLALYGLYKKSDAKEF 522

Query: 577 KEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + Y   L  G SK   EL+   + ++    FWE G+Q V  ++++ E++
Sbjct: 523 VKTYTEFLSLGGSKSPKELVSMFDFDIDSKEFWEIGMQEVRHLLEEFERL 572


>gi|217031679|ref|ZP_03437184.1| hypothetical protein HPB128_21g237 [Helicobacter pylori B128]
 gi|298736608|ref|YP_003729134.1| oligoendopeptidase F [Helicobacter pylori B8]
 gi|216946879|gb|EEC25475.1| hypothetical protein HPB128_21g237 [Helicobacter pylori B128]
 gi|298355798|emb|CBI66670.1| oligoendopeptidase F [Helicobacter pylori B8]
          Length = 578

 Score =  292 bits (748), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 186/590 (31%), Positives = 304/590 (51%), Gaps = 25/590 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG--AAIAEYER 96
           W+L  L+ + +S E    ++ ++ E+  F++ ++ NL      KN  + G   A+  YE 
Sbjct: 6   WDLSALFENKESAE--EFLKTLQTEAQEFESTYQNNL------KNLDATGFANALKHYEN 57

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQ 156
           + E I R+ +YA L +  N       KFY+      A+ ++ L+FF +E   LD    ++
Sbjct: 58  LSEKISRVMAYAQLLFAKNTKEA---KFYSQCEMACANIQQHLLFFEIEFKNLDA---KK 111

Query: 157 SYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI 216
             A       ++ ++ N+ + KKH L+ D E +    S VG  A  R F E+  SL+   
Sbjct: 112 QLAFIKKCKNHAFYLNNLIERKKHTLNLDEEKIALALSPVGVGAFSRLFDEHFSSLKIPF 171

Query: 217 NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKY 276
            +Q +   +      +  R++RK + KA S    KS  + ++I N + KD  I+ R RKY
Sbjct: 172 EEQNLSEEEILALLHNPKRKIRKKSQKAFSKALEKSRPLLTYILNMVRKDLLIETRLRKY 231

Query: 277 EKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPG 336
           +K    RH+ N +    ++++++ V   +    HRYY  K + L    +  +DR APL  
Sbjct: 232 DKKESFRHIDNQISQESVDSMIEIVNANFS-LVHRYYHQKAQILG-HKLKDYDRYAPLSD 289

Query: 337 TSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSV 396
            +   + +  A + VL +   FSP+   IA K     W+D+   D K  GAF+HG +PS 
Sbjct: 290 EN-TTMTYSQALEEVLNTLKAFSPEFYKIASKAIKEGWVDSHPKDFKQGGAFSHGGVPSA 348

Query: 397 HPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFD 456
           HPY+LLNY G  +D  T+AHE GH IH  LS + QG+L  ++ LT AETAS+F E L F+
Sbjct: 349 HPYVLLNYTGNRRDAFTIAHEFGHMIHQELSKK-QGVLNMDTPLTTAETASVFSEMLFFE 407

Query: 457 SLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWL 516
             L+    ++E   +LA K+ED+ +++ RQ+   +FE ++H       ++ T   + IW 
Sbjct: 408 H-LKKGLKQDELLFMLAGKLEDIFSTLFRQVVMTNFERRIH---EIDEELDTKDFDRIWF 463

Query: 517 ETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCF 576
           E  +     +  L+   Y  +W  +PHFI S FY YAY++G  L  +LY +YK +    F
Sbjct: 464 EENQRMFEKSVKLTK-NYHLWWSYIPHFIHSPFYCYAYSYGQLLTLALYGLYKKSDAKEF 522

Query: 577 KEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + Y   L  G SK   EL+     ++    FWE G+Q V  ++++ E++
Sbjct: 523 VKTYTEFLSLGGSKSPKELVSMFGFDIDSKEFWEIGMQEVRHLLEEFERL 572


>gi|208434392|ref|YP_002266058.1| oligoendopeptidase F [Helicobacter pylori G27]
 gi|208432321|gb|ACI27192.1| oligoendopeptidase F [Helicobacter pylori G27]
          Length = 578

 Score =  292 bits (748), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 186/590 (31%), Positives = 304/590 (51%), Gaps = 25/590 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG--AAIAEYER 96
           W+L  L+ + +S E    ++ ++ E+  F+  ++ NL      KN  + G   A+  YE 
Sbjct: 6   WDLSALFENKESAE--EFLKTLQTEAQEFENAYQNNL------KNLDATGFANALKHYEN 57

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQ 156
           + E I R+ +YA L +  N       KFY+      A+ ++ L+FF +E   LD    ++
Sbjct: 58  LSEKISRVMTYAQLLFAKNTKEA---KFYSQCEMACANIQQHLLFFEIEFKNLDA---KK 111

Query: 157 SYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI 216
             A       ++ ++ N+ + KKH L+ D E +    S VG  A  R F E+  SL+   
Sbjct: 112 QLAFIKKCKDHAFYLNNLIEKKKHTLNLDEEKIALALSPVGVGAFSRLFDEHFSSLKIPF 171

Query: 217 NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKY 276
            +Q +   +      +  R++RK + KA S    KS  + ++I N + KD  I+ + RKY
Sbjct: 172 QEQNLSEEEILALLHNPKRKIRKKSQKAFSKALEKSRPLLTYILNMVRKDLLIETKLRKY 231

Query: 277 EKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPG 336
           +K    RH+ N +    ++++++ V   +    HRYY  K + L    +  +DR APL  
Sbjct: 232 DKKESFRHIDNQISQESVDSMIEIVNANFS-LVHRYYHQKAQILG-HKLKDYDRYAPLND 289

Query: 337 TSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSV 396
            S   + +  A + VL++   FSP+   IA K     W+D+   D K  GAF+HG +PS 
Sbjct: 290 ES-ITMTYSQALEEVLKTLKAFSPEFHKIASKAIKEGWVDSHPKDFKQGGAFSHGGVPSA 348

Query: 397 HPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFD 456
           HPY+LLNY G  +D  T+AHE GH IH  LS + QG+L  ++ LT AETAS+F E L F+
Sbjct: 349 HPYVLLNYTGNRRDAFTIAHEFGHMIHQELSKK-QGVLNMDTPLTTAETASVFSEMLFFE 407

Query: 457 SLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWL 516
             L+    ++E   +LA K+ED+ +++ RQ+   +FE ++H       ++ T   + IW 
Sbjct: 408 H-LKKGLKQDELLFMLAGKLEDIFSTLFRQVVMTNFERRIH---EMDEELDTKDFDRIWF 463

Query: 517 ETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCF 576
           E  +     +  L+   Y  +W  +PHFI S FY YAY++G  L  +LY +YK +    F
Sbjct: 464 EENQRMFEKSVKLTK-NYHLWWSYIPHFIHSPFYCYAYSYGQLLTLALYGLYKKSDAKEF 522

Query: 577 KEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + Y   L  G SK   EL+     ++    FWE G+Q V  ++++ E++
Sbjct: 523 VKTYTEFLSLGGSKSPKELVSMFGFDIDSKEFWEIGMQEVRHLLEEFERL 572


>gi|315586438|gb|ADU40819.1| oligoendopeptidase F [Helicobacter pylori 35A]
          Length = 578

 Score =  291 bits (746), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 186/590 (31%), Positives = 303/590 (51%), Gaps = 25/590 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG--AAIAEYER 96
           W+L  L+ + +S E    ++ ++ E+  F++ ++ NL      KN  + G   A+  YE 
Sbjct: 6   WDLSALFENKESTE--EFLKTLQTEAQEFESAYQNNL------KNLDATGFANALKHYED 57

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQ 156
           + E I R+ +YA L +  N       KFY+       + ++ L+FF +E   LD    ++
Sbjct: 58  LSEKISRVMTYAQLLFAKNTKEA---KFYSQCEMACTNIQQHLLFFEIEFKNLDS---KK 111

Query: 157 SYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI 216
             A       ++ ++ N+ + KKH L+ D E +    S VG  A  R F E+  SL+   
Sbjct: 112 QLAFIKKCKNHAFYLNNLIERKKHTLNLDEEKIALALSPVGVGAFSRLFDEHFSSLKIPF 171

Query: 217 NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKY 276
            +Q +   +      +  R++RK + KA S    KS  + ++I N + KD  I+ R RKY
Sbjct: 172 EEQNLSEEEILALLHNPKRKIRKKSQKAFSKALEKSRPLLTYILNMVRKDLLIETRLRKY 231

Query: 277 EKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPG 336
           +K    RH+ N +    ++++++ V   +    HRYY  K + L    +  +DR APL  
Sbjct: 232 DKKESFRHIDNQISQESVDSMLEIVNANFS-LVHRYYHQKAQILG-HKLKDYDRYAPLSD 289

Query: 337 TSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSV 396
            +   + +  A + VL +   FSP+   IA K     W+D+   D K  GAF+HG +PS 
Sbjct: 290 ENT-TMTYSQALEEVLNTLKAFSPEFHKIASKAIKEGWVDSHPKDFKQGGAFSHGGVPST 348

Query: 397 HPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFD 456
           HPY+LLNY G  +D  T+AHE GH IH  LS + QG+L  ++ LT AETAS+F E L F+
Sbjct: 349 HPYVLLNYTGNRRDAFTIAHEFGHMIHQELSKK-QGVLNMDTPLTTAETASVFSEMLFFE 407

Query: 457 SLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWL 516
            L +   S +E   +LA K+ED+ +++ RQ+   +FE ++H       ++ T   + IW 
Sbjct: 408 HLKKGLKS-DELLFMLAGKLEDIFSTLFRQVVMTNFERRVH---EIDEELDTKDFDRIWF 463

Query: 517 ETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCF 576
           E  +     +  L+   Y  +W  +PHFI S FY YAY++G  L  +LY +YK +    F
Sbjct: 464 EENQRMFEKSVKLTK-NYHLWWSYIPHFIHSPFYCYAYSYGQLLTLALYGLYKKSDAKEF 522

Query: 577 KEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + Y   L  G SK   EL+     ++    FWE G+Q V  ++++ E++
Sbjct: 523 VKTYTEFLSLGGSKSPKELVSMFGFDIDSKEFWEIGMQEVRHLLEEFERL 572


>gi|317179161|dbj|BAJ56949.1| oligoendopeptidase F [Helicobacter pylori F30]
          Length = 578

 Score =  291 bits (746), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 186/590 (31%), Positives = 303/590 (51%), Gaps = 25/590 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG--AAIAEYER 96
           W+L  L+ + +S E    ++ ++ E+  F++ ++ NL      KN  + G   A+  YE 
Sbjct: 6   WDLSALFENKESAE--EFLKTLQTEAQEFESAYQNNL------KNLDAAGFANALKHYED 57

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQ 156
           + E I R+ +YA L +  N       KFY+       + ++ L+FF +E   LD    ++
Sbjct: 58  LSEKISRVMTYAQLLFAKNTKEA---KFYSQCEMACTNIQQHLLFFEIEFKNLDA---KK 111

Query: 157 SYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI 216
             A       ++ ++ N+ + KKH L+ D E +    S VG  A  R F E+  SL+   
Sbjct: 112 QLAFIKKCKNHAFYLNNLIEKKKHTLNLDEEKIALALSPVGVGAFSRLFDEHFSSLKIPF 171

Query: 217 NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKY 276
            +Q +   +      +  R++RK + KA S    KS  + ++I N + KD  I+ R RKY
Sbjct: 172 EEQNLSEEEILALLHNPKRKIRKKSQKAFSKALEKSRPLLTYILNMVRKDLLIETRLRKY 231

Query: 277 EKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPG 336
           +K    RH+ N +    ++++++ V   +    HRYY  K + L    +  +DR APL  
Sbjct: 232 DKKESFRHIDNQISQESVDSMIEIVNANFS-LVHRYYHQKAQILG-HKLKDYDRYAPLSD 289

Query: 337 TSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSV 396
            +   + +  A + VL +   FSP+   IA K     W+D+   D K  GAF+HG +PS 
Sbjct: 290 ENT-TMTYSQALEEVLNTLKAFSPEFHKIASKAIKEGWVDSHPKDFKQGGAFSHGGVPSA 348

Query: 397 HPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFD 456
           HPY+LLNY G  +D  T+AHE GH IH  LS + QG+L  ++ LT AETAS+F E L F+
Sbjct: 349 HPYVLLNYTGNRRDAFTIAHEFGHMIHQELSKK-QGVLNMDTPLTTAETASVFSEMLFFE 407

Query: 457 SLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWL 516
            L +   S +E   +LA K+ED+ +++ RQ+   +FE ++H       ++ T   + IW 
Sbjct: 408 HLKKGLKS-DELLFMLAGKLEDIFSTLFRQVVMTNFERRIH---EIDEELDTKDFDRIWF 463

Query: 517 ETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCF 576
           E  +     +  L+   Y  +W  +PHFI S FY YAY++G  L  +LY +YK +    F
Sbjct: 464 EENQRMFEKSVKLTK-NYHLWWSYIPHFIHSPFYCYAYSYGQLLTLALYGLYKKSDAKEF 522

Query: 577 KEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + Y   L  G SK   EL+     ++    FWE G+Q V  ++++ E++
Sbjct: 523 VKTYTEFLSLGGSKSPKELVSMFGFDIDSKEFWEIGMQEVRHLLEEFERL 572


>gi|322379502|ref|ZP_08053867.1| oligoendopeptidase F (pepF) [Helicobacter suis HS1]
 gi|322380302|ref|ZP_08054518.1| oligoendopeptidase F PepF [Helicobacter suis HS5]
 gi|321147285|gb|EFX41969.1| oligoendopeptidase F PepF [Helicobacter suis HS5]
 gi|321148057|gb|EFX42592.1| oligoendopeptidase F (pepF) [Helicobacter suis HS1]
          Length = 597

 Score =  291 bits (746), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 184/593 (31%), Positives = 301/593 (50%), Gaps = 22/593 (3%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           +W+L  L+ + ++  +   +   + +  AF+ +  G+ A    Q    +    + EYE +
Sbjct: 15  QWDLSALFANQEA--LDQHVSEWDQKVKAFEEKHAGSFA----QVEPEAFEKILEEYEVL 68

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQS 157
            E + R  SY  L +  +     +   Y+      AD  + L+F   E   L+ A  E  
Sbjct: 69  SEGVSRAMSYVFLIFCVDSKRSDL---YSKYQLLCADMGQHLLFVENEFCILESAKQEAI 125

Query: 158 YAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIN 217
               P   KY+ +++ + + K H+LS   E +L  TS VG EA    F + I SL+    
Sbjct: 126 IKSSP---KYAYYLRLLLRQKPHMLSLPEEKVLLATSGVGVEAFSNLFDQVITSLKMPFQ 182

Query: 218 DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYE 277
           ++ I   +      + DR++RK A K L+ T  K+  + +++ N + KD  I  + R YE
Sbjct: 183 NKMISEEEILSELHNPDRKLRKLAQKTLTKTLKKNRLVLTYVLNMVRKDSHIDTKLRHYE 242

Query: 278 KIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGT 337
           K    RHLSN +    ++++++ V+  YP   HRYY+ K K L    +  +DR AP+   
Sbjct: 243 KPESFRHLSNQIPQESVDSMLEIVEENYPLV-HRYYKSKAKLLGYK-LKDYDRYAPIE-Q 299

Query: 338 SQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVH 397
            +  + ++ A DLVL++Y  FSP+   I  +     W+D+    GK  GAF+  T+PS H
Sbjct: 300 KEAPLSYQDALDLVLKAYQNFSPKFYEIVSRGIKEGWVDSHPRPGKRGGAFSDSTVPSAH 359

Query: 398 PYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDS 457
            ++LLN+ G  +   T+AHE GH IH  LS +  G L  N+ LT +ETAS+FGE L F+S
Sbjct: 360 SFVLLNFTGNRRSAFTIAHEFGHMIHQTLSKQV-GYLNTNTPLTTSETASVFGEMLLFES 418

Query: 458 LLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLE 517
           L +    KE R I  A K+EDM +++ RQ+   +FE ++H+      ++     + IW E
Sbjct: 419 LKKDLDKKELRGI-YAGKLEDMFSTMFRQVVMTNFERRIHSSGGEFEELTAKDFDRIWQE 477

Query: 518 TQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDC-- 575
              +  G +  LS   Y  +W  +PHFI S FY Y+Y++G  LV +L+ +Y+        
Sbjct: 478 ENAKMFGKSVKLSK-NYARWWSYIPHFIHSPFYCYSYSYGQLLVLALFGLYRKKKTTAEK 536

Query: 576 --FKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
             F + Y   L  G S    EL+     +++D  FW+ G+  VEKM+++ E +
Sbjct: 537 QEFVDTYTTFLSKGGSVSPEELVGMFGFDITDKEFWKIGMGEVEKMLEEFEGL 589


>gi|217033256|ref|ZP_03438687.1| hypothetical protein HP9810_9g9 [Helicobacter pylori 98-10]
 gi|216944197|gb|EEC23622.1| hypothetical protein HP9810_9g9 [Helicobacter pylori 98-10]
          Length = 578

 Score =  291 bits (745), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 186/590 (31%), Positives = 303/590 (51%), Gaps = 25/590 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG--AAIAEYER 96
           W+L  L+ + +S E    ++ ++ E+  F++ ++ NL      KN  + G   A+  YE 
Sbjct: 6   WDLSALFENKESAE--EFLKTLQTEAQEFESAYQNNL------KNLDAAGFANALKHYED 57

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQ 156
           + E I R+ +YA L +  N       KFY+       + ++ L+FF +E   LD    ++
Sbjct: 58  LSEKISRVMTYAQLLFAKNTKEA---KFYSQCEMACTNIQQHLLFFEIEFKNLDS---KK 111

Query: 157 SYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI 216
             A       ++ ++ N+ + KKH L+ D E +    S VG  A  R F E+  SL+   
Sbjct: 112 QLAFIKKCKNHAFYLNNLIERKKHTLNLDEEKIALALSPVGVGAFSRLFDEHFSSLKIPF 171

Query: 217 NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKY 276
            +Q +   +      +  R++RK + KA S    KS  + ++I N + KD  I+ R RKY
Sbjct: 172 EEQNLSEEEILALLHNPKRKIRKKSQKAFSKALEKSRPLLTYILNMVRKDLLIETRLRKY 231

Query: 277 EKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPG 336
           +K    RH+ N +    ++++++ V   +    HRYY  K + L    +  +DR APL  
Sbjct: 232 DKKESFRHIDNQISQESVDSMIEIVNANFS-LVHRYYHQKAQILG-HKLKDYDRYAPLSD 289

Query: 337 TSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSV 396
            +   + +  A + VL +   FSP+   IA K     W+D+   D K  GAF+HG +PS 
Sbjct: 290 ENT-TMTYSQALEEVLNTLKAFSPEFYKIASKAIKEGWVDSHPKDFKQGGAFSHGGVPSA 348

Query: 397 HPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFD 456
           HPY+LLNY G  +D  T+AHE GH IH  LS + QG+L  ++ LT AETAS+F E L F+
Sbjct: 349 HPYVLLNYTGNRRDAFTIAHEFGHMIHQELSKK-QGVLNMDTPLTTAETASVFSEMLFFE 407

Query: 457 SLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWL 516
            L +   S +E   +LA K+ED+ +++ RQ+   +FE ++H       ++ T   + IW 
Sbjct: 408 HLKKGLKS-DELLFMLAGKLEDIFSTLFRQVVMTNFERRIH---EIDEELDTKDFDRIWF 463

Query: 517 ETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCF 576
           E  +     +  L+   Y  +W  +PHFI S FY YAY++G  L  +LY +YK +    F
Sbjct: 464 EENQRMFEKSVKLTK-NYHLWWSYIPHFIHSPFYCYAYSYGQLLTLALYGLYKKSDAKEF 522

Query: 577 KEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + Y   L  G SK   EL+     ++    FWE G+Q V  ++++ E++
Sbjct: 523 VKTYTEFLSLGGSKSPKELVSMFGFDIDSKEFWEIGMQEVRHLLEEFERL 572


>gi|317012287|gb|ADU82895.1| oligoendopeptidase F [Helicobacter pylori Lithuania75]
          Length = 578

 Score =  291 bits (745), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 187/590 (31%), Positives = 303/590 (51%), Gaps = 25/590 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG--AAIAEYER 96
           W+L  L+ + +  E    ++ ++ E+  F++ ++ NL      KN  + G   A+  YE 
Sbjct: 6   WDLSALFENKECAE--EFLKTLQTEAQEFESAYQNNL------KNLDATGFANALKHYEN 57

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQ 156
           + E I R  +YA L +  N       KFY+      A+ ++ L+FF +E   LD    ++
Sbjct: 58  LSEKISRAMAYAQLLFAKNTKEA---KFYSQCEMACANIQQHLLFFEIEFKNLDA---KK 111

Query: 157 SYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI 216
             A       ++ ++ N+ + KKH L+ D E +    S VG  A  R F E+  SL+   
Sbjct: 112 QLAFIKKCKNHAFYLNNLIERKKHTLNLDEEKIALALSPVGVGAFSRLFDEHFSSLKIPF 171

Query: 217 NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKY 276
            +Q +   +      +  R++RK + KA S    KS  + ++I N + KD  I+ R RKY
Sbjct: 172 EEQNLSEEEILALLHNPKRKIRKKSQKAFSKALEKSRPLLTYILNMVRKDLLIETRLRKY 231

Query: 277 EKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPG 336
           +K    RH+ N +    ++++++ V   +    HRYY  K + L    +  +DR APL  
Sbjct: 232 DKKESFRHIDNQISQESVDSMIEIVNANFS-LVHRYYHQKAQILG-HKLKDYDRYAPLND 289

Query: 337 TSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSV 396
            S   + +  A + VL++   FSP+   IA K     W+D+   D K  GAF+HG +PS 
Sbjct: 290 ES-ITMTYSQALEEVLKTLKAFSPEFHKIASKAIKEGWVDSHPKDFKQGGAFSHGGVPST 348

Query: 397 HPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFD 456
           HPY+LLNY G  +D  T+AHE GH IH  LS + QG+L  ++ LT AETAS+F E L F+
Sbjct: 349 HPYVLLNYTGNRRDAFTIAHEFGHMIHQELSKK-QGVLNMDTPLTTAETASVFSEMLFFE 407

Query: 457 SLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWL 516
            L +   S +E   +LA K+ED+ +++ RQ+   +FE ++H       ++ T   + IW 
Sbjct: 408 HLKKGLKS-DELLFMLAGKLEDIFSTLFRQVVMTNFERRIH---EIDEELDTKDFDRIWF 463

Query: 517 ETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCF 576
           E  +     +  L+   Y  +W  +PHFI S FY YAY++G  L  +LY +YK +    F
Sbjct: 464 EENQRMFEKSVKLTK-NYHLWWSYIPHFIHSPFYCYAYSYGQLLTLALYGLYKKSDAKEF 522

Query: 577 KEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + Y   L  G SK   EL+     ++    FWE G+Q V  ++++ E++
Sbjct: 523 VKTYTEFLSLGGSKSPKELVSMFGFDIDSKEFWEIGMQEVRHLLEEFERL 572


>gi|254779137|ref|YP_003057242.1| Oligoendopeptidase F [Helicobacter pylori B38]
 gi|254001048|emb|CAX28994.1| Oligoendopeptidase F [Helicobacter pylori B38]
          Length = 578

 Score =  291 bits (744), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 185/588 (31%), Positives = 304/588 (51%), Gaps = 21/588 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  L+ + +S E    ++ ++ E+  F++ ++ NL +    K  ++L      YE + 
Sbjct: 6   WDLSALFENKESAE--EFLKTLQTEAQEFESAYQNNLKNLDAAKFANTL----KHYENLS 59

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           E I R  +YA L +  N       KFY+      A+ ++ L+FF +E   LD    ++  
Sbjct: 60  EKISRAMTYAQLLFAKNTKEA---KFYSQCEMACANIQQHLLFFEIEFKNLDA---KKQL 113

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
           A       ++ ++ N+ + KKH L+ D E +    S VG  A  R F E+  SL+    +
Sbjct: 114 AFIKKCKDHAFYLNNLIEKKKHTLNLDEEKIALALSPVGVGAFSRLFDEHFSSLKIPFEE 173

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           Q +   +      +  R++RK + KA S    KS  + ++I N + KD  I+ + RKY+K
Sbjct: 174 QNLSEEEILALLHNPKRKIRKKSQKAFSKALEKSRPLLTYILNMVRKDLLIETKLRKYDK 233

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
               RH+ N +    ++++++ V   +    HRYY  K + L    +  +DR APL   S
Sbjct: 234 KESFRHIDNQISQESVDSMIEIVNANFS-LVHRYYHQKAQILG-HKLKDYDRYAPLNDES 291

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
              + +  A + VL++   FSP+   IA K     W+D+   D K  GAF+HG +PS HP
Sbjct: 292 -ITMTYSQALEEVLKTLKAFSPEFHKIASKAIKEGWVDSHPKDFKQGGAFSHGGVPSAHP 350

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           Y+LLNY G  +D  T+AHE GH IH  LS + QG+L  ++ LT AETAS+F E L F+ L
Sbjct: 351 YVLLNYTGNRRDAFTIAHEFGHMIHQELSKK-QGVLNMDTPLTTAETASVFSEMLFFEHL 409

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
            +   S +E   +LA K+ED+ +++ RQ+   +FE ++H       ++ T   ++IW E 
Sbjct: 410 KKGLKS-DELLFMLAGKLEDIFSTLFRQVVMTNFERRIH---EMDEELDTKDFDQIWFEE 465

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
            +     +  L+   Y  +W  +PHFI S FY YAY++G  L  +LY +YK +    F +
Sbjct: 466 NQRMFEKSVKLTK-NYHLWWSYIPHFIHSPFYCYAYSYGQLLTLALYGLYKKSDAKEFVK 524

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            Y   L  G SK   EL+     ++    FWE G+Q V  ++++ E++
Sbjct: 525 TYTEFLSLGGSKSPKELVSMFGFDIDSKEFWEIGMQEVRHLLEEFERL 572


>gi|210134674|ref|YP_002301113.1| oligoendopeptidase F [Helicobacter pylori P12]
 gi|210132642|gb|ACJ07633.1| oligoendopeptidase F [Helicobacter pylori P12]
          Length = 578

 Score =  290 bits (742), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 183/588 (31%), Positives = 302/588 (51%), Gaps = 21/588 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  L+ + +S E    ++ ++ E+  F+  ++ NL +    K       A+  YE + 
Sbjct: 6   WDLSALFENKESAE--EFLKTLQTEAQEFENAYQNNLKNLDAAK----FANALKHYENLS 59

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           E I R+ +Y  L +  N       KFY+      A+ ++ L+FF +E   LD    ++  
Sbjct: 60  EKISRVMAYTQLLFAKNTKEA---KFYSQCEMACANIQQHLLFFEIEFKNLDA---KKQL 113

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
           A       ++ ++ N+ + KKH L+ D E +    S VG +A  R F E+  SL+    +
Sbjct: 114 AFIKKCKDHAFYLNNLIERKKHTLNLDEEKIALALSPVGVDAFSRLFDEHFSSLKIPFEE 173

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           Q +   +      +  R++RK + KA S    KS  + ++I N + KD  I+ + RKY+K
Sbjct: 174 QNLSEEEILALLHNPKRKIRKKSQKAFSKALEKSRPLLTYILNMVRKDLLIETKLRKYDK 233

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
               RH+ N +    ++++++ V   +    HRYY  K + L    +  +DR APL   S
Sbjct: 234 KESFRHIDNQISQESVDSMIEIVNANFS-LVHRYYHQKAQILG-HKLKDYDRYAPLNDES 291

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
              + +  A + VL++   FSP+   IA K     W+D+   D K  GAF+HG +PS HP
Sbjct: 292 I-TMTYSQALEEVLKTLKAFSPEFHKIASKAIKEGWVDSHPKDFKQGGAFSHGAVPSAHP 350

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           Y+LLNY G  +D  T+AHE GH IH  LS + QG+L  ++ LT AETAS+F E L F+ L
Sbjct: 351 YVLLNYTGNRRDAFTIAHEFGHMIHQELSKK-QGVLNMDTPLTTAETASVFSEMLFFEHL 409

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
            +   S ++   +LA K+ED+ +++ RQ+   +FE ++H       ++ T   + IW E 
Sbjct: 410 KKGLKS-DDLLFMLAGKLEDIFSTLFRQVVMTNFERRIH---EIDEELDTKDFDRIWFEE 465

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
            +     +  L+   Y  +W  +PHFI S FY YAY++G  L  +LY +YK +    F +
Sbjct: 466 NQRMFEKSVKLTK-NYHLWWSYIPHFIHSPFYCYAYSYGQLLTLALYGLYKKSDAKEFVK 524

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            Y   L  G SK   EL+     ++    FWE G+Q V  ++++ E++
Sbjct: 525 TYTEFLSLGGSKSPKELVSMFGFDIDSKEFWEIGMQEVRHLLEEFERL 572


>gi|317177258|dbj|BAJ55047.1| oligoendopeptidase F [Helicobacter pylori F16]
          Length = 578

 Score =  290 bits (742), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 186/590 (31%), Positives = 302/590 (51%), Gaps = 25/590 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG--AAIAEYER 96
           W+L  L+ + +S E    ++ ++ E+  F++ ++ NL      KN  + G   A+  YE 
Sbjct: 6   WDLSALFENKESAE--EFLKTLQTEAQEFESAYQNNL------KNLDATGFANALKHYEY 57

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQ 156
           + E I R+ +YA L +  N       KFY+       + ++ L+FF +E   LD    ++
Sbjct: 58  LSEKISRVMTYAQLLFAKNTKEA---KFYSQCEMACTNIQQHLLFFEIEFKNLDA---KK 111

Query: 157 SYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI 216
             A       ++ ++ N+ + KKH L+ D E +    S VG  A  R F E+  SL+   
Sbjct: 112 QLAFIKKCKNHAFYLNNLIERKKHTLNLDEEKIALALSPVGVGAFSRLFDEHFSSLKIPF 171

Query: 217 NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKY 276
            +Q +   +      +  R++RK + KA S    KS  + ++I N + KD  I+ R RKY
Sbjct: 172 EEQNLSEEEILALLHNPKRKIRKKSQKAFSKALEKSRPLLTYILNMVRKDLLIETRLRKY 231

Query: 277 EKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPG 336
           +K    RH+ N +    ++++++ V   +    HRYY  K + L    +  +DR APL  
Sbjct: 232 DKKESFRHIDNQISQESVDSMIEIVNANFS-LVHRYYHQKAQILG-HKLKDYDRYAPL-S 288

Query: 337 TSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSV 396
                + +  A + VL +   FSP+   IA K     W+D+   D K  GAF+HG +PS 
Sbjct: 289 DEHTTMTYSQALEEVLNTLKAFSPEFHKIASKAIKEGWVDSHPKDFKQGGAFSHGGVPSA 348

Query: 397 HPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFD 456
           HPY+LLNY G  +D  T+AHE GH IH  LS + QG+L  ++ LT AETAS+F E L F+
Sbjct: 349 HPYVLLNYTGNRRDAFTIAHEFGHMIHQELSKK-QGVLNMDTPLTTAETASVFSEMLFFE 407

Query: 457 SLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWL 516
            L +   S +E   +LA K+ED+ +++ RQ+   +FE ++H       ++ T   + IW 
Sbjct: 408 HLKKGLKS-DELLFMLAGKLEDIFSTLFRQVVMTNFERRIH---EIDEELDTKDFDRIWF 463

Query: 517 ETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCF 576
           E  +     +  L+   Y  +W  +PHFI S FY YAY++G  L  +LY +YK +    F
Sbjct: 464 EENQRMFEKSVKLTK-NYHLWWSYIPHFIHSPFYCYAYSYGQLLTLALYGLYKKSDAKEF 522

Query: 577 KEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + Y   L  G SK   EL+     ++    FWE G+Q V  ++++ E++
Sbjct: 523 VKTYTEFLSLGGSKSPKELVSMFGFDIDSKEFWEIGMQEVCHLLEEFERL 572


>gi|255075929|ref|XP_002501639.1| predicted protein [Micromonas sp. RCC299]
 gi|226516903|gb|ACO62897.1| predicted protein [Micromonas sp. RCC299]
          Length = 623

 Score =  290 bits (742), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 196/593 (33%), Positives = 299/593 (50%), Gaps = 34/593 (5%)

Query: 35  NLPRWNLED--LYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           + PRW LE    Y S  S  I  +++ IE +    K  +EG +          SL  AI 
Sbjct: 22  DAPRWALETHFGYDSVYSSSIDAELDAIEQKCKELKANFEGKMGE--------SLLDAIK 73

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFE-KVLIFFALEINTLDE 151
            YE +   + +  SY  LS +  L     +K    +  + +      L FF+LE+  + +
Sbjct: 74  AYEEVDIALTKALSYVSLSCDTKLDDDKAQKRKASLFQRYSTISGNQLTFFSLELADMSQ 133

Query: 152 ALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQ-VGREALKRFFCENIE 210
             LE      P   KY A+I  +R+ + + LS ++E  L+  +   G+  +  F+   + 
Sbjct: 134 ETLETQMENSPELAKYQAYIDEVRRSQPYNLSKEVERALTVRAPFAGKGKVVEFYGNELS 193

Query: 211 SLRFKINDQKIPLTKAYKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEI 269
            LRFK  D+++ +         S D   R    KAL+    +   + +   N +A     
Sbjct: 194 RLRFKDGDEEVNMEVLLAKMTSSKDAATRHECMKALNTGLKEFERVAALSLNMVAGSWHA 253

Query: 270 QDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLK----LDTM 325
           ++  R +E++   R+L NNV   V+++L+ +VK        RYY LKK  LK    L+ M
Sbjct: 254 ENTERGFEQLRSQRNLGNNVPDEVVDSLLDAVKTTGVDYCKRYYALKKGILKNTAGLEKM 313

Query: 326 YFWDRLAPLP-GTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKG 384
            + DR A +  GTS +   +E A D+V   Y KFSP M+ + ++      ID P  +GK 
Sbjct: 314 TWADRNAAINIGTSSESYTWEEAVDIVKAGYEKFSPTMAGLFQQMVDEKRIDVPAQNGKR 373

Query: 385 SGAF-----AHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSS 439
            GA+      HG      P+ LLN+ G  +DV TLAHE GHG HF+LS + QGIL  +  
Sbjct: 374 GGAYCSSSYGHG------PFQLLNFTGTQRDVATLAHESGHGAHFMLSYK-QGILQFHPP 426

Query: 440 LTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTE 499
           LTLAETASIFGE + F  LL+ A + E+R  +L  KI+D++NS+VRQ  F  FE K+H+ 
Sbjct: 427 LTLAETASIFGEMIVFRDLLEKAPTDEDRLAMLMGKIDDIINSVVRQCGFDAFEEKVHS- 485

Query: 500 RRSTGDIPTHRINEIWLETQKESLGPAFDLSD--LEYGSFWMMVPHFIESSFYVYAYAFG 557
            R+ G +    + E W +T  +  G   ++ D   +    W  V HF    FYVY+YAF 
Sbjct: 486 GRAAGTLTPDEMTEAWQQTMVDYYGAEGEVFDSYADTSHLWTYVSHFHNVPFYVYSYAFA 545

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWE 610
           + +V SLY +Y+    + F++K L +L AG  K + E L P  ++ +DP FW+
Sbjct: 546 DLVVGSLYGVYQKQP-EGFEDKLLELLSAGGVKGFREALEPFGLDPADPVFWK 597


>gi|325995733|gb|ADZ51138.1| Oligoendopeptidase F [Helicobacter pylori 2018]
 gi|325997329|gb|ADZ49537.1| Oligoendopeptidase F [Helicobacter pylori 2017]
          Length = 578

 Score =  290 bits (741), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 184/588 (31%), Positives = 302/588 (51%), Gaps = 21/588 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  L+ + +S E    ++ ++ E+  F++ ++ NL      K       A+  YE + 
Sbjct: 6   WDLSALFENKESAE--EFLKTLQTEAQEFESAYQNNLKDLDATK----FADALKHYENLL 59

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           E I R  +YA L +  N       KFY+      A+ ++ L+FF +E   LD    ++  
Sbjct: 60  EKISRAMTYAQLLFAKNTKEA---KFYSQCEMACANIQQHLLFFEIEFKNLDA---KKQL 113

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
           A       ++ ++ N+ + KKH L+ D E +    S VG  A  R F E+  SL+    +
Sbjct: 114 AFIKKCKDHAFYLNNLIEKKKHTLNLDEEKIALALSPVGVGAFSRLFDEHFSSLKIPFEE 173

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           + +   +      +  R++RK + KA S    KS  + ++I N + KD  I+ + RKY+K
Sbjct: 174 KTLSEEEILALLHNPKRKIRKKSQKAFSKALEKSRPLLTYILNMVRKDLLIETKLRKYDK 233

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
               RH+ N +    ++++++ V   +    HRYY  K + L    +  +DR APL   S
Sbjct: 234 KESFRHIDNQISQESVDSMIEIVNANFS-LVHRYYHQKAQILG-HKLKDYDRYAPLNNES 291

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
              + +  A + VL++   FSP+   IA K     W+D+   D K  GAF+HG +PS HP
Sbjct: 292 I-TMTYSQALEEVLKTLKAFSPEFYKIASKAIKEGWVDSHPKDFKQGGAFSHGAVPSAHP 350

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           Y+LLNY G  +D  T+AHE GH IH  LS + QG+L  ++ LT AETAS+F E L F+ L
Sbjct: 351 YVLLNYTGNRRDAFTIAHEFGHMIHQELSKK-QGVLNMDTPLTTAETASVFSEMLFFEHL 409

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
            +   S +E   +LA K+ED+ +++ RQ+   +FE ++H       ++ T   + IW E 
Sbjct: 410 KKGLKS-DELLFMLAGKLEDIFSTLFRQVVMTNFERRIH---EMDEELDTKDFDRIWFEE 465

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
            +     +  L+   Y  +W  +PHFI S FY YAY++G  L  +LY +YK +    F +
Sbjct: 466 NQRMFEKSVKLTK-NYHLWWSYIPHFIHSPFYCYAYSYGQLLTLALYGLYKKSDAKQFVK 524

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            Y   L  G SK   EL+     ++ +  FWE G+Q V  ++++ E++
Sbjct: 525 TYTEFLSLGGSKSPKELVSMFGFDIDNKEFWEIGMQEVRHLLEEFERL 572


>gi|308182617|ref|YP_003926744.1| oligoendopeptidase F [Helicobacter pylori PeCan4]
 gi|308064802|gb|ADO06694.1| oligoendopeptidase F [Helicobacter pylori PeCan4]
          Length = 578

 Score =  290 bits (741), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 183/588 (31%), Positives = 300/588 (51%), Gaps = 21/588 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  L+ + +S E    ++ ++ E+  F++ ++ NL +    K       A+  YE + 
Sbjct: 6   WDLSALFENKESAE--GFLKTLQTEAQEFESAYQNNLKNLDATK----FANALKHYEDLS 59

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           E I ++ +YA L +  N       KFY+       + ++ L+FF +E   LD    ++  
Sbjct: 60  EKISKVMTYAQLLFAKNTKEA---KFYSQCEMACTNIQQHLLFFEIEFKNLDA---KKQL 113

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
           A       ++ ++ N+ + KKH L+ D E +    S VG  A  R F E+  SL+    +
Sbjct: 114 AFIKKCKDHAFYLNNLIERKKHTLNLDEEKIALALSPVGVGAFSRLFDEHFSSLKIPFEE 173

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           Q +   +      +  R++RK + KA S    KS  + ++I N + KD  I+ R RKY+K
Sbjct: 174 QNLSEEEILALLHNPKRKIRKKSQKAFSKALEKSRPLLTYILNMVRKDLLIETRLRKYDK 233

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
               RH+ N +    ++++++ V   +    HRYY  K + L    +  +DR APL    
Sbjct: 234 KESFRHIDNQISQESVDSMIEIVNANFS-LVHRYYHQKAQILG-HKLKDYDRYAPL-SDE 290

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
              + +  A + VL +   FSP+   IA K     W+D+   D K  GAF+HG +PS HP
Sbjct: 291 HTTMTYSQALEEVLNTLKAFSPEFYKIASKAIKEGWVDSHPKDFKQGGAFSHGGVPSAHP 350

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           Y+LLNY G  +D  T+AHE GH IH  LS + QG+L  ++ LT AETAS+F E L F+ L
Sbjct: 351 YVLLNYTGNRRDAFTIAHEFGHMIHQELSKK-QGVLNMDTPLTTAETASVFSEMLFFEHL 409

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
            +   S +E   +LA K+ED+ +++ RQ+   +FE ++H       ++ T   + IW E 
Sbjct: 410 KKGLKS-DELLFMLAGKLEDIFSTLFRQVVMTNFERRIH---EIDEELDTKDFDRIWFEE 465

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
            +     +  L+   Y  +W  +PHFI S FY YAY++G  L  +LY +YK +    F +
Sbjct: 466 NQRMFEKSVKLTK-NYHLWWSYIPHFIHSPFYCYAYSYGQLLTLALYGLYKKSDAKEFVK 524

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            Y   L  G SK   EL+     ++    FWE G+Q V  ++++ E++
Sbjct: 525 TYTEFLSLGGSKSPKELVSMFGFDIDSKEFWEIGMQEVRHLLEEFERL 572


>gi|308063308|gb|ADO05195.1| oligoendopeptidase F [Helicobacter pylori Sat464]
          Length = 578

 Score =  290 bits (741), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 185/590 (31%), Positives = 301/590 (51%), Gaps = 25/590 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG--AAIAEYER 96
           W+L  L+ + +S E    ++ ++ E   F++ ++ NL      KN  + G   A+  YE 
Sbjct: 6   WDLSALFENTESTE--EFLKTLQTEVQEFESTYQNNL------KNLDATGFANALKHYEN 57

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQ 156
           + E I ++ +YA L +  N       KFY+       + ++ L+FF +E   LD    ++
Sbjct: 58  LSEKISKVMTYAQLLFAKNTKEA---KFYSQCEMACTNIQQHLLFFEIEFKNLDA---KK 111

Query: 157 SYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI 216
             A       ++ ++ N+ + KKH L+ D E +    S VG  A  R F E+  SL+   
Sbjct: 112 QLAFIKKCKDHAFYLNNLIERKKHTLNLDEEKIALALSPVGVGAFSRLFDEHFSSLKIPF 171

Query: 217 NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKY 276
            +Q +   +      +  R++RK + KA S    KS  + ++I N + KD  I+ R RKY
Sbjct: 172 EEQNLSEEEILALLHNPKRKIRKKSQKAFSKALEKSRSLLTYILNMVRKDLLIETRLRKY 231

Query: 277 EKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPG 336
           +K    RH+ N +    ++++++ V   +    HRYY  K + L    +  +DR APL  
Sbjct: 232 DKKESFRHIDNQISQESVDSMIEIVNANFS-LVHRYYHQKAQILG-HKLKDYDRYAPL-S 288

Query: 337 TSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSV 396
                + +  A + VL +   FSP+   IA K     W+D+   D K  GAF+HG +PS 
Sbjct: 289 DEHTTMTYSQALEEVLNTLKTFSPEFYKIASKAIKEGWVDSHPKDFKQGGAFSHGGVPSA 348

Query: 397 HPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFD 456
           HPY+LLNY G  +D  T+AHE GH IH  LS + QG+L  ++ LT AETAS+F E L F+
Sbjct: 349 HPYVLLNYTGNRRDAFTIAHEFGHMIHQELSKK-QGVLNMDTPLTTAETASVFSEMLFFE 407

Query: 457 SLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWL 516
            L +   S +E   +LA K+ED+ +++ RQ+   +FE ++H       ++ T   + IW 
Sbjct: 408 HLKKGLKS-DELLFMLAGKLEDIFSTLFRQVVMTNFERRIH---EIDEELDTKDFDRIWF 463

Query: 517 ETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCF 576
           E  +     +  L+   Y  +W  +PHFI S FY YAY++G  L  +LY +YK +    F
Sbjct: 464 EENQRMFEKSVKLTK-NYHLWWSYIPHFIHSPFYCYAYSYGQLLTLALYGLYKKSDAKEF 522

Query: 577 KEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + Y   L  G SK   EL+     ++    FWE G+Q V  ++++ E++
Sbjct: 523 VKTYTEFLSLGGSKSPKELVSMFGFDIDSKEFWEIGMQEVRHLLEEFERL 572


>gi|308184251|ref|YP_003928384.1| oligoendopeptidase F [Helicobacter pylori SJM180]
 gi|308060171|gb|ADO02067.1| oligoendopeptidase F [Helicobacter pylori SJM180]
          Length = 578

 Score =  289 bits (740), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 185/588 (31%), Positives = 302/588 (51%), Gaps = 21/588 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  L+ + +S E    ++ ++ E+  F+  ++ NL +    K  ++L      YE + 
Sbjct: 6   WDLSALFENKESAE--EFLKTLQTEAQEFENAYQNNLKNLDAAKFANTL----KHYENLS 59

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           E I R  +YA L +  N       KFY+      A+ ++ L+FF +E   LD    ++  
Sbjct: 60  EKISRAMTYAQLLFAKNTKEA---KFYSQCEMACANIQQHLLFFEIEFKNLDA---KKQL 113

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
           A       ++ ++ N+ + KKH L+ D E +    S VG  A  R F E+  SL+    +
Sbjct: 114 AFIKKCKDHAFYLNNLIEKKKHTLNLDEEKIALALSPVGVGAFSRLFDEHFSSLKIPFEE 173

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           Q +   +      +  R++RK + KA S    KS  + ++I N + KD  I+ + RKY+K
Sbjct: 174 QNLSEEEILALLHNPKRKIRKKSQKAFSKALEKSRPLLTYILNMVRKDLLIETKLRKYDK 233

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
               RH+ N +    ++++++ V   +    HRYY  K + L    +  +DR APL   S
Sbjct: 234 KESFRHIDNQISQESVDSMIEIVNANFS-LVHRYYHQKAQILG-HKLKDYDRYAPLNDES 291

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
              + +  A + VL++   FSP+   IA K     W+D+   D K  GAF+HG +PS HP
Sbjct: 292 -ITMTYSQALEEVLKTLKAFSPEFHKIASKAIKEGWVDSHPKDFKQGGAFSHGAVPSAHP 350

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           Y+LLNY G  +D  T+AHE GH IH  LS + QG+L  ++ LT AETAS+F E L F+ L
Sbjct: 351 YVLLNYTGNRRDAFTIAHEFGHMIHQELSKK-QGVLNMDTPLTTAETASVFSEMLFFEHL 409

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
            +   S +E   +LA K+ED+ +++ RQ+   +FE ++H       ++ T   + IW E 
Sbjct: 410 KKGLKS-DELLFMLAGKLEDIFSTLFRQVVMTNFERRIH---EIDEELDTKDFDRIWFEE 465

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
            +     +  L+   Y  +W  +PHFI S FY YAY++G  L  +LY +YK +    F +
Sbjct: 466 NQRMFEKSVKLTK-NYHLWWSYIPHFIHSPFYCYAYSYGQLLTLALYGLYKKSDAKEFVK 524

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            Y   L  G SK   EL+     ++    FWE G+Q V  ++++ E++
Sbjct: 525 TYTEFLSLGGSKSPKELVSMFGFDIDSKEFWEIGMQEVRHLLEEFERL 572


>gi|188527254|ref|YP_001909941.1| oligoendopeptidase F (pepF) [Helicobacter pylori Shi470]
 gi|188143494|gb|ACD47911.1| oligoendopeptidase F (pepF) [Helicobacter pylori Shi470]
          Length = 578

 Score =  289 bits (740), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 186/590 (31%), Positives = 301/590 (51%), Gaps = 25/590 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG--AAIAEYER 96
           W+L  L+ + +S E    ++ ++ E   F++ ++ NL      KN  + G   A+  YE 
Sbjct: 6   WDLSALFENTESAE--EFLKTLQTEVQEFESAYQNNL------KNLDATGFANALKHYED 57

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQ 156
           + E I R+ +YA L +  N       KFY+       + ++ L+FF +E   LD    ++
Sbjct: 58  LSEKISRVMTYAQLLFAKNTKEA---KFYSQCEMACTNIQQHLLFFEIEFKNLDA---KK 111

Query: 157 SYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI 216
             A       ++ ++ N+ + KKH L+ D E +    S VG  A  R F E+  SL+   
Sbjct: 112 QLAFIKKCKDHAFYLNNLIERKKHTLNLDEEKIALALSPVGVGAFSRLFDEHFSSLKIPF 171

Query: 217 NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKY 276
            +Q +   +      +  R++RK + KA S    KS  + ++I N + KD  I+ R RKY
Sbjct: 172 EEQNLSEEEILALLHNPKRKIRKKSQKAFSKALEKSRPLLTYILNMVRKDLLIETRLRKY 231

Query: 277 EKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPG 336
           +K    RH+ N +    ++++++ V   +    HRYY  K + L    +  +DR APL  
Sbjct: 232 DKKESFRHIDNQISQESVDSMIEIVNANFS-LVHRYYHQKVQILG-HKLKDYDRYAPL-S 288

Query: 337 TSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSV 396
                + +  A + VL +   FSP+   IA K     W+D+   D K  GAF+HG +PS 
Sbjct: 289 DEHTTMTYSQALEEVLNTLKAFSPEFHKIASKAIKEGWVDSHPKDFKQGGAFSHGGVPSA 348

Query: 397 HPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFD 456
           HPY+LLNY G  +D  T+AHE GH IH  LS + QG+L  ++ LT AETAS+F E L F+
Sbjct: 349 HPYVLLNYTGNRRDAFTIAHEFGHMIHQELSKK-QGVLNMDTPLTTAETASVFSEMLFFE 407

Query: 457 SLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWL 516
            L +   S +E   +LA K+ED+ +++ RQ+   +FE ++H       ++ T   + IW 
Sbjct: 408 HLKKGLKS-DELLFMLAGKLEDIFSTLFRQVVMTNFERRIH---EIDEELDTKDFDRIWF 463

Query: 517 ETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCF 576
           E  +     +  L+   Y  +W  +PHFI S FY YAY++G  L  +LY +YK +    F
Sbjct: 464 EENQRMFEKSVKLTK-NYHLWWSYIPHFIHSPFYCYAYSYGQLLTLALYGLYKKSDAKEF 522

Query: 577 KEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + Y   L  G SK   EL+     ++    FWE G+Q V  ++++ E++
Sbjct: 523 VKTYTEFLSLGGSKSPKELVSMFGFDIDSKEFWEIGMQEVRHLLEEFERL 572


>gi|317180658|dbj|BAJ58444.1| oligoendopeptidase F [Helicobacter pylori F32]
          Length = 578

 Score =  289 bits (739), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 185/590 (31%), Positives = 300/590 (50%), Gaps = 25/590 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG--AAIAEYER 96
           W+L  L+ + +S E    ++ ++ E   F++ ++ NL      KN  + G   A+  YE 
Sbjct: 6   WDLSALFENKESAE--EFLKTLQTEVQEFESAYQNNL------KNLDATGFANALKHYED 57

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQ 156
           + E I R+ +YA L +  N       KFY+       + ++ L+FF +E   LD    ++
Sbjct: 58  LSEKISRVMTYAQLLFAKNTKEA---KFYSQCEMACTNIQQHLLFFEIEFKNLDA---KK 111

Query: 157 SYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI 216
             A       ++ ++ N+ + KKH L+ D E +    S VG  A  R F E+  SL+   
Sbjct: 112 QLAFIKKCKNHAFYLNNLIERKKHTLNLDEEKIALALSPVGVGAFSRLFDEHFSSLKIPF 171

Query: 217 NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKY 276
            +Q +   +      +  R++RK + KA S    KS  + ++I N + KD  I+ + RKY
Sbjct: 172 EEQNLSEEEILALLHNPKRKIRKKSQKAFSKALEKSRPLLTYILNMVRKDLLIETKLRKY 231

Query: 277 EKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPG 336
            K    RH+ N +    ++++++ V   +    HRYY  K + L    +  +DR APL  
Sbjct: 232 NKKESFRHIDNQISQESVDSMIEIVNANFS-LVHRYYHQKAQILG-HKLKDYDRYAPL-S 288

Query: 337 TSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSV 396
                + +  A + VL +   FSP+   IA K     W+D+   D K  GAF+HG +PS 
Sbjct: 289 DEHTTMTYSQALEEVLNTLKAFSPEFHKIASKAIKEGWVDSHPKDFKQGGAFSHGGVPSA 348

Query: 397 HPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFD 456
           HPY+LLNY G  +D  T+AHE GH IH  LS + QG+L  ++ LT AETAS+F E L F+
Sbjct: 349 HPYVLLNYTGNRRDAFTIAHEFGHMIHQELSKK-QGVLNMDTPLTTAETASVFSEMLFFE 407

Query: 457 SLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWL 516
            L +   S +E   +LA K+ED+ +++ RQ+   +FE ++H       ++ T   + IW 
Sbjct: 408 HLKKGLKS-DELLFMLAGKLEDIFSTLFRQVVMTNFERRIH---EIDEELDTKDFDRIWF 463

Query: 517 ETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCF 576
           E  +     +  L+   Y  +W  +PHFI S FY YAY++G  L  +LY +YK +    F
Sbjct: 464 EENQRMFEKSVKLTK-NYHLWWSYIPHFIHSPFYCYAYSYGQLLTLALYGLYKKSDAKEF 522

Query: 577 KEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + Y   L  G SK   EL+     ++    FWE G+Q V  ++++ E++
Sbjct: 523 VKTYTEFLSLGGSKSPKELVSMFGFDIDSKEFWEIGMQEVRHLLEEFERL 572


>gi|307637142|gb|ADN79592.1| oligoendopeptidase F [Helicobacter pylori 908]
          Length = 578

 Score =  288 bits (738), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 185/589 (31%), Positives = 302/589 (51%), Gaps = 23/589 (3%)

Query: 39  WNLEDLYPSHDS-QEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           W+L  L+ + +S +E S  ++    E+  F++ ++ NL      K       A+  YE +
Sbjct: 6   WDLSALFENKESAEEFSKTLQT---EAQEFESAYQNNLKDLDATK----FADALKHYENL 58

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQS 157
            E I R  +YA L +  N       KFY+      A+ ++ L+FF +E   LD    ++ 
Sbjct: 59  LEKISRAMTYAQLLFAKNTKEA---KFYSQCEMACANIQQHLLFFEIEFKNLDA---KKQ 112

Query: 158 YAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIN 217
            A       ++ ++ N+ + KKH L+ D E +    S VG  A  R F E+  SL+    
Sbjct: 113 LAFIKKCKDHAFYLNNLIEKKKHTLNLDEEKIALALSPVGVGAFSRLFDEHFSSLKIPFE 172

Query: 218 DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYE 277
           ++ +   +      +  R++RK + KA S    KS  + ++I N + KD  I+ + RKY+
Sbjct: 173 EKTLSEEEILALLHNPKRKIRKKSQKAFSKALEKSRPLLTYILNMVRKDLLIETKLRKYD 232

Query: 278 KIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGT 337
           K    RH+ N +    ++++++ V   +    HRYY  K + L    +  +DR APL   
Sbjct: 233 KKESFRHIDNQISQESVDSMIEIVNANFS-LVHRYYHQKAQILG-HKLKDYDRYAPLNNE 290

Query: 338 SQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVH 397
           S   + +  A + VL++   FSP+   IA K     W+D+   D K  GAF+HG +PS H
Sbjct: 291 S-ITMTYSQALEEVLKTLKAFSPEFYKIASKAIKEGWVDSHPKDFKQGGAFSHGAVPSAH 349

Query: 398 PYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDS 457
           PY+LLNY G  +D  T+AHE GH IH  LS + QG+L  ++ LT AETAS+F E L F+ 
Sbjct: 350 PYVLLNYTGNRRDAFTIAHEFGHMIHQELSKK-QGVLNMDTPLTTAETASVFSEMLFFEH 408

Query: 458 LLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLE 517
           L +   S +E   +LA K+ED+ +++ RQ+   +FE ++H       ++ T   + IW E
Sbjct: 409 LKKGLKS-DELLFMLAGKLEDIFSTLFRQVVMTNFERRIH---EMDEELDTKDFDRIWFE 464

Query: 518 TQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFK 577
             +     +  L+   Y  +W  +PHFI S FY YAY++G  L  +LY +YK +    F 
Sbjct: 465 ENQRMFEKSVKLTK-NYHLWWSYIPHFIHSPFYCYAYSYGQLLTLALYGLYKKSDAKQFV 523

Query: 578 EKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           + Y   L  G SK   EL+     ++ +  FWE G+Q V  ++++ E++
Sbjct: 524 KTYTEFLSLGGSKSPKELVSMFGFDIDNKEFWEIGMQEVRHLLEEFERL 572


>gi|303270999|ref|XP_003054861.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226462835|gb|EEH60113.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 597

 Score =  288 bits (738), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 201/612 (32%), Positives = 312/612 (50%), Gaps = 37/612 (6%)

Query: 37  PRWNLED--LYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEY 94
           PRW+LE    Y S +S  +  DM+ +E + +A K+ +EG L       +   LGA I  Y
Sbjct: 1   PRWDLEMHFGYDSPNSASVDADMDAVEADCVALKSNFEGKL-------DSKLLGA-IQLY 52

Query: 95  ERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFE-KVLIFFALEINTLDEAL 153
           E+I   + +  SY  L+ +  L     +K    +  + +      L FF+LE+  L +  
Sbjct: 53  EKIDIALTKALSYVSLACDTCLDDDDAQKRKASLMQRYSIISGNNLTFFSLELADLAQED 112

Query: 154 LEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQ-VGREALKRFFCENIESL 212
           L+      P    YSA+I  +R+ + + LS ++E  L+  +   G+  +  F+   +  L
Sbjct: 113 LDAQMESTPELANYSAYIDEVRRSRPYNLSKEVERALTVRAPFAGKGKVVEFYGNELSRL 172

Query: 213 RFKINDQK----------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNT 262
           RF+    K          + L K   S    D + R    + L+        + +   N 
Sbjct: 173 RFEDPTAKEGEPAEVNMEVLLAKMTGS---KDAKTRYQCMQTLNSGLKNFERVAALSLNM 229

Query: 263 LAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLK- 321
           +A    +++  R +E +   R+L NNV   V+++L+ +VK        RYY LKK  LK 
Sbjct: 230 VAGGWHVENAERGFENLRSQRNLGNNVPDEVVDSLLDAVKTTGVAYCKRYYALKKNILKE 289

Query: 322 ---LDTMYFWDRLAPLP-GTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
              LD   + DR A +  GT+ D   +  A D+V + YAKFSP M+ +  +      ID 
Sbjct: 290 TQGLDAFTWADRNAAIDIGTAADEYSWTEAVDIVREGYAKFSPTMADLFTEMVDQKRIDV 349

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
           P  +GK  GA+   +  +  P+ LLN+ G  +DV TLAHE GHG HF+LS + QGIL  +
Sbjct: 350 PAQNGKRGGAYCSSSYGN-GPFQLLNFTGTQRDVATLAHESGHGAHFMLSYK-QGILQFH 407

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
             LTLAETASIFGE + F  LL  AS+ E+R  +L +KI+D++NS+VRQ  F  FE K+H
Sbjct: 408 PPLTLAETASIFGEMIVFRDLLAKASTDEDRLAMLMSKIDDIINSVVRQCGFDAFEDKVH 467

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSD--LEYGSFWMMVPHFIESSFYVYAYA 555
           +  R+ G +    + + W +T  E  G   ++ D   +    W  V HF    FYVY+YA
Sbjct: 468 SA-RAAGALTPDEMTKAWEQTVVEYYGEEGEVFDSYADTSHLWTYVSHFHNVPFYVYSYA 526

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
           F + +V SLY +Y + + D F+EK L++L AG +K + E L P  +  +DP FW   L  
Sbjct: 527 FADLVVGSLYGVY-AKSPDGFEEKLLDLLAAGGTKGFEEALEPFGLKPADPAFWTDALDA 585

Query: 616 -VEKMIDDVEKM 626
            +  ++D+ E +
Sbjct: 586 HLGSLMDEAEAL 597


>gi|237833995|ref|XP_002366295.1| oligoendopeptidase F, putative [Toxoplasma gondii ME49]
 gi|211963959|gb|EEA99154.1| oligoendopeptidase F, putative [Toxoplasma gondii ME49]
          Length = 667

 Score =  288 bits (738), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 191/605 (31%), Positives = 322/605 (53%), Gaps = 25/605 (4%)

Query: 35  NLPRWNLEDLYP--SHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
            LPR+NL+  +P  S     I  D+E +   +  FK R++G L          +L  A+ 
Sbjct: 68  TLPRYNLKRHFPYSSIFDPAIDRDIEALSRRAREFKERFKGTLET--------TLLEALI 119

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA-DFEKVLIFFALEINTLDE 151
           ++E++ E +  +  Y  L    N ++  IRK    + + +A D +   +F  LE+  + E
Sbjct: 120 KHEQLDEAVDFVDYYIALVAAVNTTNEEIRKRVNQLESAIAADVQPYRLFVNLELGAMPE 179

Query: 152 ALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIES 211
           A L++  A +     YS ++   R+   ++LS D+E  L     +  +    ++ + +  
Sbjct: 180 AALQKQMAANGNLSFYSGFLGAARRRAPYVLSEDVERALLVRKPMTVQVATEYYFKQLGD 239

Query: 212 LRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTF--NKSSHIFSFITNTLAKDEEI 269
             F +N +K+ L+       D+ +E R +A KA+      +K ++  +   N +A    +
Sbjct: 240 ATFDMNGEKLILSMILAFIMDNSQEKRWAAQKAVKQGLERHKITNFAALSLNVVAGSWHM 299

Query: 270 QDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLK----LDTM 325
           + + R YE++  SR+++NNV    I+AL+ + +      + RY++LKKK LK    ++  
Sbjct: 300 ERKERGYERLRSSRNVANNVSDKTIDALIHAGETVAVSLTKRYFKLKKKILKNRAGVEVF 359

Query: 326 YFWDRLAPLPGTSQD-IIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKG 384
            F DRLAPLP  S D +  ++ +  +V  +Y  FSP M+++ +K      IDAP   GK 
Sbjct: 360 DFADRLAPLPLKSSDRLYDWKESTRIVRDAYKSFSPTMALMFDKLLEEERIDAPAVPGKR 419

Query: 385 SGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAE 444
           + A   GT P+  P+I+L ++G+P+ V TLAHE GH IH +LS E QG L     LT+AE
Sbjct: 420 TPACYLGT-PTTGPFIILEHVGQPRCVETLAHEAGHAIHSMLSYE-QGNLQLAPPLTIAE 477

Query: 445 TASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTG 504
            AS+ GE + F+ LL+  +  EER   L   ++   +++ RQ+ F DFE ++H + R+ G
Sbjct: 478 MASLMGERIVFNDLLRRTTDPEERLSHLLRYLDGWTSTVTRQLMFDDFERRVH-DARAQG 536

Query: 505 DIPTHRINEIWLETQKESLGPAFDLSDLEYGSF--WMMVPHFIESSFYVYAYAFGNCLVN 562
            IP      +W E+ ++  G   ++ D    S   W  +PHF  + FYVYAYAF +  V 
Sbjct: 537 TIPDGAFTTMWKESLEKYFGAEGEVFDSYANSEADWARIPHFHNTPFYVYAYAFSDLAVG 596

Query: 563 SLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ-TVEKMID 621
           SLY +YK++  + F++KYL+ILR+GN K + E++ P  +N S   FW   ++ T   +ID
Sbjct: 597 SLYRVYKAHP-EGFEQKYLDILRSGNKKSFEEIMKPFGLNPSAETFWADAVEATGGTVID 655

Query: 622 DVEKM 626
           + E +
Sbjct: 656 EAESL 660


>gi|317181787|dbj|BAJ59571.1| oligoendopeptidase F [Helicobacter pylori F57]
          Length = 578

 Score =  288 bits (738), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 182/588 (30%), Positives = 300/588 (51%), Gaps = 21/588 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  L+ + +S E    ++ ++ E+  F++ ++ NL +     +      A+  YE + 
Sbjct: 6   WDLSALFENKESAE--EFLKTLQTEAQEFESAYQNNLKNL----DIAGFANALKHYEDLS 59

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           E I R+ +YA L +  N       KFY+       + ++ L+FF +E   LD    ++  
Sbjct: 60  EKISRVTTYAQLLFAKNTKEA---KFYSQCEMACTNIQQHLLFFEIEFKNLD---TKKQL 113

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
           A       ++ ++ N+ + KKH L+ D E +    S VG  A  R F E+  SL+    +
Sbjct: 114 AFIKKCKNHAFYLNNLIEKKKHTLNLDEEKIALALSPVGVGAFSRLFDEHFSSLKIPFEE 173

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           Q +   +      +  R++RK + KA S    KS  + ++I N + KD  I+ + RKY K
Sbjct: 174 QNLSEEEILALLHNPKRKIRKKSQKAFSKALEKSRPLLTYILNMVRKDLLIETKLRKYNK 233

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
               RH+ N +    ++++++ V   +    HRYY  K + L    +  +DR APL   +
Sbjct: 234 KESFRHIDNQISQESVDSMIEIVNANFS-LVHRYYHQKAQILG-HKLKDYDRYAPLSDEN 291

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
              + +  A + VL +   FSP+   IA K     W+D+   D K  GAF+HG +PS HP
Sbjct: 292 -TTMTYSQALEEVLNTLKAFSPEFHKIASKAIKEGWVDSHPKDFKQGGAFSHGGVPSAHP 350

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           Y+LLNY G  +D  T+AHE GH IH  LS + QG+L  ++ LT AETAS+F E L F+ L
Sbjct: 351 YVLLNYTGNRRDAFTIAHEFGHMIHQELSKK-QGVLNMDTPLTTAETASVFSEMLFFEHL 409

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
            +   S +E   +LA K+ED+ +++ RQ+   +FE ++H       ++ T   + IW E 
Sbjct: 410 KKGLKS-DELLFMLAGKLEDIFSTLFRQVVMTNFERRIH---EIDEELDTKDFDRIWFEE 465

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
            +     +  L+   Y  +W  +PHFI S FY YAY++G  L  +LY +YK +    F +
Sbjct: 466 NQRMFEKSVKLTK-NYHLWWSYIPHFIHSPFYCYAYSYGQLLTLALYGLYKKSDAKEFIK 524

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            Y   L  G SK   EL+     ++    FWE G+Q V  ++++ E++
Sbjct: 525 TYTEFLSLGGSKSPKELVSMFGFDIDSKEFWEIGMQEVRHLLEEFERL 572


>gi|237751603|ref|ZP_04582083.1| oligoendopeptidase F [Helicobacter bilis ATCC 43879]
 gi|229372969|gb|EEO23360.1| oligoendopeptidase F [Helicobacter bilis ATCC 43879]
          Length = 652

 Score =  288 bits (738), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 183/544 (33%), Positives = 294/544 (54%), Gaps = 20/544 (3%)

Query: 90  AIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTL 149
           A+  Y+ + E +G I +Y  L +   + S      Y D   K       ++FF LE   L
Sbjct: 116 ALQTYDSLSEGLGSIMTYVFLKFA--IDSKKYGALYADYEMKCNAMYAKVMFFELEFADL 173

Query: 150 DEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENI 209
           D   + +    +     Y+ +++ I   KK+ LS   E +L + S VG +A  R F E+ 
Sbjct: 174 DSTKMNEFIKANE---NYAFFLQTIEANKKYKLSLKEEQILLNVSPVGVDAFSRLFDESF 230

Query: 210 ESLRFK--INDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDE 267
            ++RFK  +ND++I   +        +R++RK A K  +    K+SH+ ++I N + KD 
Sbjct: 231 ANMRFKGVLNDEEIGEEEILGFLHVRNRKLRKLAQKNFTKGLRKNSHLLTYILNMVRKDV 290

Query: 268 EIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYF 327
            I    R YEK    RH+SN      +++++  V N      H YY +K + L    +  
Sbjct: 291 AITQNLRGYEKPESFRHISNQTTQESVDSMIDCV-NANMNLVHGYYRVKSQLLG-HKLKD 348

Query: 328 WDRLAPLPGTSQDI----IPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGK 383
           +DR APL  T ++     + F+ A    L+S+ KFSP+   IA++   + WID+     K
Sbjct: 349 YDRYAPLGLTKENSKKAEVEFQDALYDTLESFYKFSPRFYEIAKEAIFNGWIDSHPKPAK 408

Query: 384 GSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLA 443
             GAF+HG++PS HPY++LN+ G  +D  T+AHELGH IH  L S+ QG L +++ LT A
Sbjct: 409 RGGAFSHGSVPSAHPYVMLNFTGNRRDAFTIAHELGHAIHQEL-SKIQGTLNHDTPLTTA 467

Query: 444 ETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRST 503
           ETAS+F E L FDS+ +    +E   I  A KIED+ +++ RQI   +FE  +H ER   
Sbjct: 468 ETASVFAEMLLFDSMKKTLKGRELLDI-YAGKIEDIFSTLFRQIVMTNFERAIH-ERE-- 523

Query: 504 GDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNS 563
           G++ +   + IWL+  K+  G +  L+  +Y  +W  +PHFI S FY YAY++G  LV +
Sbjct: 524 GELKSEDFDRIWLDENKKMFGDSVHLTK-KYAKWWSYIPHFIHSPFYCYAYSYGQLLVLA 582

Query: 564 LYDIYK-SNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
           L+ +YK S   + F + Y++ L AG SK   +L+L    ++++  FWE G+  V+ ++ +
Sbjct: 583 LFGLYKRSEDKEKFIQTYIDFLSAGGSKSPRDLILTFGFDVNESAFWEIGMNEVKNLLSE 642

Query: 623 VEKM 626
            E +
Sbjct: 643 FEDL 646


>gi|15611489|ref|NP_223140.1| oligopeptidase [Helicobacter pylori J99]
 gi|4154958|gb|AAD06003.1| OLIGOPEPTIDASE [Helicobacter pylori J99]
          Length = 578

 Score =  288 bits (737), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 184/588 (31%), Positives = 303/588 (51%), Gaps = 21/588 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  L+ + +S E    ++ ++ E   F+  ++ NL +    K  ++L      YE + 
Sbjct: 6   WDLSALFENKESAE--EFLKTLQTEVQEFENAYQNNLKNLDAAKFANTL----KHYENLS 59

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           E I R  +YA L +  N       KFY+      A+ ++ L+FF +E   LD    ++  
Sbjct: 60  EKISRAMAYAQLLFAKNTKEA---KFYSQCEMACANIQQHLLFFEIEFKNLDA---KKQL 113

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
           A       ++ ++ N+ + KKH L+ D E +    S VG  A  R F E+  SL+    +
Sbjct: 114 AFIKKCKDHAFYLNNLIEKKKHTLNLDEEKIALALSPVGVGAFSRLFDEHFSSLKIPFEE 173

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           + +   +      +  R++RK + KA S +  KS  + ++I N + KD  I+ + RKY+K
Sbjct: 174 KTLSEEEILALLHNPKRKIRKKSQKAFSKSLEKSRPLLTYILNMVRKDLLIETKLRKYDK 233

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
               RH+ N +    ++++++ V   +    HRYY  K + L    +  +DR APL   S
Sbjct: 234 KESFRHIDNQISQESVDSMIEIVNANFS-LVHRYYHQKAQILG-HKLKDYDRYAPLNDES 291

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
              + +  A + VL++   FSP+   IA K     W+D+   D K  GAF+HG +PS HP
Sbjct: 292 -ITMTYSQALEEVLKTLKAFSPEFHKIASKAIKEGWVDSHPKDFKQGGAFSHGAVPSAHP 350

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           Y+LLNY G  +D  T+AHE GH IH  LS + QG+L  ++ LT AETAS+F E L F+ L
Sbjct: 351 YVLLNYTGNRRDAFTIAHEFGHMIHQELSKK-QGVLNMDTPLTTAETASVFSEMLFFEHL 409

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
            +   S +E   +LA K+ED+ +++ RQ+   +FE ++H       ++ T   ++IW E 
Sbjct: 410 KKGLKS-DELLFMLAGKLEDIFSTLFRQVVMTNFERRIH---EMDEELDTKDFDQIWFEE 465

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
            +     +  L+   Y  +W  +PHFI S FY YAY++G  L  +LY +YK +    F +
Sbjct: 466 NQRMFEKSVKLTK-NYHLWWSYIPHFIHSPFYCYAYSYGQLLTLALYGLYKKSDAKEFVK 524

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            Y   L  G SK   EL+     ++    FWE G+Q V  ++++ E++
Sbjct: 525 TYTEFLSLGGSKSPKELVSMFGFDIDSKEFWEIGMQEVRHLLEEFERL 572


>gi|224372545|ref|YP_002606917.1| oligoendopeptidase F [Nautilia profundicola AmH]
 gi|223589093|gb|ACM92829.1| oligoendopeptidase F [Nautilia profundicola AmH]
          Length = 582

 Score =  288 bits (737), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 196/593 (33%), Positives = 313/593 (52%), Gaps = 29/593 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  L+ S    E    ++  E +++ F+  ++  L   T  +  + L     EYE I 
Sbjct: 3   WDLTPLFSS--LTEAEEFLKQAEFKAIEFEKNYKSRLYTLTPDEFLNVL----KEYEEIW 56

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTL--DEALLEQ 156
           E IGR  +YA L +  + S  +I   + +I  K    E+ LI+F LE   L  D+   +Q
Sbjct: 57  ENIGRSLTYAYLEFATDTSKGSILAKFQEIANKA---EEHLIWFELEFIYLPIDK---QQ 110

Query: 157 SYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI 216
            +  +    KY  ++ ++++   + LS   E +L         A  R F E+I  L F  
Sbjct: 111 QFIDNAGVYKY--YLIHLQEEAPYKLSEKEEKILMKKDLTSGSAFSRLFDEHISRLSFFF 168

Query: 217 NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ-DRWRK 275
             +K+   +     + SDR  RK A  +L+        +F++I N + KD +I     R 
Sbjct: 169 KGEKLSEEEVLSKLYSSDRNERKKAQVSLTLGLKPHQDLFAYIYNQVKKDWKIDFIDIRG 228

Query: 276 YEKIADSRHLSNNVEPYVIEALMQSV-KNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPL 334
           Y+ + + RHLSN V    ++AL+++V +N Y      YY LKK+ L  D ++ +DR AP+
Sbjct: 229 YDNVEEPRHLSNKVTKKSVDALVKTVNENTY--LVEEYYNLKKEILGYDQLFDYDRYAPI 286

Query: 335 PGT-SQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTI 393
             T  Q+ IPFE A++ VL ++  FS +   IA+K F  NWID     GK  GAF+H   
Sbjct: 287 KLTDKQEEIPFEEAKETVLNAFKNFSDKFYEIAKKAFDENWIDVYPKQGKRGGAFSHSAT 346

Query: 394 PSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETL 453
           P  HPY+LLNY  + +D+ TLAHELGH IH  L+ +  G L  ++ LT AETASIF E L
Sbjct: 347 PHAHPYVLLNYTNQRRDIFTLAHELGHAIHQYLAKDV-GYLNQDTPLTTAETASIFAEML 405

Query: 454 TFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINE 513
            F+ L ++    E  +I  A K+ED+  ++ RQI F +FE ++H    +  ++     N+
Sbjct: 406 LFEELKKSLPKNELMEI-YAGKLEDIFATLFRQIVFTNFERRVH----AADELKPQDYNK 460

Query: 514 IWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTV 573
           IW+E  ++  G +  L+   Y  +W  +PHFI S FY Y+Y++   LV +LY +YK N  
Sbjct: 461 IWMEENQKMFGESVILTQ-NYEIWWSYIPHFIHSPFYCYSYSYAQLLVLTLYKLYK-NGF 518

Query: 574 DCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           + F+EKY+  L  G S    + L    +++ D NFW+ G+  V  ++++ +++
Sbjct: 519 ENFEEKYIEFLSQGGSLPPKKQLEMFGVDIEDENFWQNGIGAVRDLLNEFKEL 571


>gi|108562871|ref|YP_627187.1| oligoendopeptidase F [Helicobacter pylori HPAG1]
 gi|107836644|gb|ABF84513.1| oligoendopeptidase F [Helicobacter pylori HPAG1]
          Length = 578

 Score =  288 bits (737), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 182/588 (30%), Positives = 299/588 (50%), Gaps = 21/588 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  L+ + +  E    ++ ++ E   F++ ++ NL +    K       A+  YE + 
Sbjct: 6   WDLSALFENKEHAE--EFLKTLQTEVQEFESAYQNNLKNLDAAK----FANALKHYENLS 59

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           E   R+ +YA L +  N       KFY+      A+ ++ L+FF +E   LD    ++  
Sbjct: 60  EKTSRVMTYAQLLFAKNTKEA---KFYSQCEMACANIQQHLLFFEIEFKNLDA---KKQL 113

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
           A       ++ ++ N+ + KKH L+ D E +    S VG  A  R F E+  SL+    +
Sbjct: 114 AFIKKCKDHAFYLNNLIERKKHTLNLDEEKIALALSPVGVGAFSRLFDEHFSSLKIPFEE 173

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           Q +   +      +  R++RK + KA S    KS  + ++I N + KD  I+ R RKY+K
Sbjct: 174 QNLSEEEILALLHNPKRKIRKKSQKAFSKALEKSRPLLTYILNMVRKDLLIETRLRKYDK 233

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
               RH+ N +    ++++++ V   +    HRYY  K + L    +  +DR APL   +
Sbjct: 234 KESFRHIDNQISQESVDSMIEIVNANFS-LVHRYYHQKAQILG-HKLKDYDRYAPLSDKN 291

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
              + +  A + VL +   FSP+   IA K     W+D+   D K  GAF+HG +PS HP
Sbjct: 292 -TTMTYSQALEEVLNTLKAFSPEFHKIASKAIKEGWVDSHPKDFKQGGAFSHGAVPSAHP 350

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           Y+LLNY G  +D  T+AHE GH IH  LS + QG+L  ++ LT AETAS+F E L F+  
Sbjct: 351 YVLLNYTGNRRDAFTIAHEFGHMIHQELSKK-QGVLNMDTPLTTAETASVFSEMLFFEH- 408

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
           L+    ++E   +LA K+ED+ +++ RQ+   +FE ++H       ++ T   + IW E 
Sbjct: 409 LKKGLKQDELLFMLAGKLEDIFSTLFRQVVMTNFERRIH---EIDEELDTKDFDRIWFEE 465

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
            +     +  L+   Y  +W  +PHFI S FY YAY++G  L  +LY +YK +    F +
Sbjct: 466 NQRMFEKSVKLTK-NYHLWWSYIPHFIHSPFYCYAYSYGQLLTLALYGLYKKSDAKEFVK 524

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            Y   L  G SK   EL+     ++    FWE G+Q V  ++++ E++
Sbjct: 525 TYTEFLSLGGSKSPKELVSMFGFDIDSKEFWEIGMQEVRHLLEEFERL 572


>gi|261837878|gb|ACX97644.1| oligoendopeptidase F [Helicobacter pylori 51]
          Length = 578

 Score =  288 bits (737), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 183/590 (31%), Positives = 303/590 (51%), Gaps = 25/590 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG--AAIAEYER 96
           W+L  L+ + +S E    ++ ++ E+  F++ ++ NL      KN  + G   A+  YE 
Sbjct: 6   WDLSALFENKESAE--EFLKTLQTEAQEFESAYQNNL------KNLDATGFANALKHYED 57

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQ 156
           + E I +  +YA L +  N       KFY+       + ++ L+FF +E   LD    ++
Sbjct: 58  LSEKISKAMTYAQLLFAKNTKEA---KFYSQCEMACTNIQQHLLFFEIEFKNLDA---KK 111

Query: 157 SYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI 216
             A       ++ ++ N+ + KKH L+ D E +    S VG  A  R F E+  SL+   
Sbjct: 112 QLAFIKKCKNHAFYLNNLIEKKKHTLNLDEEKIALALSPVGVGAFSRLFDEHFSSLKIPF 171

Query: 217 NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKY 276
            +Q +   +     ++  R++RK + KA S    KS  + ++I N + KD  I+ + RKY
Sbjct: 172 EEQNLSEEEILALLYNPKRKIRKKSQKAFSKALEKSRPLLTYILNMVRKDLLIETKLRKY 231

Query: 277 EKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPG 336
           +K    RH+ N +    ++++++ V   +    HRYY  K + L    +  +DR APL  
Sbjct: 232 DKKESFRHIDNQISQESVDSMLEIVNANFS-LVHRYYHQKAQILG-HKLKDYDRYAPLSD 289

Query: 337 TSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSV 396
            +   + +  A + VL +   FSP+   IA K     W+D+   D K  GAF+HG +PS 
Sbjct: 290 ENT-TMTYSQALEEVLNTLKAFSPEFHKIASKAIKEGWVDSHPKDFKQGGAFSHGGVPSA 348

Query: 397 HPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFD 456
           HPY+LLNY G  +D  T+AHE GH IH  LS + QG+L  ++ LT AETAS+F E L F+
Sbjct: 349 HPYVLLNYTGNRRDAFTIAHEFGHMIHQELSKK-QGVLNMDTPLTTAETASVFSEMLFFE 407

Query: 457 SLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWL 516
            L +   S +E   +LA K+ED+ +++ RQ+   +FE ++H       ++ T   + IW 
Sbjct: 408 HLKKGLKS-DELLFMLAGKLEDIFSTLFRQVVMTNFERRIH---EIDEELDTKDFDRIWF 463

Query: 517 ETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCF 576
           E  +     +  ++   Y  +W  +PHFI S FY YAY++G  L  +LY +YK +    F
Sbjct: 464 EENQRMFEKSVKITK-NYHLWWSYIPHFIHSPFYCYAYSYGQLLTLALYGLYKKSDAKEF 522

Query: 577 KEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + Y   L  G SK   EL+     ++    FWE G+Q V  ++++ E++
Sbjct: 523 VKTYTEFLSLGGSKSPKELVSMFGFDIDSKEFWEIGMQEVRHLLEEFERL 572


>gi|317010719|gb|ADU84466.1| oligoendopeptidase F [Helicobacter pylori SouthAfrica7]
          Length = 578

 Score =  288 bits (737), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 185/595 (31%), Positives = 302/595 (50%), Gaps = 35/595 (5%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAA--IAEYER 96
           W+L  L+ + +S E    ++ ++ E+  F++      AH  N K   + G A  +  YE 
Sbjct: 6   WDLSALFENKESTE--EFLKTLQTEAQEFES------AHQNNLKTLDATGFANTLKHYEN 57

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQ 156
           + E I +  +YA L +  N       KFY+       + ++ L+FF +E   LD      
Sbjct: 58  LLEKISKAMTYAQLLFAKNSKEA---KFYSQCEMACTNIQQHLLFFEIEFKNLD------ 108

Query: 157 SYAQDPLTL-----KYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIES 211
             ++  LT       ++ ++ N+ + KKH L+ D E +    S VG  A  R F E+  S
Sbjct: 109 --SKKQLTFIKKCKDHAFYLNNLIEKKKHTLNLDEEKIALALSPVGVGAFSRLFDEHFSS 166

Query: 212 LRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
           L+    DQ +   +      +  R++RK + KA S    KS  + ++I N + KD  I+ 
Sbjct: 167 LKIPFEDQVLSEEEVLALLHNPKRKIRKKSQKAFSKVLEKSRPLLTYILNMVRKDLLIET 226

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRL 331
           + RKY+K    RH+ N +    ++++++ V  ++    HRYY  K + L    +  +DR 
Sbjct: 227 KLRKYDKKESFRHIDNQISQESVDSMIEIVNAHFS-LVHRYYHKKAQILG-HKLKDYDRY 284

Query: 332 APLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHG 391
           APL   S   + +  A +  L++   FSP+   IA K     W+D+   + K  GAF+HG
Sbjct: 285 APLSAES-ITMTYSQALEETLKALKAFSPEFHKIASKAIKEGWVDSHPKEFKQGGAFSHG 343

Query: 392 TIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE 451
            +PS HPY+LLNY G  +D  T+AHE GH IH  LS + QG+L  ++ LT AETAS+F E
Sbjct: 344 AVPSTHPYVLLNYTGNRRDAFTIAHEFGHMIHQELSKK-QGVLNMDTPLTTAETASVFSE 402

Query: 452 TLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRI 511
            L F+  L+     +E   +LA K+ED+ +++ RQ+   +FE ++H       ++ T   
Sbjct: 403 MLLFEH-LKKNLKPDELLFMLAGKLEDIFSTLFRQVVMTNFERRIH---EIDEELDTKDF 458

Query: 512 NEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSN 571
           + IW E  +     +  L+   Y  +W  +PHFI S FY YAY++G  L  +LY +YK +
Sbjct: 459 DRIWFEENQRMFEKSVKLTK-NYHLWWSYIPHFIHSPFYCYAYSYGQLLTLALYGLYKKS 517

Query: 572 TVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
               F + Y   L  G SK   EL+L    ++    FWE G+Q V  ++++ E++
Sbjct: 518 DAKSFVKTYTEFLSLGGSKSPRELVLMFGFDIDSKEFWEIGMQEVRHLLEEFERL 572


>gi|305431863|ref|ZP_07401030.1| oligoendopeptidase F [Campylobacter coli JV20]
 gi|304444947|gb|EFM37593.1| oligoendopeptidase F [Campylobacter coli JV20]
          Length = 571

 Score =  287 bits (735), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 190/588 (32%), Positives = 310/588 (52%), Gaps = 21/588 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  L+ + D  E+ N  +    +S  FK  +   L    ++ N      A+ EYE + 
Sbjct: 4   WDLGVLFKNED--ELENTTQNYIQQSKEFKKNYSTTL----DKLNPDDFLNALKEYEHLH 57

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
            ++ +I +YA L   C     +   FYT    +    E+ L+FF LE   L E   E++ 
Sbjct: 58  LILSKIMTYAYL---CFAKDSSKGSFYTKYEQECKKIEENLLFFELEFCELSE---EKTK 111

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
                   Y  +++N+ + K++ LS   E ++   S  G  A  R F E++ +L+     
Sbjct: 112 ELIKFCKGYDFYLQNLLQNKRYNLSQKEERIMLYLSNTGANAFSRLFDESMTALKIPFEG 171

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
            K+   +     +++DR++RK AAK  +   +K+ ++ +FI N +  +     + R YE 
Sbjct: 172 NKLSEEEILSKLYNNDRKIRKKAAKKFTKALDKNLNLLTFIFNMIKTELNNICKLRGYES 231

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
               RHL N +    +++L+Q+ + ++   S+ +Y+ KK+ L  + +  +DR AP+   +
Sbjct: 232 AETPRHLQNQITQQSVDSLIQTTQKHFYLVSN-FYKRKKQILGFNKLKDYDRYAPIGKEA 290

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
           +    FE ++ ++L ++  FSP    IA++ F   WID    D K SGAF+H   P  HP
Sbjct: 291 K--FSFEESKKIILNAFYDFSPVFGDIAKEAFKKGWIDVYPQDKKQSGAFSHSATPDTHP 348

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           +ILLNY    +D+ TLAHELGH IH  LS      L  N+ LT AETAS+F E L FD  
Sbjct: 349 FILLNYTDGRRDLFTLAHELGHTIHQKLSYNV-SFLNQNTPLTTAETASVFAEMLVFD-Y 406

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
           ++    KEE   L A KIED+  ++ RQI+F  FE ++H    +  ++ +  I++IW+E 
Sbjct: 407 VKNKLKKEELLALYAAKIEDIFATLYRQINFTCFERRIHV---NENELKSEEISQIWMEE 463

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
            ++  G + +LS   Y  +W  +PHFI S FY YAYA+   LV +LY +YKSN    FKE
Sbjct: 464 SQKMFGESVELSK-NYALWWSYIPHFIHSPFYCYAYAYAQLLVLALYGLYKSNACSNFKE 522

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            Y+ +L  G S    EL+     ++ D +FWE G+  ++K+ID+  ++
Sbjct: 523 LYIKMLSLGGSVSPKELVGMFGFDIEDKSFWEIGIVEIKKLIDEFMRL 570


>gi|297379666|gb|ADI34553.1| oligoendopeptidase, pepF/M3 family [Helicobacter pylori v225d]
          Length = 578

 Score =  287 bits (734), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 185/590 (31%), Positives = 300/590 (50%), Gaps = 25/590 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG--AAIAEYER 96
           W+L  L+ + +S E    ++ ++ E   F++ ++ NL      KN  + G   A+  YE 
Sbjct: 6   WDLSALFENKESAE--EFLKTLQTEVQEFESAYQNNL------KNLDATGFANALKHYED 57

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQ 156
           + E I +  +YA L +  N       KFY+       + ++ L+FF +E   LD    ++
Sbjct: 58  LSEKISKAMTYAQLLFAKNTKEA---KFYSQCEMACTNIQQHLLFFEIEFKNLDA---KK 111

Query: 157 SYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI 216
             A       ++ ++ N+ + KKH L+ D E +    S VG  A  R F E+  SL+   
Sbjct: 112 QLAFIKKCKNHAFYLNNLIERKKHTLNLDEEKIALALSPVGVGAFSRLFDEHFSSLKIPF 171

Query: 217 NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKY 276
            +Q +   +      +  R++RK + KA S    KS  + ++I N + KD  I+ R RKY
Sbjct: 172 EEQNLSEEEILALLHNPKRKIRKKSQKAFSKALEKSRPLLTYILNMVRKDLLIETRLRKY 231

Query: 277 EKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPG 336
           +K    RH+ N +    ++++++ V   +    HRYY  K + L    +  +DR APL  
Sbjct: 232 DKKESFRHIDNQISQESVDSMIEIVNANFS-LVHRYYHQKAQILG-HKLKDYDRYAPL-S 288

Query: 337 TSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSV 396
                + +  A + VL +   FSP+   IA K     W+D+   D K  GAF+HG +PS 
Sbjct: 289 DEHTTMTYSQALEEVLNTLKAFSPEFYKIASKAIKEGWVDSHPKDFKQGGAFSHGGVPSA 348

Query: 397 HPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFD 456
           HPY+LLNY G  +D  T+AHE GH IH  LS + QG+L  ++ LT AETAS+F E L F+
Sbjct: 349 HPYVLLNYTGNRRDAFTIAHEFGHMIHQELSKK-QGVLNMDTPLTTAETASVFSEMLFFE 407

Query: 457 SLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWL 516
            L +   S +E   +LA K+ED+ +++ RQ+   +FE ++H       ++ T   + IW 
Sbjct: 408 HLKKGLKS-DELLFMLAGKLEDIFSTLFRQVVMTNFERRIH---EIDEELDTKDFDRIWF 463

Query: 517 ETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCF 576
           E  +     +  L+   Y  +W  +PHFI S FY YAY++G  L  +LY +YK +    F
Sbjct: 464 EENQRMFEKSVKLTK-NYHLWWSYIPHFIHSPFYCYAYSYGQLLTLALYGLYKKSDAKEF 522

Query: 577 KEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + Y   L  G SK   EL+     ++    FWE G+Q V  ++++ E++
Sbjct: 523 VKTYTEFLSLGGSKSPKELVSMFGFDIDSKEFWEIGMQEVHHLLEEFERL 572


>gi|315638602|ref|ZP_07893776.1| oligoendopeptidase F [Campylobacter upsaliensis JV21]
 gi|315481226|gb|EFU71856.1| oligoendopeptidase F [Campylobacter upsaliensis JV21]
          Length = 574

 Score =  287 bits (734), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 193/588 (32%), Positives = 301/588 (51%), Gaps = 29/588 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESL----AFKTRWEGNLAHATNQKNCHSLGAAIAEY 94
           W+L  L+ + +      ++E    E++     F+ ++E  +AH + ++   SL     +Y
Sbjct: 4   WDLSALFKNEE------ELEAFACENIRQAEEFRQKYEKKIAHLSKEEFLISL----KQY 53

Query: 95  ERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALL 154
           E + E   +I +YA L +  N  +      Y +   K+ +          E+  L  +  
Sbjct: 54  ENLNENATKIMTYAYLCFAKNTLNGDFYARYEEKCKKIEENLLFFELEFCELEELKSSEF 113

Query: 155 EQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF 214
            + + +D     Y+ ++ N+ K KK  LS   E +L   S  G  A  R F E++ +LR 
Sbjct: 114 VE-FCED-----YAFYLNNLLKNKKFNLSQKEERILLYLSNTGASAFSRLFDESMSALRI 167

Query: 215 KINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWR 274
               QK+   +     + +DR+VRK AAK  +   NK++ + SFI N +  + +     R
Sbjct: 168 NFEGQKLSEEEILSKLYHNDRKVRKKAAKNFTKALNKNASLLSFILNMIKTELKNICHLR 227

Query: 275 KYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPL 334
            YE     RHLSN +    ++AL+ S +  Y      +Y LKK+ L    +  +DR APL
Sbjct: 228 GYENAEMPRHLSNQISQKSVDALILSAEKSYHLVED-FYLLKKQILGFKELKDYDRYAPL 286

Query: 335 PGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIP 394
              +     FE ++D+VL+++  FS +   IA++ F   WID    + K  GAF+H  I 
Sbjct: 287 GKEAN--FSFEKSKDIVLKAFKSFSSEFEDIAKEAFEKGWIDVYPKENKQGGAFSHSAIK 344

Query: 395 SVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLT 454
             HPYILLNY  K +D+ TLAHELGH IH  LS +    L  N+ LT AETAS+F E L 
Sbjct: 345 EAHPYILLNYTNKRRDLFTLAHELGHTIHQKLSYKV-SFLNQNTPLTTAETASVFAEMLV 403

Query: 455 FDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEI 514
           FD  ++     EE   L A KIED+  ++ RQISF  FE ++H E     ++   +I+ I
Sbjct: 404 FD-YVKNKLKNEELIALYAAKIEDIFATLYRQISFTCFERRVHKEE---NELKKEQIDAI 459

Query: 515 WLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVD 574
           W+E   +  G +  L+   Y S+W  +PHFI S FY YAY++   LV +LY +YKS   +
Sbjct: 460 WMEESAKMFGKSVKLTK-NYASWWSYIPHFIHSPFYCYAYSYAQLLVLALYGLYKSGKCE 518

Query: 575 CFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
            FKE Y+ +L  G S    EL+     ++ D NFW+ G+  +EK++ +
Sbjct: 519 NFKELYIKMLSRGGSVSPKELISVFGFDVEDENFWQFGICEIEKLLKE 566


>gi|109947633|ref|YP_664861.1| hypothetical protein Hac_1098 [Helicobacter acinonychis str.
           Sheeba]
 gi|109714854|emb|CAJ99862.1| pepF [Helicobacter acinonychis str. Sheeba]
          Length = 578

 Score =  287 bits (734), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 183/590 (31%), Positives = 302/590 (51%), Gaps = 25/590 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAA--IAEYER 96
           W+   L+ + +S E    ++ ++ E+  F++      AH  N K   + G A  + +YE 
Sbjct: 6   WDFSALFENKESAE--EFLKTLQTEAQEFES------AHQNNLKTLDATGFANTLKDYEN 57

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQ 156
           + E I ++ +YA L +  N       KFY+       + ++ L+FF +E   LD    ++
Sbjct: 58  LLEKISKVMTYAQLLFAKNSKEA---KFYSQCGMACTNIQQHLLFFEIEFKNLD---TKK 111

Query: 157 SYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI 216
             A       ++ ++ N+ + KKH L+ D E +    S VG  A  R F E+  SL+   
Sbjct: 112 QLAFIKKCKDHAFYLNNLIEKKKHTLNLDEEKIALALSPVGVGAFSRLFDEHFSSLKIPF 171

Query: 217 NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKY 276
            DQ +   +      +  R++RK + KA S    K   + ++I N + KD  I+ + RKY
Sbjct: 172 EDQVLSEEEVLALLHNPKRKIRKKSQKAFSKVLEKFRPLLTYILNMVRKDLLIETKLRKY 231

Query: 277 EKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPG 336
           +K    RH+ N +    ++++++ V   +    HRYY  K + L    +  +DR APL  
Sbjct: 232 DKKESFRHIDNQISQESVDSMIEIVNANFS-LVHRYYHKKAQILG-HKLKDYDRYAPLNA 289

Query: 337 TSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSV 396
            S   + +  A + +L++   FSP+   IA K     W+D+   + K  GAF+HG +PS 
Sbjct: 290 ES-ITMTYSHALEEILKALKAFSPEFHKIASKAIKEGWVDSHPKEFKQGGAFSHGAVPSA 348

Query: 397 HPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFD 456
           HPY+LLNY G  +D  T+AHE GH IH  LS + QG+L  ++ LT AETAS+F E L F+
Sbjct: 349 HPYVLLNYTGNRRDAFTIAHEFGHMIHQELSKK-QGVLNMDTPLTTAETASVFSEMLLFE 407

Query: 457 SLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWL 516
            L +   S +E   +LA K+ED+ +++ RQ+   +FE ++H       ++ T   N+IW 
Sbjct: 408 HLKKNLKS-DELLFMLAGKLEDIFSTLFRQVVMTNFERRIH---EMDEELDTKDFNQIWF 463

Query: 517 ETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCF 576
           E  +     +  L+   Y  +W  +PHFI S FY YAY++G  L  +LY +YK +    F
Sbjct: 464 EENQRMFEKSVKLTK-NYHLWWSYIPHFIHSPFYCYAYSYGQLLTLALYGLYKKSDAKSF 522

Query: 577 KEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + Y   L  G SK   EL+     ++    FWE G+Q V  ++++ E++
Sbjct: 523 VKTYTEFLSLGGSKSPKELVSMFGFDIDSKEFWEIGMQEVRHLLEEFERL 572


>gi|261839292|gb|ACX99057.1| hypothetical protein HPKB_0452 [Helicobacter pylori 52]
          Length = 578

 Score =  287 bits (734), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 184/590 (31%), Positives = 302/590 (51%), Gaps = 25/590 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG--AAIAEYER 96
           W+L  L+ + +S E    ++ ++ E+  F++ ++ NL      KN  + G   A+  YE 
Sbjct: 6   WDLSALFENKESAE--EFLKTLQTEAQEFESTYQNNL------KNLDAAGFANALKHYED 57

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQ 156
           + E I +  +YA L +  N       KFY+       + ++ L+FF +E   LD    ++
Sbjct: 58  LSEKISKAMTYAQLLFAKNTKEA---KFYSQCEMACTNIQQHLLFFEIEFKNLDA---KK 111

Query: 157 SYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI 216
             A       ++ ++ N+ + KKH L+ D E +    S VG  A  R F E+  SL+   
Sbjct: 112 QLAFIKKCKNHAFYLNNLIERKKHTLNLDEEKIALALSPVGVGAFSRLFDEHFSSLKIPF 171

Query: 217 NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKY 276
            +Q +   +      +  R++RK + KA S    KS  + ++I N + KD  I+ + RKY
Sbjct: 172 EEQNLSEEEILALLHNPKRKIRKKSQKAFSKALEKSRPLLTYILNMVRKDLLIETKLRKY 231

Query: 277 EKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPG 336
           +K    RH+ N +    ++++++ V   +    HRYY  K + L    +  +DR APL  
Sbjct: 232 DKKESFRHIDNQISQESVDSMIEIVNANFS-LVHRYYHQKAQILG-HKLKDYDRYAPLSD 289

Query: 337 TSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSV 396
            +   + +  A + VL +   FSP+   IA K     W+D+   D K  GAF+HG +PS 
Sbjct: 290 ENT-TMTYSQALEEVLNTLKAFSPEFHKIASKAIKEGWVDSHPKDFKQGGAFSHGGVPSA 348

Query: 397 HPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFD 456
           HPY+LLNY G  +D  T+AHE GH IH  LS + QG+L  ++ LT AETAS+F E L F+
Sbjct: 349 HPYVLLNYTGNRRDAFTIAHEFGHMIHQELSKK-QGVLNMDTPLTTAETASVFSEMLFFE 407

Query: 457 SLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWL 516
            L +   S +E   +LA K+ED+ +++ RQ+   +FE ++H       ++ T   + IW 
Sbjct: 408 HLKKGLKS-DELLFMLAGKLEDIFSTLFRQVVMTNFERRIH---EIDEELDTKDFDRIWF 463

Query: 517 ETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCF 576
           E  +     +  L+   Y  +W  +PHFI S FY YAY++G  L  +LY +YK +    F
Sbjct: 464 EENQRMFEKSVKLTK-NYHLWWSYIPHFIHSPFYCYAYSYGQLLTLALYGLYKKSDAKEF 522

Query: 577 KEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + Y   L  G SK   EL+     ++    FWE G+Q V  ++++ E++
Sbjct: 523 VKTYTEFLSLGGSKSPKELVSMFGFDIDSKEFWEIGMQEVRHLLEEFERL 572


>gi|317013888|gb|ADU81324.1| oligoendopeptidase F [Helicobacter pylori Gambia94/24]
          Length = 578

 Score =  286 bits (733), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 182/588 (30%), Positives = 300/588 (51%), Gaps = 21/588 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  L+ + +S E    ++ ++ E+   ++ ++ NL       +      A+  YE + 
Sbjct: 6   WDLSALFENKESAE--EFLKTLQTEAQELESAYQNNLKDL----DATGFADALKHYENLL 59

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           E I R  +YA L +  N       KFY+      A+ ++ L+FF +E   LD    ++  
Sbjct: 60  EKISRAMTYAQLLFAKNTKEA---KFYSQCEMACANIQQHLLFFEIEFKNLDA---KKQL 113

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
           A       ++ ++ N+ + KKH L+ D E +    S VG  A  R F E+  SL+    +
Sbjct: 114 AFIKKCKDHAFYLNNLIEKKKHTLNLDEEKIALALSPVGVGAFSRLFDEHFSSLKIPFEE 173

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           + +   +      +  R++RK + KA S    KS  + ++I N + KD  I+ + RKY+K
Sbjct: 174 KTLSEEEILALLHNPKRKIRKKSQKAFSKALEKSRPLLTYILNMVRKDLLIETKLRKYDK 233

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
               RH+ N +    ++++++ V   +    HRYY  K + L    +  +DR APL   S
Sbjct: 234 KESFRHIDNQISQESVDSMIEIVNANFS-LVHRYYHQKAQILG-HKLKDYDRYAPLNNES 291

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
              + +  A + VL++   FSP+   IA K     W+D+   D K  GAF+HG +PS HP
Sbjct: 292 I-TMTYSQALEEVLKTLKAFSPEFHKIASKAIKEGWVDSHPKDFKQGGAFSHGAVPSAHP 350

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           Y+LLNY G  +D  T+AHE GH IH  LS + QG+L  ++ LT AETAS+F E L F+ L
Sbjct: 351 YVLLNYTGNRRDAFTIAHEFGHMIHQELSKK-QGVLNMDTPLTTAETASVFSEMLFFEHL 409

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
            +   S +E   +LA K+ED+ +++ RQ+   +FE ++H       ++ T   + IW E 
Sbjct: 410 KKGLKS-DELLFMLAGKLEDIFSTLFRQVVMTNFERRIH---EMDEELDTKDFDRIWFEE 465

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
            +     +  L+   Y  +W  +PHFI S FY YAY++G  L  +LY +YK +    F +
Sbjct: 466 NQRMFEKSVKLTK-NYHLWWSYIPHFIHSPFYCYAYSYGQLLTLALYGLYKKSDAKEFVK 524

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            Y   L  G SK   EL+     ++    FWE G+Q V  ++++ E++
Sbjct: 525 TYTEFLSLGGSKSPKELVSMFGFDIDSKEFWEIGMQEVRHLLEEFERL 572


>gi|221486519|gb|EEE24780.1| oligoendopeptidase F, putative [Toxoplasma gondii GT1]
          Length = 667

 Score =  286 bits (731), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 190/605 (31%), Positives = 321/605 (53%), Gaps = 25/605 (4%)

Query: 35  NLPRWNLEDLYP--SHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
            LPR+NL+  +P  S     I  D+E +   +  FK R++G L          +L  A+ 
Sbjct: 68  TLPRYNLKRHFPYSSIFDPAIDRDIEALSRRAREFKERFKGTLET--------TLLEALI 119

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA-DFEKVLIFFALEINTLDE 151
           ++E++ E +  +  Y  L    N ++  IRK    + + +A D +   +F  LE+  + E
Sbjct: 120 KHEQLDEAVDFVDYYIALVAAVNTTNEEIRKRVNQLESAIAADVQPYRLFVNLELGAMPE 179

Query: 152 ALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIES 211
           A L++  A +     YS ++   R+   ++LS D+E  L     +  +    ++ + +  
Sbjct: 180 AALQKQMAANGNLSFYSGFLGAARRRAPYVLSEDVERALLVRKPMTVQVATEYYFKQLGD 239

Query: 212 LRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTF--NKSSHIFSFITNTLAKDEEI 269
             F +N +K+ L+       D+ +E R +A KA+      +K ++  +   N +A    +
Sbjct: 240 ATFDMNGEKLILSMILAFIMDNSQEKRWAAQKAVKQGLERHKITNFAALSLNVVAGSWHM 299

Query: 270 QDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLK----LDTM 325
           + + R Y+++  SR+++NNV    I+AL+ + +      + RY+ LKKK LK    ++  
Sbjct: 300 ERKERGYKRLRSSRNVANNVSDETIDALIHAGETVAVSLTKRYFMLKKKILKNRAGVEVF 359

Query: 326 YFWDRLAPLPGTSQD-IIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKG 384
            F DRLAPLP  S D +  ++ +  +V  +Y  FSP M+++ +K      IDAP   GK 
Sbjct: 360 DFADRLAPLPLKSTDRLYDWKESTRIVRDAYKSFSPTMALMFDKLLEEERIDAPAVPGKR 419

Query: 385 SGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAE 444
           + A   GT P+  P+I+L ++G+P+ V TLAHE GH IH +LS E QG L     LT+AE
Sbjct: 420 TPACYLGT-PTTGPFIILEHVGQPRCVETLAHEAGHAIHSMLSYE-QGNLQLAPPLTIAE 477

Query: 445 TASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTG 504
            AS+ GE + F+ LL+  +  EER   L   ++   +++ RQ+ F DFE ++H + R+ G
Sbjct: 478 MASLMGERIVFNDLLRRTTDPEERLSHLLRYLDGWTSTVTRQLMFDDFERRVH-DARAQG 536

Query: 505 DIPTHRINEIWLETQKESLGPAFDLSDLEYGSF--WMMVPHFIESSFYVYAYAFGNCLVN 562
            IP      +W E+ ++  G   ++ D    S   W  +PHF  + FYVYAYAF +  V 
Sbjct: 537 TIPDGTFTTMWKESLEKYFGAEGEVFDSYANSEADWTRIPHFHNTPFYVYAYAFSDLAVG 596

Query: 563 SLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ-TVEKMID 621
           SLY +YK++  + F++KYL+ILR+GN K + E++ P  +N S   FW   ++ T   +ID
Sbjct: 597 SLYRVYKAHP-EGFEQKYLDILRSGNKKSFEEIMKPFGLNPSAETFWADAVEATGGTVID 655

Query: 622 DVEKM 626
           + E +
Sbjct: 656 EAESL 660


>gi|308061800|gb|ADO03688.1| oligoendopeptidase F [Helicobacter pylori Cuz20]
          Length = 578

 Score =  286 bits (731), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 185/590 (31%), Positives = 300/590 (50%), Gaps = 25/590 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG--AAIAEYER 96
           W+L  L+ + +S E    ++ ++ E   F++ ++ NL      KN  + G   A+  YE 
Sbjct: 6   WDLSALFENKESTE--EFLKTLQTEVQEFESAYQNNL------KNLDATGFSNALKYYED 57

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQ 156
           + E I +  +YA L +  N       KFY+       + ++ L+FF +E   LD    ++
Sbjct: 58  LSEKISKAMTYAQLLFAKNTKEA---KFYSQCEMACTNIQQHLLFFEIEFKNLDA---KK 111

Query: 157 SYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI 216
             A       ++ ++ N+ + KKH L+ D E +    S VG  A  R F E+  SL+   
Sbjct: 112 QLAFIKKCKDHAFYLNNLIEKKKHTLNLDEEKIALALSPVGVGAFSRLFDEHFSSLKIPF 171

Query: 217 NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKY 276
            +Q +   +      +  R++RK + KA S    KS  + ++I N + KD  I+ R RKY
Sbjct: 172 EEQHLSEEEILALLHNPKRKIRKKSQKAFSKALEKSRPLLTYILNMVRKDLLIETRLRKY 231

Query: 277 EKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPG 336
           +K    RH+ N +    ++++++ V   +    HRYY  K + L    +  +DR APL  
Sbjct: 232 DKKESFRHIDNQISQESVDSMIEIVNANFS-LVHRYYHQKAQILG-HKLKDYDRYAPL-S 288

Query: 337 TSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSV 396
                + +  A + VL +   FSP+   IA K     W+D+   D K  GAF+HG +PS 
Sbjct: 289 DEHTTMTYSQALEEVLNTLKAFSPEFYKIASKAIKEGWVDSHPKDFKQGGAFSHGGVPSA 348

Query: 397 HPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFD 456
           HPY+LLNY G  +D  T+AHE GH IH  LS + QG+L  ++ LT AETAS+F E L F+
Sbjct: 349 HPYVLLNYTGNRRDAFTIAHEFGHMIHQELSKK-QGVLNMDTPLTTAETASVFSEMLFFE 407

Query: 457 SLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWL 516
            L +   S +E   +LA K+ED+ +++ RQ+   +FE ++H       ++ T   + IW 
Sbjct: 408 HLKKGLKS-DELLFMLAGKLEDIFSTLFRQVVMTNFERRIH---EIDEELDTKDFDRIWF 463

Query: 517 ETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCF 576
           E  +     +  L+   Y  +W  +PHFI S FY YAY++G  L  +LY +YK +    F
Sbjct: 464 EENQRMFEKSVKLTK-NYHLWWSYIPHFIHSPFYCYAYSYGQLLTLALYGLYKKSDAKEF 522

Query: 577 KEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + Y   L  G SK   EL+     ++    FWE G+Q V  ++++ E++
Sbjct: 523 VKTYTEFLSLGGSKSPKELVSMFGFDIDSKEFWEIGMQEVRHLLEEFERL 572


>gi|221508289|gb|EEE33876.1| oligoendopeptidase F, putative [Toxoplasma gondii VEG]
          Length = 667

 Score =  286 bits (731), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 190/605 (31%), Positives = 321/605 (53%), Gaps = 25/605 (4%)

Query: 35  NLPRWNLEDLYP--SHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
            LPR+NL+  +P  S     I  D+E +   +  FK R++G L          +L  A+ 
Sbjct: 68  TLPRYNLKRHFPYSSIFDPAIDRDIEALSRRAREFKERFKGTLET--------TLLEALI 119

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA-DFEKVLIFFALEINTLDE 151
           ++E++ E +  +  Y  L    N ++  IRK    + + +A D +   +F  LE+  + E
Sbjct: 120 KHEQLDEAVDFVDYYIALVAAVNTTNEEIRKRVNQLESAIAADVQPYRLFVNLELGAMPE 179

Query: 152 ALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIES 211
           A L++  A +     YS ++   R+   ++LS D+E  L     +  +    ++ + +  
Sbjct: 180 AALQKQMAANGNLSFYSGFLGAARRRAPYVLSEDVERALLVRKPMTVQVATEYYFKQLGD 239

Query: 212 LRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTF--NKSSHIFSFITNTLAKDEEI 269
             F +N +K+ L+       D+ +E R +A KA+      +K ++  +   N +A    +
Sbjct: 240 ATFDMNGEKLILSMILAFIMDNSQEKRWAAQKAVKQGLERHKITNFAALSLNVVAGSWHM 299

Query: 270 QDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLK----LDTM 325
           + + R Y+++  SR+++NNV    I+AL+ + +      + RY+ LKKK LK    ++  
Sbjct: 300 ERKERGYKRLRSSRNVANNVSDETIDALIHAGETVAVSLTKRYFMLKKKILKNRAGVEVF 359

Query: 326 YFWDRLAPLPGTSQD-IIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKG 384
            F DRLAPLP  S D +  ++ +  +V  +Y  FSP M+++ +K      IDAP   GK 
Sbjct: 360 DFADRLAPLPLKSTDRLYDWKESTRIVRDAYKSFSPTMALMFDKLLEEERIDAPAVPGKR 419

Query: 385 SGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAE 444
           + A   GT P+  P+I+L ++G+P+ V TLAHE GH IH +LS E QG L     LT+AE
Sbjct: 420 TPACYLGT-PTTGPFIILEHVGQPRCVETLAHEAGHAIHSMLSYE-QGNLQLAPPLTIAE 477

Query: 445 TASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTG 504
            AS+ GE + F+ LL+  +  EER   L   ++   +++ RQ+ F DFE ++H + R+ G
Sbjct: 478 MASLMGERIVFNDLLRRTTDPEERLSHLLRYLDGWTSTVTRQLMFDDFERRVH-DARAQG 536

Query: 505 DIPTHRINEIWLETQKESLGPAFDLSDLEYGSF--WMMVPHFIESSFYVYAYAFGNCLVN 562
            IP      +W E+ ++  G   ++ D    S   W  +PHF  + FYVYAYAF +  V 
Sbjct: 537 TIPDGTFTTMWKESLEKYFGAEGEVFDSYANSEADWARIPHFHNTPFYVYAYAFSDLAVG 596

Query: 563 SLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ-TVEKMID 621
           SLY +YK++  + F++KYL+ILR+GN K + E++ P  +N S   FW   ++ T   +ID
Sbjct: 597 SLYRVYKAHP-EGFEQKYLDILRSGNKKSFEEIMKPFGLNPSAETFWADAVEATGGTVID 655

Query: 622 DVEKM 626
           + E +
Sbjct: 656 EAESL 660


>gi|57167986|ref|ZP_00367125.1| oligoendopeptidase F [Campylobacter coli RM2228]
 gi|57020360|gb|EAL57029.1| oligoendopeptidase F [Campylobacter coli RM2228]
          Length = 571

 Score =  285 bits (729), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 188/588 (31%), Positives = 309/588 (52%), Gaps = 21/588 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  L+ + D  E+ N  +    +S  FK  +   L    ++ N      A+ EYE + 
Sbjct: 4   WDLGVLFKNED--ELENTTQNYIQQSKEFKKNYSTTL----DKLNPDDFLNALKEYEHLH 57

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
            ++ +I +YA L   C     +   FY     +    E+ L+FF LE   L E   E++ 
Sbjct: 58  LILSKIMTYAYL---CFAKDSSKGSFYAKYEQECKKIEENLLFFELEFCELSE---EKTK 111

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
                   Y  +++N+ + K++ LS   E ++   S  G  A  R F E++ +L+     
Sbjct: 112 ELIKFCKGYDFYLQNLLQNKRYNLSQKEERIMLYLSNTGANAFSRLFDESMTALKIPFEG 171

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
            K+   +     +++DR++RK AAK  +   +K+ ++ +FI N +  +     + R YE 
Sbjct: 172 NKLSEEEILSKLYNNDRKIRKKAAKKFTKALDKNLNLLTFIFNMIKTELNNICKLRGYES 231

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
               RHL N +    +++L+Q+ + ++   S+ +Y+ KK+ L  + +  +DR AP+   +
Sbjct: 232 AETPRHLQNQITQQSVDSLIQTTQKHFYLVSN-FYKRKKQILGFNKLKDYDRYAPIGKEA 290

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
           +    FE ++ ++L ++  FSP    IA++ F   WID    D K SGAF+H   P  HP
Sbjct: 291 K--FSFEESKKIILNAFYDFSPVFGDIAKEAFKKGWIDVYPQDKKQSGAFSHSATPDTHP 348

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           +ILLNY    +D+ TLAHELGH IH  LS      L  N+ LT AETAS+F E L FD  
Sbjct: 349 FILLNYTDGRRDLFTLAHELGHTIHQKLSYNV-SFLNQNTPLTTAETASVFAEMLVFD-Y 406

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
           ++    KEE   L A KIED+  ++ RQI+F  FE ++H    +  ++ +  +++IW+E 
Sbjct: 407 VKNKLKKEELLALYAAKIEDIFATLYRQINFTCFERRIHV---NENELKSEEVSQIWMEE 463

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
            ++  G + +LS   Y  +W  +PHFI S FY YAYA+   LV +LY +YKSN    FKE
Sbjct: 464 SQKMFGESVELSK-NYALWWSYIPHFIHSPFYCYAYAYAQLLVLALYGLYKSNACSNFKE 522

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            Y+ +L  G S    EL+     ++ D +FWE G+  ++K+ID+  ++
Sbjct: 523 LYIKMLSLGGSVSPKELVGMFGFDIEDKSFWEIGIVEIKKLIDEFMRL 570


>gi|325118671|emb|CBZ54222.1| putative oligoendopeptidase F [Neospora caninum Liverpool]
          Length = 630

 Score =  283 bits (724), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 188/605 (31%), Positives = 310/605 (51%), Gaps = 32/605 (5%)

Query: 34  GNLPRWNLED--LYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAI 91
             LPR+NL     Y S     I  D+E +  ++ AF  R++G L  A        L  A+
Sbjct: 30  ATLPRYNLTRHFGYTSIFDPRIDEDIEKLSRQAEAFNKRFKGTLDSA--------LSEAL 81

Query: 92  AEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA-DFEKVLIFFALEINTLD 150
             YE + E +  +  Y  L    N +   IR+    + +++A + +  L+F ++E+ +L 
Sbjct: 82  EAYEEVDEAVDMVDYYVALVSAVNTTDEAIRQRVNQLESRMASEIQPHLLFVSVELASLP 141

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIE 210
           EA +E+  A +     YS ++   R+   H+LS  +E  L     +       ++ + ++
Sbjct: 142 EAAIEKQKAANDNLHFYSGFLGAARRRAPHMLSESVERALMVRKPLTVTTATDYYFKQLD 201

Query: 211 SLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKS--SHIFSFITNTLAKDEE 268
              F +  +++ L +      DS +E R +A  A+     +   +   +   N +     
Sbjct: 202 DATFLMQGERMILPQVLSFIMDSQQERRWAAQAAVKQGLQEHMITKFGALSLNIVLGSWY 261

Query: 269 IQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWL----KLDT 324
            + + R Y+ +  SR++SNNV    IEAL+++ +    + + RYY LKK+ L     L T
Sbjct: 262 AERKERGYQTVRSSRNVSNNVSDATIEALIKAGETVAVQLTKRYYRLKKQILVKKGALTT 321

Query: 325 MYFWDRLAPLP-GTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGK 383
             F DRLAPLP  +S  +  +E + ++V  +Y+ FSP M+ + ++      IDAP   GK
Sbjct: 322 FDFADRLAPLPLKSSGHVFDWEESTNIVRTAYSSFSPTMAKLFDQLLDEERIDAPAVPGK 381

Query: 384 GSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLA 443
            + A   GT P+  P+++L ++G+   V TLAHE GH IH +LS E QG L +   LT+A
Sbjct: 382 RTPACYLGT-PTTGPFVVLQHVGQQHCVETLAHEAGHAIHSILSYE-QGNLQHVPPLTVA 439

Query: 444 ETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRST 503
           E AS+ GE + FDSLL   +  EER  LL + I+   +++ RQ+ F DFE ++H E R+ 
Sbjct: 440 EMASLMGERIVFDSLLGRTTDPEERLALLLSHIDGWTSTVTRQLMFDDFESRVH-EARTQ 498

Query: 504 GDIPTHRINEIWLETQKESLGPAFDLSDLEYGSF------WMMVPHFIESSFYVYAYAFG 557
           G IP      +W    KE+L   F      + SF      W+ +PHF    FYV+AYAF 
Sbjct: 499 GTIPDGAFTAMW----KEALEKYFGAEGEVFDSFANAELDWVRIPHFHRQPFYVHAYAFS 554

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
              V SLY +YK++  + F++KYL++LR+GN K + E++ P  ++ S  +FW   ++   
Sbjct: 555 ELAVGSLYGVYKTSP-NGFEQKYLDVLRSGNKKSFEEIMTPFGLDPSVESFWADAMKATG 613

Query: 618 KMIDD 622
             + D
Sbjct: 614 GAVMD 618


>gi|332673295|gb|AEE70112.1| oligoendopeptidase F [Helicobacter pylori 83]
          Length = 578

 Score =  282 bits (722), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 181/588 (30%), Positives = 298/588 (50%), Gaps = 21/588 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  L+ + +S E    ++ ++ E+  F++ ++ NL +     +      A+  YE + 
Sbjct: 6   WDLSALFENKESTE--EFLKTLQTEAQEFESAYQNNLKNL----DIAGFANALKHYEDLS 59

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           E I R  +YA L +  N       KFY+       + ++ L+FF +E   LD    ++  
Sbjct: 60  EKISRAMTYAQLLFAKNTKEA---KFYSQCEMACTNIQQHLLFFEIEFKNLDA---KKQL 113

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
           A       ++ ++ N+ + KKH L+ D E +    S VG  A  R F E+  SL+    +
Sbjct: 114 AFIKKCKNHAFYLNNLIEKKKHTLNLDEEKIALALSPVGVGAFSRLFDEHFSSLKIPFEE 173

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           Q +   +      +  R++RK + KA S    KS  + ++I N + KD  I+ + RKY K
Sbjct: 174 QYLSEEEILALLHNPKRKIRKKSQKAFSKALEKSRPLLTYILNMVRKDLLIETKLRKYNK 233

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
               RH+ N +    ++++++ V   +    HRYY  K + L    +  +DR APL   +
Sbjct: 234 KESFRHIDNQISQESVDSMIEIVNANFS-LVHRYYHQKAQILG-HKLKDYDRYAPLSDEN 291

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
              + +  A + VL +   FSP+   IA K     W+D+   D K  GAF+HG + S HP
Sbjct: 292 -TTMTYSQALEEVLNTLKAFSPEFHKIASKAIKEGWVDSHPKDFKQGGAFSHGGVSSAHP 350

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           Y+LLNY G  +D  T+AHE GH IH  LS + QG+L  ++ LT AETAS+F E L F+ L
Sbjct: 351 YVLLNYTGNRRDAFTIAHEFGHMIHQELSKK-QGVLNMDTPLTTAETASVFSEMLFFEHL 409

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
            +   S +E   +LA K+ED+ +++ RQ+   +FE ++H       ++ T   + IW E 
Sbjct: 410 KKGLKS-DELLFMLAGKLEDIFSTLFRQVVMTNFERRIH---EIDEELDTKDFDRIWFEE 465

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
            +     +  L+   Y  +W  +PHFI S FY YAY++G  L  +LY +YK +    F +
Sbjct: 466 NQRMFEKSVKLTK-NYHLWWSYIPHFIHSPFYCYAYSYGQLLTLALYGLYKKSDAKEFVK 524

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            Y   L  G SK   EL+     ++    FWE G+Q V  ++++ E++
Sbjct: 525 TYTEFLSLGGSKSPKELVSMFGFDIDSKEFWEIGMQEVRHLLEEFERL 572


>gi|308802213|ref|XP_003078420.1| Peptidase M3A and M3B, thimet/oligopeptidase F (ISS) [Ostreococcus
           tauri]
 gi|116056872|emb|CAL53161.1| Peptidase M3A and M3B, thimet/oligopeptidase F (ISS) [Ostreococcus
           tauri]
          Length = 758

 Score =  281 bits (720), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 196/611 (32%), Positives = 304/611 (49%), Gaps = 25/611 (4%)

Query: 29  SQENLGNLPRWNLED--LYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS 86
           +++++ + PRW+LE    Y S    +I ++M  IE     FK  +EG L           
Sbjct: 54  AEKSVASEPRWDLEKHFGYASASDTKIDDEMTSIERACEDFKKTFEGKLDA--------E 105

Query: 87  LGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFE-KVLIFFALE 145
           L  AI  YE I   + R  SY  LS +  LS   ++K    +  +        L +F LE
Sbjct: 106 LLEAIEAYEGIELTLTRALSYVSLSADTRLSDDNMQKRKASLMQRYGQASGNFLTWFNLE 165

Query: 146 INTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLS-DTSQVGREALKRF 204
           +  LDEA++   Y +      Y  ++  +R+   + LS ++E  LS  +S  G+  +  F
Sbjct: 166 LAALDEAVVAAQYEKSDKLRTYKPFVDEVRRSAPYNLSKEVERALSVRSSFAGKGKVVEF 225

Query: 205 FCENIESLRFKINDQKIPLTKAYKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTL 263
           +   +  L+F ++ +++ +         S D   R    K L+          +   N +
Sbjct: 226 YGNELSRLKFDMDGKQVNMEVLLAKMTSSRDAAERAKCMKTLNDGLKDFERTAALSLNMV 285

Query: 264 AKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLK-- 321
           A    I+ + R ++ +   R+LSNN+   V+++L+Q+V         +YY LKK+ LK  
Sbjct: 286 AGSWHIEMKERGFKTLRSQRNLSNNLPDDVVDSLLQAVGTTGVDYCKKYYALKKQILKHT 345

Query: 322 --LDTMYFWDRLAPLP-GTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAP 378
             LD   + DR A +  G  +D   +E A DLV   Y KFSP M+ +         ID P
Sbjct: 346 QGLDKFTWSDRNASIDIGKGEDKYTWEQAVDLVRDGYNKFSPTMAKLFMDMVEEKRIDVP 405

Query: 379 QYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNS 438
             DGK  GA+   +  S  P+ LLN+ G  +DV TLAHE GHG HF+L  E QGIL  + 
Sbjct: 406 AQDGKRGGAYCSSSFGS-GPFQLLNFTGTQRDVATLAHESGHGAHFILCYE-QGILQFHP 463

Query: 439 SLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHT 498
            LTLAETASIFGE + F  LL+   S E+R  ++ +K++D++NS+VRQ SF  FE K+H 
Sbjct: 464 PLTLAETASIFGEMIVFRDLLEKTPSDEDRLAMIMSKVDDIINSVVRQCSFDQFEEKVHN 523

Query: 499 ERRSTGDIPTHRINEIWLETQKESLGPAFDLSDL--EYGSFWMMVPHFIESSFYVYAYAF 556
             R+ G +    +   W E      G   ++ D        +  V HF    FYVYAYAF
Sbjct: 524 A-RANGTLTPEELATAWREVMVNYYGEEGEVFDSYENTSQLYAYVSHFHNVPFYVYAYAF 582

Query: 557 GNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT- 615
           G+ LV SLY  Y     + F+EK L++LRAG +K + + + P  ++ + P FW   L   
Sbjct: 583 GDLLVGSLYGAYMKQP-EGFEEKLLDLLRAGGTKDFVDAVSPFGLDPASPTFWSDALHAH 641

Query: 616 VEKMIDDVEKM 626
           +  ++++ E++
Sbjct: 642 LGGLMEEAEEL 652


>gi|291277062|ref|YP_003516834.1| M3 family peptidase [Helicobacter mustelae 12198]
 gi|290964256|emb|CBG40105.1| peptidase (M3 family) [Helicobacter mustelae 12198]
          Length = 569

 Score =  281 bits (720), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 174/542 (32%), Positives = 286/542 (52%), Gaps = 26/542 (4%)

Query: 90  AIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTL 149
           ++ EYE + E IGR+ +Y  L +  +     I   Y +   K  + E  ++FF LE   L
Sbjct: 48  SLQEYEEVLEGIGRVMTYVFLHFASDTKKGAI---YAEYEMKTHEIESHVLFFELEFCAL 104

Query: 150 D----EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFF 205
           D    + L+E++        +Y  +++ +   K H LS + E +L   S VG +A  R F
Sbjct: 105 DTETQKDLMEEAG-------QYGYYLEKLLLKKSHQLSLEEEKVLLQVSPVGVDAFARLF 157

Query: 206 CENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAK 265
            E   +L+    + +    +       S+RE RK A K  S    KS  +  +I N + K
Sbjct: 158 DEFFSTLKIPYQEGEKREEEILALLHSSNREERKEAQKCFSKELKKSRMLLGYIFNMVRK 217

Query: 266 DEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTM 325
           D +IQ + R Y      RH SN++    +++L+  V N   K  H+YY+ K + L    +
Sbjct: 218 DLQIQSKMRNYPNKEAFRHQSNHISQKSVDSLIDVV-NGNMKLVHKYYKHKSQILGY-KL 275

Query: 326 YFWDRLAPLPGTSQDI-IPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKG 384
             +DR AP+   +Q+  + +     +VL  +  FSP+   IA++     W+D+   D K 
Sbjct: 276 KDYDRYAPI--LNQEFSLDYAEGVGMVLACFEDFSPKFYKIAKRACEGGWVDSHPRDAKR 333

Query: 385 SGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAE 444
            GAF+HG +PS HP++LLNY G  +DV T+AHE GH +H  LS + QG L  ++ LT AE
Sbjct: 334 GGAFSHGAVPSAHPFVLLNYTGNYRDVFTIAHEFGHMVHQELSKK-QGYLNMDTPLTTAE 392

Query: 445 TASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTG 504
           TAS+F E L FDS ++   S+++   + A+K+ED+ +++ RQ+   +FE  +H   R   
Sbjct: 393 TASVFAEMLLFDS-VKKTLSRDQLLGIYASKLEDIFSTMFRQVVMTNFERAIHASDR--- 448

Query: 505 DIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSL 564
           ++    ++E+W+E  ++  G +  L+   Y  +W  +PHF+ S FY YAY++G  LV +L
Sbjct: 449 ELKAEELDEMWMEENQKMFGKSLKLTK-NYAMWWSYIPHFVHSPFYCYAYSYGQLLVLAL 507

Query: 565 YDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVE 624
           + +YK      F   Y   L +G SK   EL+     ++ DP FW  G++ V+KM+ + E
Sbjct: 508 FGLYKKQG-QSFVGVYEEFLSSGGSKSPRELVSAFGFDIEDPKFWNIGMKEVKKMLKEFE 566

Query: 625 KM 626
           ++
Sbjct: 567 EL 568


>gi|154147999|ref|YP_001406661.1| peptidase [Campylobacter hominis ATCC BAA-381]
 gi|153804008|gb|ABS51015.1| peptidase [Campylobacter hominis ATCC BAA-381]
          Length = 566

 Score =  281 bits (720), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 183/591 (30%), Positives = 311/591 (52%), Gaps = 38/591 (6%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W L+  + +++        E ++ ESL F   ++G +   +N +  ++L      YE + 
Sbjct: 3   WKLDKFFDNYNEF-----CETLKKESLEFSQNFKGRMNEISNDEFLNALKI----YENLS 53

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKV-------LIFFALEINTLDE 151
           E I +I +YA L +  +          T   A LA  E +       L+FF LE N LD 
Sbjct: 54  EKISKILTYAELKFAVD----------TTTGADLAKAEILANKISENLLFFELEFNELDT 103

Query: 152 ALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIES 211
              +    ++    +Y  +++ + K K H L+   E +L  T+ V   A  R F E + S
Sbjct: 104 QK-QNEILENAGNFRY--YLELLIKQKSHRLTFLEEKILLKTAPVRENAFSRLFSETLSS 160

Query: 212 LRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
           L+FK   + +   +      D  R+ RK AAK+LS    K+  I S+I N +  + +I  
Sbjct: 161 LKFKFKGKILNEEQILALLSDKKRKNRKKAAKSLSKVLQKNQQILSYIYNMIKTNLQITC 220

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRL 331
             RKYE      H +N +    +++L+++ +  +     ++Y+ K++ L  D +Y +DR 
Sbjct: 221 ELRKYESGEMIMHENNQISKQSVDSLIKTTERNF-NLVEKFYDKKREILGFDKLYDYDRY 279

Query: 332 APLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHG 391
           APL    +    FE  +++VL ++ +FS +   IA+K F  NWID      + SGAF+H 
Sbjct: 280 APLGDDEK--FSFEDTKNIVLAAFGEFSKEFEKIAKKAFDENWIDEKITSNRQSGAFSHS 337

Query: 392 TIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE 451
            +  +HP++ LN+ GK +DV TLAHELGH IH  L+    G   + + LT AE+ASIF E
Sbjct: 338 AVSEIHPFVFLNFTGKRRDVFTLAHELGHAIHQYLAYGV-GYFGSFTPLTTAESASIFCE 396

Query: 452 TLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRI 511
            L FD     A +K +++ +LANKIED+  ++ RQI+F  FE + H ++   G++   +I
Sbjct: 397 MLVFDYFKNRA-NKAKKQAILANKIEDIFATLYRQINFTTFEREFHAQK---GEVSAEKI 452

Query: 512 NEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSN 571
           +EIW++  K+  G +  L + +Y  +W  +PHFI S FY Y+YA+    V +++ +YKS 
Sbjct: 453 DEIWMKHSKKMFGKSLKLRN-DYKLWWSYIPHFIHSPFYCYSYAYAQLFVLAIFGLYKSK 511

Query: 572 TVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
             + F +KY+  L  G S+   +++   ++++ D NFW  G+  + K++ +
Sbjct: 512 KCENFTQKYIKFLSLGGSESPKDMIKIFDLDIEDENFWNIGINEISKLVGE 562


>gi|145345125|ref|XP_001417073.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144577299|gb|ABO95366.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 577

 Score =  279 bits (713), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 192/568 (33%), Positives = 291/568 (51%), Gaps = 22/568 (3%)

Query: 57  MECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNL 116
           M  +E     FK  +EG L          SL AAI  YE I + +  + SY  LS +  L
Sbjct: 1   MSAVEKACEGFKATYEGTLDT--------SLLAAIETYEGIEQTLTTVLSYMSLSADTRL 52

Query: 117 SSPTIRKFYTDINAKLADFE-KVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIR 175
               +++    +  +        L +F LE+  + E+ LE  YA+D     Y  +I  +R
Sbjct: 53  MDDAVQQRKGALMQQYGQASGNYLTWFGLELADMAESALEAQYAKDAKLKNYKPYIDEVR 112

Query: 176 KIKKHLLSNDME-CLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDS- 233
           +   + LS ++E  L   +S  G+  +  F+   +  L+F ++ +K+ +         S 
Sbjct: 113 RSAPYNLSKEVERALTVRSSFTGKGKVIEFYGNELSRLQFDLDGKKVNMEVLLAKMTSSK 172

Query: 234 DREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYV 293
           D  VR+   K L+        I +   N  A    I+++ R ++ +  SR+LSNN+   V
Sbjct: 173 DTMVRRQCMKTLNDGLKDFERICALSLNMAAGSWAIENKERGFKNLRSSRNLSNNLPDDV 232

Query: 294 IEALMQSVKNYYPKTSHRYYELKKKWLK----LDTMYFWDRLAPLP-GTSQDIIPFEVAR 348
           +++L+ +V         +YY LKK+ LK    L+T  + DR A +  G+ +D   +E A 
Sbjct: 233 VDSLLAAVATTGVDYCKKYYTLKKQILKSTQGLETFTWADRNASIDIGSGEDNYSWEQAV 292

Query: 349 DLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKP 408
           +LV + Y KFSP M+ +  KF     ID P  DGK  GA+      S  P+ LLN+    
Sbjct: 293 ELVHKGYNKFSPTMADMFTKFVDEKRIDVPAQDGKRGGAYCSSAYGS-GPFQLLNFTHSA 351

Query: 409 QDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEER 468
           +DV TLAHE GH +HF LS   QGIL  +  LTLAETASIFGE + F  LL+   S E+R
Sbjct: 352 RDVATLAHESGHAVHFELSY-PQGILQFHPPLTLAETASIFGEMIVFRDLLEKTPSDEDR 410

Query: 469 KILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFD 528
             ++ +K++D++NS+VRQ SF  FE K+HT  R+ G +    +++ W E  +E  G   +
Sbjct: 411 LAMIMSKVDDIINSVVRQCSFDKFEEKVHT-MRAKGTVTPEEMSKAWRECTEEYYGKEGE 469

Query: 529 LSD-LEYGS-FWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRA 586
           + D LE  S  +  V HF   +FYVYAYAFG+ LV SLY  Y     + F+ K L++LRA
Sbjct: 470 IFDSLEDTSHLYAYVSHFHNVAFYVYAYAFGDLLVGSLYGAYMKQP-EGFEAKLLDLLRA 528

Query: 587 GNSKHYSELLLPLNINLSDPNFWERGLQ 614
           G +K + E + P  ++     FW   L 
Sbjct: 529 GGTKDFVEAVEPFGLDPKSATFWSDALH 556


>gi|32267309|ref|NP_861341.1| oligoendopeptidase PepF [Helicobacter hepaticus ATCC 51449]
 gi|32263362|gb|AAP78407.1| oligoendopeptidase PepF [Helicobacter hepaticus ATCC 51449]
          Length = 618

 Score =  274 bits (700), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 187/618 (30%), Positives = 297/618 (48%), Gaps = 36/618 (5%)

Query: 25  TTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC 84
           T   S   +    +W+L  L+ +   +++   M      +  F   +EG L +       
Sbjct: 10  TQRSSMRGIIESSQWDLTALFKT--KEQLERFMSSHLRRAKKFAKSYEGQLKNI----KP 63

Query: 85  HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL 144
           +     I EYE+I E  GRI +Y  L   C     T    Y     +    + +++FF +
Sbjct: 64  NEFADVIKEYEQILEGFGRIMTYVFL---CFAKDTTQGDLYAKYEMQTTQIQNLVLFFEI 120

Query: 145 EINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRF 204
           E   L E   ++     P   +Y+ +++ I +   + LS   E +L  TS VG  A  R 
Sbjct: 121 EFCKLPETHRKEVIQHTP---QYAYFLEKIIEQDTYQLSLAEEKVLLATSPVGVGAFSRL 177

Query: 205 FCENIESLRFK------------INDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKS 252
           F E++   RF+                K+   +       S R VRK A K  S    KS
Sbjct: 178 FDEHLAQFRFEPLKKENKKSNKGKKSHKLSEEEILSLLHHSKRSVRKYAQKVFSKKLKKS 237

Query: 253 SHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRY 312
            H+ S++ N + KD  I    R Y+     RH++N      ++ L+  V  +Y   +  Y
Sbjct: 238 RHLLSYVLNMVRKDLSITTALRGYKLPESFRHINNGATQKSVDKLIDIVSAHYGIVAD-Y 296

Query: 313 YELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTH 372
           Y +K   L ++ +  +DR APL   + +I  +  A  LVL+++  FS +   IA K    
Sbjct: 297 YRVKASLLGINELQDYDRYAPLDTHTYEI-SYNEAIKLVLKAFENFSKEFKDIALKALKK 355

Query: 373 NWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQG 432
            W+D+     K  GAF+HG++PS HPY+LLNY    +D  T+AHE GH IH  L S+TQG
Sbjct: 356 GWVDSHPTPNKRGGAFSHGSVPSAHPYVLLNYTNSRRDAFTIAHEFGHMIHQEL-SKTQG 414

Query: 433 ILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDF 492
            L  ++ LT AETAS+F E L FD +L+    K+E   L A K+ED+ +++ RQI    F
Sbjct: 415 YLNMDTPLTTAETASVFAEMLLFD-MLKTTLDKQELISLYAGKLEDIFSTLFRQIVMTHF 473

Query: 493 ELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVY 552
           E ++H +   + ++     ++IW E  +   G +  L+   Y  +W  +PHF+ S FY Y
Sbjct: 474 ERRIHAQ---SEELKPEAFDKIWREENERMFGDSLKLTK-NYDGWWCYIPHFVHSPFYCY 529

Query: 553 AYAFGNCLVNSLYDIYKSNTVD----CFKEKYLNILRAGNSKHYSELLLPLNINLSDPNF 608
           AY++G  LV +L+ +YKS         F +KY + L  G SK   +L+     NL    F
Sbjct: 530 AYSYGQLLVLALFGLYKSQKTPRMRAKFIQKYTDFLSLGGSKSPKDLIASFGFNLESDKF 589

Query: 609 WERGLQTVEKMIDDVEKM 626
           W  G+  V+KM+++ +++
Sbjct: 590 WLIGMAEVQKMLEEFKEL 607


>gi|149194059|ref|ZP_01871157.1| oligoendopeptidase F [Caminibacter mediatlanticus TB-2]
 gi|149136012|gb|EDM24490.1| oligoendopeptidase F [Caminibacter mediatlanticus TB-2]
          Length = 579

 Score =  273 bits (697), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 188/549 (34%), Positives = 293/549 (53%), Gaps = 29/549 (5%)

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
           N       + EYE I E IGR  +Y  L +  + S       + ++  +    E+ LI+F
Sbjct: 41  NPDEFIEVLKEYEEIWENIGRALTYIYLEFATDSSKGNFLAKFQELATQA---EEHLIWF 97

Query: 143 ALEIN--TLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
            LE     LD+   +Q +  +    KY  ++ ++++   + LS   E +L         A
Sbjct: 98  ELEFIHLPLDK---QQRFIDNAGVYKY--YLIHLQEEAPYKLSEKEEKILMKKDLTSSSA 152

Query: 201 LKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFIT 260
             R F E I  L+F  + + +   +     +  +R+ RK A  +L+         FSFI 
Sbjct: 153 FVRLFDETISKLKFFFDGEFLSEEEILSKLYSPNRDERKKAQVSLTLGLKPHQDNFSFIY 212

Query: 261 NTLAKDEEIQ-DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKW 319
           N + KD +I     R Y+     RHLSN V    ++AL+ +V N     +  YY++KK  
Sbjct: 213 NQIKKDWKIDYIDIRGYDDPESPRHLSNRVSKKSVDALINAVNNSTFIVA-EYYKIKKNL 271

Query: 320 LKLDTMYFWDRLAPLPGTSQDI-IPFEVARDLVLQSYAKFSPQMSI-IAEKFFTHNWIDA 377
           L  D +Y +DR AP+  T+++  I FE A++LVL +++KFSP     IA+K F   WID 
Sbjct: 272 LGYDKLYDYDRYAPVKLTNKNPEISFEEAKELVLNAFSKFSPTFFYEIAKKAFEERWIDV 331

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
              +GK SGAF+H   P VHPY+LLNY  + +DV TLAHELGH IH  L+ E  G L  +
Sbjct: 332 YPKEGKRSGAFSHSATPKVHPYVLLNYTNQRRDVFTLAHELGHAIHQYLAKEV-GYLNQD 390

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
           + LT AETASIF E L F+  ++ + SKEE   + A K+ED+  ++ RQ+ F +FE ++H
Sbjct: 391 TPLTTAETASIFAEMLLFEE-IKNSLSKEELIEVYAAKLEDIFATLFRQVVFTNFERRVH 449

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
               ++ ++  +  N+IW+E  ++    +  L+   Y  +W  +PHFI S FY YAY++ 
Sbjct: 450 ----NSEELKPNEYNKIWIEENQKMFKDSVYLTK-NYEIWWSYIPHFIHSPFYCYAYSYA 504

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNS----KHYSELLLPLNINLSDPNFWERGL 613
             LV SLY +YK    + F+EKY+  L  G S    K + EL    NI++   +FW +G+
Sbjct: 505 QLLVLSLYKLYKEG-FENFEEKYIKFLSQGGSIPPKKQFLEL---FNIDIEKEDFWNKGI 560

Query: 614 QTVEKMIDD 622
             V++M+++
Sbjct: 561 DVVKEMLNE 569


>gi|222056112|ref|YP_002538474.1| oligoendopeptidase, pepF/M3 family [Geobacter sp. FRC-32]
 gi|221565401|gb|ACM21373.1| oligoendopeptidase, pepF/M3 family [Geobacter sp. FRC-32]
          Length = 594

 Score =  273 bits (697), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 194/600 (32%), Positives = 299/600 (49%), Gaps = 18/600 (3%)

Query: 30  QENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGA 89
           Q+NL  L  W    LYP   S E+ ND +    +++ F+ R+ G +A      +   L  
Sbjct: 3   QKNLDALI-WKTHTLYPGPQSAELENDFQKAPAKAMDFRERYRGKVA----SLDGAGLLQ 57

Query: 90  AIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLAD-FEKVLIFFALEINT 148
           A+ EYE + ELI +   YA L +  + S   + K  +   A+  +   + ++FF LEI  
Sbjct: 58  ALKEYEELEELIVKPQLYAHLLFAAD-SEDEVNKRLSQKAAEFGNQMSREVLFFDLEIIQ 116

Query: 149 LDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCEN 208
           L+E       A D     Y  ++++ RK + H+L    E LL   S  G EA  R F E 
Sbjct: 117 LEEPAF-SVLAADERLANYRHYMESQRKFRPHMLPEREETLLKQKSLTGTEAFSRLFDEV 175

Query: 209 IESLRFKIN----DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLA 264
             S R+K+     +Q++   +           VR+ A         + + +FS + NT+A
Sbjct: 176 SASFRYKLELDGEEQELTGEELLGLLHHPQASVRERAFTVFLKRHEEQAIVFSTVFNTVA 235

Query: 265 KDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDT 324
            D       R Y    +  +L N +   V+  LM   +  YP  +  Y+ +K K LK+D 
Sbjct: 236 LDHGQDQELRSYRHPMEPTNLGNEIPAEVVNRLMSVSEANYP-LAQEYFRIKAKLLKMDR 294

Query: 325 MYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKG 384
           +   D  APL  T++    F+ ARDL L +Y +FSP    +A  FF    +DA    GK 
Sbjct: 295 LKNTDVYAPLGDTTRRYT-FDEARDLALAAYGRFSPAFRDMAAAFFHEGRVDALPRPGKS 353

Query: 385 SGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAE 444
            GAF  G  PS+ PY+LLN+ G  +DV T+AHELGHGIHF L ++ Q ++  ++ L LAE
Sbjct: 354 GGAFCMGMTPSLPPYVLLNFTGNLRDVATIAHELGHGIHFTL-AQHQTMVNYHAPLPLAE 412

Query: 445 TASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTG 504
           TAS+FGE L    LL+  +  + +  LL  +IED++ +  RQ     FE ++H ER++ G
Sbjct: 413 TASVFGEMLLTRHLLEEENDPQVKIALLCAQIEDIIATTFRQNVLTRFEERMHLERQN-G 471

Query: 505 DIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSL 564
            +   R+ E+W E      G A ++ D  Y   W  + HFI + FY Y+Y F   LV SL
Sbjct: 472 LLTATRLCELWWEENARLFGDAVEMID-AYRWGWSYISHFIHARFYCYSYTFAELLVLSL 530

Query: 565 YDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVE 624
           Y  Y S   + F   Y  IL +G S+  +  +    I+LS P+FW+ G   +  ++++++
Sbjct: 531 YQRYLSEG-EAFIPVYREILASGGSRSPANTVRSAGIDLSAPDFWQNGYDVLRDLVENLK 589


>gi|148264112|ref|YP_001230818.1| pepF/M3 family oligoendopeptidase [Geobacter uraniireducens Rf4]
 gi|146397612|gb|ABQ26245.1| oligoendopeptidase, pepF/M3 family [Geobacter uraniireducens Rf4]
          Length = 591

 Score =  271 bits (692), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 188/596 (31%), Positives = 297/596 (49%), Gaps = 23/596 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           WN   LY   +S ++  D E     +  F+ R+ G +A      +   L  A+ EYE + 
Sbjct: 10  WNTAPLYTGPESPDLEGDFEAAATGANGFRERYRGRVAGL----DVVELQKALVEYEELE 65

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADF----EKVLIFFALEINTLDEALL 154
           ELI +   YA L +  +  +   ++    ++ K A+F     + L+FF LEI  +++   
Sbjct: 66  ELIVKPQLYAHLLFAADSENDVNKR----LSQKAAEFGNLMSRELLFFDLEIIQMEDKAF 121

Query: 155 EQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF 214
            Q    + L   Y  +++++RK   H L+   E LL   S  G EA  R F E   S R+
Sbjct: 122 AQLIGDERLA-NYRHYMESLRKFHPHTLTEREESLLKQKSLTGTEAFSRLFDEVSASFRY 180

Query: 215 KIN----DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
            +     +++    +       +D  VR+ A         +   IFS + NT+A D    
Sbjct: 181 TMTLDGEEREFTGEELLGLLHHTDAMVREQAFATFLKRHEEQGIIFSSVFNTVALDHGQD 240

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
              R Y+   +  +L N +   V+E +M   +  YP  +  Y+ LK K L LD +   D 
Sbjct: 241 LELRNYKSPMEPTNLGNEIPAEVVERMMSVSEANYP-LAQEYFRLKAKLLNLDKLKNTDV 299

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
            AP+ G  +    F  ARDLV+ +Y +FSP+   IA  FF    IDA    GK  GAF  
Sbjct: 300 YAPV-GEIEQHYTFAEARDLVIAAYDRFSPEFRDIAAAFFKDGRIDALPRIGKSGGAFCM 358

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
           G  P + PY+LLN+ G  +DV T+AHELGHGIHF L ++ Q ++  ++ L LAETAS+FG
Sbjct: 359 GMTPRLAPYVLLNFTGNLRDVATVAHELGHGIHFTL-AQRQTMVNYHAPLPLAETASVFG 417

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E L    +L+  + K+ +  LL  KIED++ +  RQ     FE ++H ER+  G +   +
Sbjct: 418 EMLLTRHMLEGETDKQVKIALLCAKIEDIIATTFRQNVLTRFEERMHLERKK-GLLTATQ 476

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
           + ++W E      G + ++ +  Y   W  + HFI + FY Y+Y F   LV SLY  Y  
Sbjct: 477 LCDLWWEENARLYGDSVEMIE-AYRWGWSYISHFIHTRFYCYSYTFAELLVLSLYQRYLK 535

Query: 571 NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              D F   Y  IL  G SK  ++ + P  I+L+DP+FW+ G   +  ++++++++
Sbjct: 536 EG-DAFIPTYREILAGGGSKSPADTVRPAGIDLADPDFWQNGYDVLTGLLEELKQL 590


>gi|78222509|ref|YP_384256.1| peptidase M3B, oligoendopeptidase-related clade 3 [Geobacter
           metallireducens GS-15]
 gi|78193764|gb|ABB31531.1| Peptidase M3B, oligoendopeptidase-related clade 3 [Geobacter
           metallireducens GS-15]
          Length = 612

 Score =  269 bits (688), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 188/597 (31%), Positives = 298/597 (49%), Gaps = 26/597 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+ + LY +H + E+  D+     E+ AF+  + G +A      +   L  A+  YE + 
Sbjct: 29  WDTDPLYHAH-APELEADLASGAAETKAFRVAYLGKVA----SLDAAGLLEALRRYEALT 83

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKV----LIFFALEINTLDEALL 154
           EL+ +   YA L +  +  +   +K    ++ + A+F  +    L+FF LEI  + +   
Sbjct: 84  ELLVKPQLYAHLLFAADAGNDEHKK----LSQRTAEFGNLMGRELLFFDLEIMEIPDGGF 139

Query: 155 EQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF 214
            +  A   L   Y  +++++RK K H L+   E LL   +  G EA  R F E   S R+
Sbjct: 140 AEIVADGGLA-GYRHYLESVRKFKPHTLTEREEQLLKLKNLTGAEAFTRLFDELSASFRY 198

Query: 215 KIN----DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
           ++     +++    +        D  VR+ A         +       I NT+A D   +
Sbjct: 199 RMELDGEEREFTGEELLGLLHHPDATVRERAFAIFLRRHEEEGIALGAIFNTVALDHGQE 258

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQ-SVKNYYPKTSHRYYELKKKWLKLDTMYFWD 329
              R Y    +  +L N +   V+  LM  S  NY    +  Y+ LK + L L  +   D
Sbjct: 259 LELRSYRHPMEPTNLGNEIPEEVVNRLMDVSEANY--GLARDYFRLKARLLGLPKLKNTD 316

Query: 330 RLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFA 389
             AP  G +     FE ARDLVL++Y  F P+   I   FF    ID     GKG GAF 
Sbjct: 317 VYAP-AGETDRHYTFEEARDLVLEAYGAFQPRFRDICAAFFAERRIDVLPRPGKGGGAFC 375

Query: 390 HGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIF 449
            G  PS+ PY+LLN+ G  +DV TLAHELGHG+HFVL ++ Q +L  ++ L LAETAS+F
Sbjct: 376 MGMTPSLSPYVLLNFTGNLRDVATLAHELGHGLHFVL-AQKQTMLNYHAPLPLAETASVF 434

Query: 450 GETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTH 509
           GE L    LL+  S  + +  LL  KIED++ +  RQ     FE ++H ER+  G + + 
Sbjct: 435 GEMLLTRFLLERESDPQVKIALLCAKIEDIIATTFRQNVLTRFEERMHKERKE-GLLTSS 493

Query: 510 RINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYK 569
           R+ ++W E   +  G A ++ +  Y   W  + HFI + FY Y+Y F   LV SLY  Y 
Sbjct: 494 RLCDLWWEENGKLYGDAVEMIE-PYRWGWSYISHFIHARFYCYSYTFAELLVLSLYRKYL 552

Query: 570 SNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            +  + F   Y+ IL +G S   ++ + P  I+L+DP+FW++G   + ++I++++ +
Sbjct: 553 EDG-ETFIPTYVGILESGGSLSPADTVKPAGIDLADPHFWQKGYDFLAELIEELKGL 608


>gi|46199470|ref|YP_005137.1| putative oligoendopeptidase F protein [Thermus thermophilus HB27]
 gi|46197096|gb|AAS81510.1| putative oligoendopeptidase F protein [Thermus thermophilus HB27]
          Length = 570

 Score =  266 bits (680), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 187/580 (32%), Positives = 283/580 (48%), Gaps = 20/580 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           WNL+DLY       I  D++     +LA     +G L    + K    L   +  YE+  
Sbjct: 3   WNLDDLYAGPADPRIEEDLKAAL--ALAQGLDPQGLL----DPKGAQDL---LGRYEKAL 53

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           EL  +  +YA L +      P  +     + ++  +    L+   + +  L E   ++  
Sbjct: 54  ELAYKPLNYASLYFATRTQDPEAKTLLDRVRSRFTEVRNRLVPLEVALRKLPEEAFQRLL 113

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
           A  P       ++K  R    H LS   E LL+  + VGR A  +F+ E     RF++ +
Sbjct: 114 AH-PGLADLGHFLKRQRAYAPHTLSEREEELLNLKALVGRSAWSQFYTEYTGRFRFRVGE 172

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD-RWRKYE 277
           +++   +      D D EVR+ A +AL       +   S + N +  D  +QD R R Y 
Sbjct: 173 RELTEMEVRALRRDPDPEVRREAHRALYGKLLAEAPTLSAVFNAVYLDY-LQDLRLRGYR 231

Query: 278 KIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGT 337
              +   L + VE   IEAL+++ K +YP    RYY  K   L  +     D LAPL   
Sbjct: 232 HPLEPVALRDEVEVREIEALLEATKAHYPLVE-RYYRWKAGRLGREKTPSEDLLAPL--G 288

Query: 338 SQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVH 397
            +  +PF  A+ LVL+++ +FSP+++ IA +FF   WID     GK  GAF  G +PS H
Sbjct: 289 EKPKVPFAEAQALVLEAFRRFSPELAEIAREFFEKRWIDVYPRPGKRGGAFCSGGLPSTH 348

Query: 398 PYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDS 457
           PYILLN+        TLAHELGHG+HF L+ + Q +L   +S  LAETAS+F E L  D 
Sbjct: 349 PYILLNHTDDLDSAHTLAHELGHGVHFYLARK-QRLLNFGASTPLAETASVFAEILLDDL 407

Query: 458 LLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLE 517
           LL+  S  EE+ +LLA ++ED +N++ RQ+ +  FE +   E R    +     + +W E
Sbjct: 408 LLERLSG-EEKTLLLAERVEDAINTLFRQVMYTFFEQR-SLEARKEAALSPEAFHALWDE 465

Query: 518 TQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFK 577
            Q+   G A   ++L+  + W  +PHF+   FY Y+YA G  +V +LY  Y+    + F 
Sbjct: 466 EQRRLYGEAVAWTELDRAA-WAGIPHFVHYRFYTYSYALGYLVVLALYGKYREEG-EAFV 523

Query: 578 EKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
            KYL IL AG S    E+L    + L    F+  G   +E
Sbjct: 524 PKYLRILEAGESASPKEILAEAGVELGSEAFFRYGFGVLE 563


>gi|55981501|ref|YP_144798.1| oligoendopeptidase F [Thermus thermophilus HB8]
 gi|55772914|dbj|BAD71355.1| oligoendopeptidase F [Thermus thermophilus HB8]
          Length = 570

 Score =  266 bits (679), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 188/580 (32%), Positives = 282/580 (48%), Gaps = 20/580 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L DLY       I  D+E     +LA     +G L    + K    L   +  YE+  
Sbjct: 3   WDLSDLYSGPQDPRILQDLEAAL--ALAQGLDPQGLL----DPKGAQDL---LERYEKAL 53

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           EL  +  +YA L +      P  +     + ++  +    L+   + +  L E   ++  
Sbjct: 54  ELAYKPLNYASLYFATRTQDPEAKALLDRVRSRFTEVRNRLVPLEVALRKLPEEAFQRLL 113

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
           A  P       ++K  R    H LS   E LL+  + VGR A  +F+ E     RF++ +
Sbjct: 114 AH-PGLADLGHFLKRQRAYAPHTLSEREEELLNLKALVGRSAWSQFYTEYTGRFRFRVGE 172

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD-RWRKYE 277
           +++   +      D D EVR+ A +AL       +   S + N +  D  +QD R R Y 
Sbjct: 173 RELTEMEVRALRRDPDPEVRREAHRALYGKLLAEAPTLSAVFNAVYLDY-LQDLRLRGYR 231

Query: 278 KIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGT 337
              +   L + VE   IEAL+++ K +YP    RYY  K   L  +     D LAPL   
Sbjct: 232 HPLEPVALRDEVEVREIEALLEATKAHYPLVE-RYYRWKAGRLGREKTPSEDLLAPL--G 288

Query: 338 SQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVH 397
            +  +PF  AR LVL+++ +FSP+++ IA +FF   WID     GK  GAF  G +PS H
Sbjct: 289 EKPKVPFAEARALVLEAFRRFSPELAEIAREFFEKRWIDVYPRPGKRGGAFCSGGLPSTH 348

Query: 398 PYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDS 457
           PYILLN+        TLAHELGHG+HF L+ + Q +L   +S  LAETAS+F E L  D 
Sbjct: 349 PYILLNHTDDLDSAHTLAHELGHGVHFYLARK-QRLLNFGASTPLAETASVFAEILLDDL 407

Query: 458 LLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLE 517
           LL+  S  EE+ +LLA ++ED +N++ RQ+ +  FE +   E R    +     + +W E
Sbjct: 408 LLERLSG-EEKTLLLAERVEDAINTLFRQVMYTFFEQR-SLEARKEAALSPEAFHALWDE 465

Query: 518 TQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFK 577
            Q+   G A   ++L+  + W  +PHF+   FY Y+YA G  +V +LY  Y+    + F 
Sbjct: 466 EQRRLYGEAVAWTELDRAA-WAGIPHFVHYRFYTYSYALGYLVVLALYGKYREEG-EAFV 523

Query: 578 EKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
            KYL IL AG S    E+L    + L    F+  G   +E
Sbjct: 524 PKYLRILEAGESASPKEILAEAGVELGSEAFFRYGFGVLE 563


>gi|322418683|ref|YP_004197906.1| oligoendopeptidase, pepF/M3 family [Geobacter sp. M18]
 gi|320125070|gb|ADW12630.1| oligoendopeptidase, pepF/M3 family [Geobacter sp. M18]
          Length = 588

 Score =  264 bits (674), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 181/593 (30%), Positives = 294/593 (49%), Gaps = 17/593 (2%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+   LYPS  + E++   E    +  AF+ R+ G +A    +    SL  A+ EYE++ 
Sbjct: 7   WDTTPLYPSPSAPELTRAFEDATAQVAAFRERYRGKVA----ELPADSLLEALKEYEKLQ 62

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           E + +   Y+ L +  +  S   ++             + L+FF LEI  ++E    +  
Sbjct: 63  EELAKPQLYSHLLFAADSESDLHKRLSQKSEEFGNAMGRELLFFDLEIIQMEEEPF-RKL 121

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIN- 217
            Q+ L   Y  ++  +RK KKH LS   E LL+  S  G +A  R F E   SLR+ ++ 
Sbjct: 122 VQESLLDNYRHFLMVLRKFKKHTLSEREESLLTQKSLTGVQAFCRLFDEVSASLRYTLDM 181

Query: 218 ---DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWR 274
               +++   +          E+R+ A         + S +FS + N +A D   +   R
Sbjct: 182 EGETREMTGEELLALLHHPSAELRERAFGTFLKKHEEHSILFSAVFNNVALDHSQEMELR 241

Query: 275 KYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPL 334
            Y+   +  +L N +   V+E+LMQ  +  YP  +  Y+ LK + L +  +   D  AP+
Sbjct: 242 SYDHPMEPTNLGNEIPNEVVESLMQVSEKNYP-LAQEYFRLKARLLGIPRLKNTDVYAPI 300

Query: 335 PGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIP 394
               +    F  AR + +++Y  FS + + +A+ FFT   +D     GK  GAF  G  P
Sbjct: 301 SEGDRKY-SFAEARAMTVEAYRGFSEEFAQLADSFFTGKRVDVMPRPGKSGGAFCMGMTP 359

Query: 395 SVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLT 454
           S+ PY+LLN+ G  +DV T+AHE+GHGIH+ L ++ Q +L  +  L LAETAS+FGE L 
Sbjct: 360 SLPPYLLLNFTGNLRDVATIAHEVGHGIHYQL-AQRQTMLNYHPPLPLAETASVFGEMLL 418

Query: 455 FDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEI 514
              LL+  +  E +K LL  KIED++ +  RQ     FE ++H E R+ G +    + ++
Sbjct: 419 TRQLLERETDVEVKKSLLCAKIEDIIATTFRQNVLTRFEERMHLE-RANGLLTASELADL 477

Query: 515 WLETQKESLGPAFDLSD-LEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTV 573
           W +   +  G A ++ +   YG  W  + HFI + FY Y+Y     +V SL+  Y     
Sbjct: 478 WWQENAKLYGDAVEMIEPYRYG--WSYISHFIHARFYCYSYTCAELVVLSLFQRYLKER- 534

Query: 574 DCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           + F   Y NIL  G SK   + L P  I  SDP+FW+ G   +  +I++++ +
Sbjct: 535 ESFVPIYRNILADGGSKSPGDTLAPAGIVFSDPSFWQGGYDLLGDLINELKAL 587


>gi|163736071|ref|ZP_02143494.1| oligoendopeptidase F, putative [Roseobacter litoralis Och 149]
 gi|161390667|gb|EDQ15013.1| oligoendopeptidase F, putative [Roseobacter litoralis Och 149]
          Length = 368

 Score =  263 bits (673), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 144/369 (39%), Positives = 205/369 (55%), Gaps = 15/369 (4%)

Query: 23  DMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           D     + + LG+LP WNL+DLY   D+ E+  D++ +E    +F   +EGNL       
Sbjct: 10  DANASGAADPLGDLPEWNLDDLYTGEDAPELKRDLDWLEQACASFAADYEGNL------- 62

Query: 83  NCHSLGAA-----IAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEK 137
              SL AA     +   E+I ++ GRI SYA L Y    +     KF +D+  K+ +F  
Sbjct: 63  --ESLDAAGFLECVLRNEKISQIAGRIMSYAGLRYYQLTTDAGRAKFMSDLQEKITNFTT 120

Query: 138 VLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVG 197
            L+FF LEIN L +  L++ YAQ+    +Y      IR +K + LS+++E  L D   VG
Sbjct: 121 PLVFFTLEINRLADDHLDRLYAQNGDLARYKPIFDRIRAMKPYQLSDELEKFLHDLGVVG 180

Query: 198 REALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
            +A +R F E I  L F+++ + + +  A     D +R  R++AA+ L+  F  +   F+
Sbjct: 181 -DAWERLFDETIAGLEFEVDGEALNIEGALNLLTDPERPKREAAARELADVFGSNVKTFA 239

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
            + NT AK++EI DRWR  E     RHLSN VEP V+EAL  +V   YPK SHRYYELK+
Sbjct: 240 RVHNTQAKEKEIVDRWRGMESPQQGRHLSNQVEPEVVEALRNAVVKSYPKLSHRYYELKR 299

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           KWL LD M  WDR APLP     I+ ++ A+ +V+ +Y  F P+M  IA  FF+  WIDA
Sbjct: 300 KWLGLDKMQVWDRNAPLPLEDNRIVGWDQAQSMVMDAYTAFDPRMGEIAAPFFSKGWIDA 359

Query: 378 PQYDGKGSG 386
               GK  G
Sbjct: 360 GVKPGKAPG 368


>gi|118579806|ref|YP_901056.1| pepF/M3 family oligoendopeptidase [Pelobacter propionicus DSM 2379]
 gi|118502516|gb|ABK98998.1| oligoendopeptidase, pepF/M3 family [Pelobacter propionicus DSM
           2379]
          Length = 589

 Score =  263 bits (672), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 184/592 (31%), Positives = 288/592 (48%), Gaps = 15/592 (2%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           WN   LYP+ DS E+  D+   +  +  F+ R+   +A    Q    SL  A+ EYE + 
Sbjct: 8   WNTALLYPAPDSAELEADLGSFDALAADFRERYFEKIA----QLQPSSLLEAVREYEALQ 63

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
             + +   YA L +  + S+ T        +   +   + L+FF LE+  LD+A   Q+ 
Sbjct: 64  VRMAKPFCYAHLLFAADSSNETTLSLSQRCSELGSRLSQQLLFFDLELMNLDDAPF-QAL 122

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF--KI 216
              P    Y  ++  IRK + + L  + E LL+  +  G  A  R F E   SLR+  ++
Sbjct: 123 CSLPQAAPYVHFLNGIRKFRPYTLKENEERLLTRKNLTGVSAFTRLFDELSASLRYSMEL 182

Query: 217 NDQKIPLT--KAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWR 274
           + Q    T  +        D +VR  A         ++  +F+ + N +A D   +   R
Sbjct: 183 DGQVREFTGEELLSLLHHHDPDVRFRAMTTFLEKHGQNGIVFNAVFNNMALDHGQEMELR 242

Query: 275 KYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPL 334
            Y       ++ N +    +E LM   +  Y   +  Y+ LK   L ++ +   D  APL
Sbjct: 243 GYSSPIQPTNIGNEIPDEAVEHLMAVTEANY-GLAQEYFRLKAGLLGMEKIRNCDIYAPL 301

Query: 335 PGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIP 394
              S+    F+ ARDLV+ SY  +  +   I   FFT   +D     GK  GAFA G  P
Sbjct: 302 -AESRKSYEFDEARDLVVASYGAYDAEFGRIVADFFTERRVDVMPRPGKSGGAFAMGISP 360

Query: 395 SVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLT 454
              P++LLN+ G  +D+ T+AHE GHG+HFVL S+ Q +L  ++ L LAETAS+FGE L 
Sbjct: 361 QTPPFLLLNFTGTLRDLATIAHEAGHGLHFVL-SQKQNMLNYHAPLPLAETASVFGEMLL 419

Query: 455 FDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEI 514
              LL + S    RK LL  KIED++ +  RQ     FEL+LHTE RS G +   R++ I
Sbjct: 420 TRRLLDSESDPLLRKSLLCAKIEDIIATTFRQTVLTRFELRLHTE-RSKGLLTNDRVSRI 478

Query: 515 WLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVD 574
           WLE  ++  G A ++    Y   W  + HFI S FY Y+Y F   LV +L+  Y     +
Sbjct: 479 WLEENEKLFGNAVEMIP-AYSWGWSYISHFIHSRFYCYSYTFAELLVLALFQNY-CEKGE 536

Query: 575 CFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            FK  Y ++L +G +   +E      I+++  +FW++G   +  +I +++ +
Sbjct: 537 SFKPGYRSLLESGGALSPTETARLAGIDITAGDFWQKGYDFLGGLIQELKAV 588


>gi|39996971|ref|NP_952922.1| oligoendopeptidase F [Geobacter sulfurreducens PCA]
 gi|39983859|gb|AAR35249.1| oligoendopeptidase F [Geobacter sulfurreducens PCA]
          Length = 596

 Score =  263 bits (671), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 183/597 (30%), Positives = 297/597 (49%), Gaps = 25/597 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+   LY S   ++I  D+     E+ AF+ R+ G +A      +   +  A+  YE + 
Sbjct: 10  WDTSPLYASATCEDIDRDLSRGAAEAQAFRERYAGKVA----TLDAAEVADAVRRYEDLG 65

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADF----EKVLIFFALEINTLDEALL 154
           EL+ +   YA L +  +  +   ++    ++ + A+F     + L+FF LEI  + +   
Sbjct: 66  ELLAKPQLYAHLLFAADSEADDHKR----LSQRTAEFGNLMSRELLFFDLEIMEIADDRF 121

Query: 155 EQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF 214
                 D L   Y  +++++R+ + + L    E LL   S  G +A  R F E   SLR+
Sbjct: 122 -AGLLSDELLAPYRHYLESVRRFRPYTLKEREEQLLKMKSLTGTDAFSRLFDELSASLRY 180

Query: 215 KIN----DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
           ++     ++     +        +  VR+ A     +   ++  +FS + N +A D   +
Sbjct: 181 RMELEGEERDFTGEELLGLLHHPEAGVRERAFATFLNRHEENGIVFSSVFNNVALDHSQE 240

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQ-SVKNYYPKTSHRYYELKKKWLKLDTMYFWD 329
              R Y    +  +L N++   V+  LM  S  NY    +  Y+ LK + L L  +   D
Sbjct: 241 LELRGYRHPMEPTNLGNDIPEEVVNRLMDVSEANY--GLARDYFRLKARLLGLPKLKNTD 298

Query: 330 RLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFA 389
             AP+ G +     F+ AR+LVL++Y +F P+   +A  FF    ID     GK  GAF 
Sbjct: 299 VYAPV-GDNDRTYSFDEARELVLEAYGRFHPRFGEMAAAFFDERRIDVLPRPGKSGGAFC 357

Query: 390 HGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIF 449
            G  P + PY+LLNY G  +DV TLAHELGHG+HF L+ + Q +L  ++ L LAETAS+F
Sbjct: 358 MGMTPHLSPYLLLNYTGNLRDVATLAHELGHGLHFELARK-QTMLNYHAPLPLAETASVF 416

Query: 450 GETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTH 509
           GE L    LLQ  S    +  LL  KIED++ +  RQ     FE ++H ER+  G + + 
Sbjct: 417 GEMLLTRFLLQRESDPAMKISLLCAKIEDIIATTFRQNVLTRFEERMHRERQE-GLLTSS 475

Query: 510 RINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYK 569
           R+ ++W E      G A D+    Y   W  + HFI + FY Y+Y F   LV SLY  Y 
Sbjct: 476 RLCDLWWEENGRLYGDAVDMIP-PYRWGWSYISHFIHARFYCYSYTFAELLVLSLYRNYL 534

Query: 570 SNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
               + F   YL+IL +G S   ++ + P  I+L+DP+FW++G   + ++I++++ +
Sbjct: 535 EQG-ERFIPTYLSILESGGSLSPADTVRPAGIDLADPHFWQKGYDFLAELIEELKGL 590


>gi|218295692|ref|ZP_03496488.1| oligoendopeptidase, pepF/M3 family [Thermus aquaticus Y51MC23]
 gi|218243851|gb|EED10378.1| oligoendopeptidase, pepF/M3 family [Thermus aquaticus Y51MC23]
          Length = 570

 Score =  262 bits (670), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 189/586 (32%), Positives = 285/586 (48%), Gaps = 26/586 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAA---IAEYE 95
           W+L DLY S +   I  D+E     +LA        LA   + K+  S   A   ++ YE
Sbjct: 3   WDLSDLYASPEDPRIFQDLEA----ALA--------LAQGLDPKDLLSPEGASSLLSRYE 50

Query: 96  RICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLE 155
           +  EL  +  +YA L +      P  +     +     +    L+   + +  L E    
Sbjct: 51  KALELAYKPLNYASLYFATRTQDPGAKALLDRVRNAFTEVRNRLVPLEVALRKLPEEAF- 109

Query: 156 QSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFK 215
           Q+    P  L    ++   R    + LS   E LL+  + VGR A  +F+ E     RF 
Sbjct: 110 QALLSHPGLLDLRHFLMRQRAYAPYTLSEREEELLNLKALVGRSAWSQFYTEYTGRFRFL 169

Query: 216 INDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD-RWR 274
           +  +++   +      D D EVR+ A +AL     + +   S + N +  D  +QD R R
Sbjct: 170 VRGKELTEMEVRALRRDPDPEVRREAHQALYGKLLEEAPTLSAVFNAVYLDY-LQDLRLR 228

Query: 275 KYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPL 334
            Y    +   L + VE   IEAL+++ +++YP    RYY  K K L  +     D LAPL
Sbjct: 229 GYGNPLEPVALRDEVEVRDIEALLEATESFYPLV-ERYYLWKAKKLGQEKTPSQDLLAPL 287

Query: 335 PGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIP 394
               +  +PFE A+ LVL+++ +FSP++  IA +FF   WID     GK  GAF  G +P
Sbjct: 288 --GEKPKVPFEEAKALVLEAFRRFSPEVEAIAREFFERRWIDVYPRPGKRGGAFCSGGLP 345

Query: 395 SVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLT 454
           S HPY+LLN+        TLAHELGHG+HF L+ E Q +L   +S  LAETAS+F E L 
Sbjct: 346 STHPYVLLNHTDDLDSAHTLAHELGHGVHFYLARE-QRLLNFGASTPLAETASVFAEILL 404

Query: 455 FDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEI 514
            D LL+  S  EER +LLA ++ED +N++ RQ+ +  FE +    R+     P     +I
Sbjct: 405 DDLLLERLSG-EERTLLLAERVEDAINTLFRQVMYTFFEKRSLLARKEAALSP-EAFQKI 462

Query: 515 WLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVD 574
           W E Q    G +   ++L+  S W  +PHF+   FY Y+YA G  +V +LY  Y+    +
Sbjct: 463 WQEEQARLYGESVAWTELD-QSAWAGIPHFVHYRFYTYSYALGYLVVLALYGRYREEG-E 520

Query: 575 CFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMI 620
            F  +YL +L+AG      E+L    + L+   F+  G   +E  I
Sbjct: 521 AFVPRYLEVLKAGEKASPKEILAQAGVELASEAFFRYGFGVLEDWI 566


>gi|298505988|gb|ADI84711.1| oligoendopeptidase F [Geobacter sulfurreducens KN400]
          Length = 596

 Score =  262 bits (669), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 183/597 (30%), Positives = 296/597 (49%), Gaps = 25/597 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+   LY S   ++I  D+     E+ AF+ R+ G +A      +   +  A+  YE + 
Sbjct: 10  WDTSPLYASATCEDIDRDLSRGAAEAQAFRERYAGKVA----TLDAAEVADAVRRYEDLG 65

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADF----EKVLIFFALEINTLDEALL 154
           EL+ +   YA L +  +  +   ++    ++ + A+F     + L+FF LEI  + +   
Sbjct: 66  ELLAKPQLYAHLLFAADSEADDHKR----LSQRTAEFGNLMSRELLFFDLEIMEIADDRF 121

Query: 155 EQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF 214
                 D L   Y  +++++R+ + + L    E LL   S  G +A  R F E   SLR+
Sbjct: 122 -AGLLSDELLAPYRHYLESVRRFRPYTLKEREEQLLKMKSLTGTDAFSRLFDELSASLRY 180

Query: 215 KIN----DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
           ++     ++     +        +  VR+ A     +   ++  +FS + N +A D   +
Sbjct: 181 RMELEGEERDFTGEELLGLLHHPEAGVRERAFATFLNRHEENGIVFSSVFNNVALDHSQE 240

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQ-SVKNYYPKTSHRYYELKKKWLKLDTMYFWD 329
              R Y    +  +L N +   V+  LM  S  NY    +  Y+ LK + L L  +   D
Sbjct: 241 LELRGYRHPMEPTNLGNEIPEEVVNRLMDVSEANY--GLARDYFRLKARLLGLPKLKNTD 298

Query: 330 RLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFA 389
             AP+ G +     F+ AR+LVL++Y +F P+   +A  FF    ID     GK  GAF 
Sbjct: 299 VYAPV-GDNDRTYSFDEARELVLEAYGRFHPRFGEMAAAFFDERRIDVLPRPGKSGGAFC 357

Query: 390 HGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIF 449
            G  P + PY+LLNY G  +DV TLAHELGHG+HF L+ + Q +L  ++ L LAETAS+F
Sbjct: 358 MGMTPHLSPYLLLNYTGNLRDVATLAHELGHGLHFELARK-QTMLNYHAPLPLAETASVF 416

Query: 450 GETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTH 509
           GE L    LLQ  S    +  LL  KIED++ +  RQ     FE ++H ER+  G + + 
Sbjct: 417 GEMLLTRFLLQRESDPAMKISLLCAKIEDIIATTFRQNVLTRFEERMHRERQE-GLLTSS 475

Query: 510 RINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYK 569
           R+ ++W E      G A D+    Y   W  + HFI + FY Y+Y F   LV SLY  Y 
Sbjct: 476 RLCDLWWEENGRLYGDAVDMIP-PYRWGWSYISHFIHARFYCYSYTFAELLVLSLYRNYL 534

Query: 570 SNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
               + F   YL+IL +G S   ++ + P  I+L+DP+FW++G   + ++I++++ +
Sbjct: 535 EQG-ERFIPTYLSILESGGSLSPADTVRPAGIDLADPHFWQKGYDFLAELIEELKGL 590


>gi|189425052|ref|YP_001952229.1| oligoendopeptidase, pepF/M3 family [Geobacter lovleyi SZ]
 gi|189421311|gb|ACD95709.1| oligoendopeptidase, pepF/M3 family [Geobacter lovleyi SZ]
          Length = 592

 Score =  259 bits (663), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 179/594 (30%), Positives = 288/594 (48%), Gaps = 17/594 (2%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           WN   LYP+ DS E+  D+   +  +  F+ ++   +A  +       +  A++EYE + 
Sbjct: 8   WNTALLYPAPDSPELEADLASFDQLAADFRAQYFEKIATLSPS----DILKALSEYEAMQ 63

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
             + +   Y+ L +  +  +   R      +   +   + L+FF LE+  L + L  Q  
Sbjct: 64  TRMAKPFCYSHLLFASDSGNEIHRALSQRCSELGSRLSQALLFFDLELMNLPDDLFSQVC 123

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIN- 217
           +  P    Y  +++ IRK K + L  + E LL+     G  A  + F E   SL +++  
Sbjct: 124 SL-PGASGYVHFLEGIRKFKPYTLQENEERLLTRKDLTGSRAFTKLFDELSASLTYQMEF 182

Query: 218 ---DQKIPLTKAYKSFFDSDREVRKSAAKAL--SHTFNKSSHIFSFITNTLAKDEEIQDR 272
               ++    +          EVR +A       H  + ++ +F  + NT+A D   +  
Sbjct: 183 EGEVKEFTGEELLSLLHHPSAEVRFNAQTCFLEKHAESGNALVFGTVFNTMALDHGQEME 242

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
            R Y+      ++ N +    +E LMQ+ +  Y   +  Y+ LK K L +D +   D  A
Sbjct: 243 LRGYQSAIQPTNIGNELTDEAVEHLMQTTEANY-GLAQEYFRLKAKMLGMDKIRNCDVYA 301

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           P+   +Q    F+ ARDL + +Y  + PQ   I + FF    +D     GK  GAFA G 
Sbjct: 302 PV-AEAQKKYEFDEARDLTVAAYRNYDPQFGDIIKAFFDERRVDVMPRQGKSGGAFAMGI 360

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
            P   P++LLN+    +D+ T+AHE GHG+HFVL S+ Q  L  ++ L LAETAS+FGE 
Sbjct: 361 SPVDPPFLLLNFTNNLRDIATIAHEAGHGLHFVL-SQKQNSLNYHAPLPLAETASVFGEM 419

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           L    LL   +  E RK LL  KIED++ +  RQ     FEL+LH ER+  G +   RI+
Sbjct: 420 LLTRMLLDTETDPEVRKSLLCAKIEDIIATTFRQTVLTRFELRLHQERQQ-GLLSNERIS 478

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
           +IWLE   +  G A ++    Y   W  + HFI S FY Y+Y F   LV +LY  Y+  T
Sbjct: 479 QIWLEENSKLFGDAVEMIP-AYQWGWSYISHFIHSRFYCYSYTFAELLVLALYQQYR-ET 536

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            D FK  Y  +L +G +   ++      I++    FW++G   +E +I++++ M
Sbjct: 537 GDAFKPGYRALLESGGALSPADTAKLAGIDIESSGFWQKGHDFLEGLIEELKAM 590


>gi|197117683|ref|YP_002138110.1| oligoendopeptidase, pepF/M3 family [Geobacter bemidjiensis Bem]
 gi|197087043|gb|ACH38314.1| oligoendopeptidase, pepF/M3 family [Geobacter bemidjiensis Bem]
          Length = 588

 Score =  259 bits (661), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 179/593 (30%), Positives = 292/593 (49%), Gaps = 17/593 (2%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+   LYP+  + E++   E    +  AF+ R+ G +A    + +   L  A+ +YE + 
Sbjct: 7   WDTTPLYPAPSAPELARAFEEGTGQVAAFRERYRGKVA----ELDAEGLLEALKQYESLQ 62

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           E +     YA L +  +  S   ++             + LIFF LE+  ++E    +  
Sbjct: 63  EKLATPQLYAHLLFAADSESDEHKRLSQKAEEFGNAMGRELIFFDLELIQMEEEPFAK-L 121

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIN- 217
           A D L   Y  +++ +RK KKH L+   E LL+  S  G +A  R F E   SLR+ +  
Sbjct: 122 ADDLLLENYRHYLQVLRKFKKHTLTEREESLLAQKSLTGVQAFCRLFDEVSASLRYTLEM 181

Query: 218 ---DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWR 274
               +++   +        D  +R+ A         ++  +FS + N +A D   +   R
Sbjct: 182 EGETREMTGEELLALLHHPDTGLRERAFGTFLKRHEENGIMFSAVFNNVALDHSQELELR 241

Query: 275 KYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPL 334
            Y    +  +L N +   V+E+LM+  +  YP  +  Y+ LK + L +  +   D  AP+
Sbjct: 242 NYSHPMEPTNLGNEIPNEVVESLMRVSEENYP-LAQEYFRLKAQLLGIPRLKNTDVYAPI 300

Query: 335 PGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIP 394
              S     FE AR + + +Y  FS + + +A+ FFT   +D     GK  GAF  G IP
Sbjct: 301 -SESDRKYSFEEARAMTVAAYRGFSDEFAELADSFFTGKRVDVLPRPGKSGGAFCMGMIP 359

Query: 395 SVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLT 454
           S+ PY+LLN+ G  +DV T+AHE+GHGIH++L ++ Q +L  +  L LAETAS+FGE L 
Sbjct: 360 SLPPYLLLNFTGNLRDVSTMAHEVGHGIHYLL-AQRQSMLNYHPPLPLAETASVFGEMLL 418

Query: 455 FDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEI 514
              LL+  +  E +K LL  KIED++ +  RQ     FE ++H E R+ G +    + ++
Sbjct: 419 TRQLLEQETDVEVKKSLLCAKIEDIIATTFRQNVLTSFEERMHLE-RANGLLTASELCDM 477

Query: 515 WLETQKESLGPAFDLSD-LEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTV 573
           W +   +  G A ++ +   YG  W  + HFI + FY Y+Y     +V SL+  Y     
Sbjct: 478 WWQENAKLYGDAVEMIEPYRYG--WSYISHFIHARFYCYSYTCAELVVLSLFQRYLKER- 534

Query: 574 DCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           + F   Y +IL  G SK   + L P  I  SDP+FW+ G   +  +I +++ +
Sbjct: 535 ESFVPVYRDILADGGSKSPGDTLAPGGIVFSDPSFWQGGYDLLGDLIKELKAL 587


>gi|320450924|ref|YP_004203020.1| oligoendopeptidase F [Thermus scotoductus SA-01]
 gi|320151093|gb|ADW22471.1| oligoendopeptidase F [Thermus scotoductus SA-01]
          Length = 574

 Score =  257 bits (657), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 184/583 (31%), Positives = 281/583 (48%), Gaps = 25/583 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAA---IAEYE 95
           W+L DLY S +   +  D+     E+L        NLA + + K       A      YE
Sbjct: 6   WDLSDLYLSPEDPNLERDLA----EAL--------NLASSLDPKGLLHPSQAEGLFRRYE 53

Query: 96  RICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLE 155
              E   +  +YA L +      P  +     +  +  +    L+   + +  L E    
Sbjct: 54  EALEKAYKPLNYASLYFATRTQDPVAKALLDRVRNRYTEVRNRLVPLEVALRKLPEEAF- 112

Query: 156 QSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFK 215
           Q+  + P       +++  R    H LS   E LL+    VGR A  +F+ E     RF+
Sbjct: 113 QALLEHPGLADLRHFLQRQRAFAPHTLSEREEELLNLKGLVGRSAWSQFYTEYTGRFRFR 172

Query: 216 INDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD-RWR 274
           + ++++   +      D D +VR+ A + L       +   S + N +  D  +QD R R
Sbjct: 173 VGERELTEMEVRALRRDPDPKVRREAHRELYGKLMAEAPTLSAVFNAVFLDY-LQDLRLR 231

Query: 275 KYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPL 334
            Y    +   L + VE   IEAL+++ + +YP     YY  K + L L+     D LAPL
Sbjct: 232 GYHHPLEPVALRDEVEVKDIEALLEATQAHYPLVEA-YYRWKARRLGLEKTPSPDLLAPL 290

Query: 335 PGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIP 394
               +  +PFE A+DLVL ++ +FSP++  IA +FF   WID     GK  GAF  G +P
Sbjct: 291 -AKEKPKVPFEEAQDLVLTAFHRFSPEVGRIAREFFEKRWIDVYPRPGKRGGAFCSGGLP 349

Query: 395 SVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLT 454
           S HPY+LLN+        TLAHELGHG+HF L+ + Q +L   +S  LAETAS+F E + 
Sbjct: 350 STHPYVLLNHTDDLDAAHTLAHELGHGVHFYLARK-QRLLNFGASTPLAETASVFAE-IL 407

Query: 455 FDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEI 514
            D+LL    S EER +LLA ++ED + ++ RQ+ +  FE +    RR     P    + I
Sbjct: 408 LDNLLLERLSPEERTLLLAERVEDAIGTLFRQVMYTFFERRSLEARREAALSP-EAFHGI 466

Query: 515 WLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVD 574
           W E Q    G A + ++L+  + W  +PHF+   FY Y+YA G  +V +LY  Y+     
Sbjct: 467 WQEEQGRLYGDAVEWTELDQAA-WAGIPHFVHFRFYTYSYALGYLVVLALYGKYQEEG-K 524

Query: 575 CFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
            F  KYL IL AG S+   E+L    ++L+   F++ G   +E
Sbjct: 525 AFVPKYLGILEAGESQSPKEILAQAGVDLASEAFFQYGFGVLE 567


>gi|253701586|ref|YP_003022775.1| oligoendopeptidase [Geobacter sp. M21]
 gi|251776436|gb|ACT19017.1| oligoendopeptidase, pepF/M3 family [Geobacter sp. M21]
          Length = 588

 Score =  256 bits (653), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 179/593 (30%), Positives = 292/593 (49%), Gaps = 17/593 (2%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+   LYP+  + E++   E    +  AF+ R+ G ++      +   L  A+ +YE + 
Sbjct: 7   WDTTPLYPAPSAPELTRAFEEAMGQVAAFRERYRGKVSAL----DAGGLLEALKQYESLQ 62

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           E +     YA L +  +  +   ++             + LIFF LE+  ++E    +  
Sbjct: 63  EKLATPQLYAHLLFAADSENDEHKRLAQKAEEFGNAMGRELIFFDLELIQMEEEPFAK-L 121

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLR--FKI 216
           A D L   Y  +++ +RK KKH L+   E LL+  S  G +A  R F E   SLR  F++
Sbjct: 122 ADDLLLDNYRHYLQVLRKFKKHTLTEREESLLAQKSLTGVQAFCRLFDEVSASLRYTFEM 181

Query: 217 NDQKIPLT--KAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWR 274
             +   +T  +        D  +R+ A         ++  +FS + N +A D   +   R
Sbjct: 182 EGETREMTGEELLALLHHPDAGLRERAFGTFLKRHEENGIMFSAVFNNVALDHSQEMELR 241

Query: 275 KYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPL 334
            Y    D  +L N +   V+E+LM+  +  YP  +  Y+ LK + L +  +   D  AP+
Sbjct: 242 NYSHPMDPTNLGNEIPNEVVESLMRVSEENYP-LAQEYFRLKAQLLGIPRLKNTDVYAPI 300

Query: 335 PGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIP 394
             + +    FE AR + + +Y  FS + + +A+ FFT   +D     GK  GAF  G IP
Sbjct: 301 TESDRKY-SFEEARAMTVAAYRGFSDEFAELADSFFTGKRVDVLPRPGKSGGAFCMGMIP 359

Query: 395 SVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLT 454
           S+ PY+LLN+ G  +DV T+AHE+GHGIH++L ++ Q +L  +  L LAETAS+FGE L 
Sbjct: 360 SLPPYLLLNFTGNLRDVSTMAHEVGHGIHYLL-AQRQSMLNYHPPLPLAETASVFGEMLL 418

Query: 455 FDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEI 514
              LL+  +  E +K LL  KIED++ +  RQ     FE ++H E R+ G +    + ++
Sbjct: 419 TRQLLEQETDVEVKKSLLCAKIEDIIATTFRQNVLTRFEERMHLE-RANGLLTATELCDM 477

Query: 515 WLETQKESLGPAFDLSD-LEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTV 573
           W +   +  G A ++ +   YG  W  + HFI + FY Y+Y     +V SL+  Y     
Sbjct: 478 WWQENAKLYGDAVEMIEPYRYG--WSYISHFIHARFYCYSYTCAELVVLSLFQRYLKER- 534

Query: 574 DCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           + F   Y  IL  G SK   + L P  I  SDP+FW+ G   +  +I +++ +
Sbjct: 535 ESFVPVYRGILADGGSKSPGDTLAPGGIVFSDPSFWQGGYDLLGDLIKELKAL 587


>gi|23008148|ref|ZP_00049713.1| COG1164: Oligoendopeptidase F [Magnetospirillum magnetotacticum
           MS-1]
          Length = 223

 Score =  251 bits (642), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 121/225 (53%), Positives = 156/225 (69%), Gaps = 4/225 (1%)

Query: 402 LNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQA 461
           +NY GKP+DVMTLAHELGHG+H VL++   G L   + LTLAETAS+FGE LTF  LL  
Sbjct: 1   MNYQGKPRDVMTLAHELGHGVHQVLAA-GNGALMAPTPLTLAETASVFGEMLTFRRLLAG 59

Query: 462 ASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKE 521
            +   +R+ +LA K+EDM+N++VRQI+FY FE K+H   R+ G++   +INE+W+  Q E
Sbjct: 60  TTDPVQRRAMLAAKVEDMINTVVRQIAFYSFERKVHLA-RAKGELTAEQINELWMSVQSE 118

Query: 522 SLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYL 581
           SLGPA  L D  Y  FW  +PHFI S FYVYAYAFG+CLVNSLY +Y +     F E+Y 
Sbjct: 119 SLGPAIAL-DKGYEPFWAYIPHFIHSPFYVYAYAFGDCLVNSLYGVY-ARAEPGFVERYF 176

Query: 582 NILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            +L AG SK Y ELL P  ++ SDP FW+ GL  +E MI ++E M
Sbjct: 177 ALLSAGGSKPYGELLKPFGLDASDPGFWQIGLGMIEDMIAELEAM 221


>gi|302038521|ref|YP_003798843.1| putative oligoendopeptidase F [Candidatus Nitrospira defluvii]
 gi|300606585|emb|CBK42918.1| putative Oligoendopeptidase F [Candidatus Nitrospira defluvii]
          Length = 605

 Score =  248 bits (633), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 153/536 (28%), Positives = 284/536 (52%), Gaps = 15/536 (2%)

Query: 95  ERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALL 154
           E+I    GR+ +YA L ++ +      R F T +  +L   +  L+FF L   ++D+   
Sbjct: 77  EQIARESGRLGAYAYLWFSEDTKQLQARSFKTKVEEQLTALQNHLLFFDLWWQSVDQRNA 136

Query: 155 EQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFF--CENIESL 212
           E+  A       +   ++ IR+ K H LS   E +++  +  G+ A+ + +    N  + 
Sbjct: 137 ERLMANSG---DFRYHLETIRRFKPHTLSEPEEKIINIKNITGQSAVHQLYDVVTNGFTF 193

Query: 213 RFKINDQKIPLTK-AYKSFFDSDRE-VRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
             +I+ +K  + + A  ++  S +  VR++A + +   +     +   I  TL  D + +
Sbjct: 194 TMRIDGKKKTMNREALTAYLRSPKAAVRETAYREMYRVYESQQDLLGEIYKTLVNDWKAE 253

Query: 271 D-RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWD 329
           + + R ++   +SR+LSN++    ++AL+    N  P    RY++LK +  K+ TM  + 
Sbjct: 254 NLQLRHFKTPLESRNLSNDIPDRAVDALLSVCTNNAP-IFQRYFKLKARLCKIKTMNRYH 312

Query: 330 RLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFA 389
             AP     Q    +  A  +VL +Y  FSP+++ +A++ F    IDA    GK  GA+ 
Sbjct: 313 IYAPHRA-EQKTYRYADAVRMVLDAYYGFSPRLAELAQRVFADRHIDARTKPGKMGGAYC 371

Query: 390 HGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIF 449
           +   P++ PY++LN+ G+ +D+ T+AHELGH +H ++ +E   + T +S+L LAETAS+F
Sbjct: 372 YSVTPNLTPYVMLNFTGEARDIATMAHELGHAVHAMM-AEQHNVFTFHSTLPLAETASVF 430

Query: 450 GETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTH 509
           GE +  D+L+   +++  ++ LL N+++D+  +++RQ  F  FE   H +  + G   T 
Sbjct: 431 GERILSDALMATETNRSVKQSLLVNQLDDIYATVMRQAYFVAFERTAH-DMVAQGATTTD 489

Query: 510 RINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYK 569
            + + ++   ++  G +  +   E+   W+ +PH   S FY YAY+FGN LV +LY +Y+
Sbjct: 490 -LAQTYMTLLRQQFGKSLRVPQ-EFQWEWLTIPHLYASPFYCYAYSFGNLLVLALYRMYQ 547

Query: 570 SNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEK 625
                 F  KYL +L AG SK    +L  + ++++ P FW+ G   +  M+D +E+
Sbjct: 548 EQG-SAFVPKYLELLAAGGSKAPQAILAEVGVDMNSPAFWQSGFDAISGMVDQLEQ 602


>gi|218513176|ref|ZP_03510016.1| oligoendopeptidase F protein [Rhizobium etli 8C-3]
          Length = 204

 Score =  247 bits (631), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 110/193 (56%), Positives = 144/193 (74%), Gaps = 1/193 (0%)

Query: 295 EALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQS 354
           +AL  +V+  YP+ SHRYY++K KWL ++ M FWDR APLP TS  +I +  A+D VL +
Sbjct: 13  DALAAAVREAYPRLSHRYYKMKAKWLGMEQMNFWDRNAPLPETSSAVISWSDAKDTVLSA 72

Query: 355 YAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTL 414
           Y  F+P+M+ IA +FF   WIDAP   GK  GAFAH T+PS HPY+L+NY+GKP+DVMTL
Sbjct: 73  YGNFAPEMADIARRFFDEQWIDAPVRPGKAPGAFAHPTVPSAHPYVLVNYMGKPRDVMTL 132

Query: 415 AHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLAN 474
           AHELGHG+H VL+   QG L   + LTLAETAS+FGE LTF +LL+  + + ERK +LA 
Sbjct: 133 AHELGHGVHQVLAG-AQGALMCQTPLTLAETASVFGEMLTFRALLEKTTDRRERKAMLAQ 191

Query: 475 KIEDMLNSIVRQI 487
           K+EDM+N++VRQI
Sbjct: 192 KVEDMINTVVRQI 204


>gi|320159756|ref|YP_004172980.1| putative M3 family peptidase [Anaerolinea thermophila UNI-1]
 gi|319993609|dbj|BAJ62380.1| putative M3 family peptidase [Anaerolinea thermophila UNI-1]
          Length = 591

 Score =  246 bits (629), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 181/614 (29%), Positives = 299/614 (48%), Gaps = 37/614 (6%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           MT++  Q+       W L DL     SQ    +++ +  +  A    +E      T +  
Sbjct: 1   MTSLPYQQTA-----WRLSDL-----SQGTPEEIDALFQQLEAQTQEFEALRPLLTPEIA 50

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
             +    I + ERI E   R+  YA LS++ N                LA+ +   +FF 
Sbjct: 51  VETFLDLIHKLERITEDTYRLYGYAGLSFSANTQDQNALTLVGRAEQFLAELQNRTLFFT 110

Query: 144 LEINTLDE--ALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
           L    LD+  A    S A D     Y+ W++ +R +K + LS   E +++  +  G  A+
Sbjct: 111 LWWKGLDDENAARLMSQAGD-----YTYWLEEMRHLKPYTLSEAEEKIINLKNVTGASAI 165

Query: 202 KRFF--CENIESLRFKINDQKIPLTKAYKSFF--DSDREVRKSAAKALSHTFNKSSHIFS 257
           +R +    N  + + +++ +   LT+     +   +D ++R  A + L   +       +
Sbjct: 166 ERLYETYTNRYTFKLEVDGEVKELTRGELMTYVRGADPDLRARAYQELYRVYGNDGAFLA 225

Query: 258 FITNTLAKD---EEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTS--HRY 312
            +   L +D   E I    R Y+     R+L+N++   V++ L++  +     TS   RY
Sbjct: 226 QMYQNLVRDWYNENIT--LRGYKSPIAVRNLANDIPDEVVDTLLEVCRK---NTSVFQRY 280

Query: 313 YELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTH 372
           + LK +WL +D +  +D  AP+   +    PFE A  LVL S+ +F PQ + +A++ F H
Sbjct: 281 FRLKARWLGMDKLRRYDIYAPV-ARADKAYPFEHAAWLVLDSFRQFDPQFAELAQRVFEH 339

Query: 373 NWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQG 432
             +D+    GK SGAF     P + P++LLNY G+  DV T+AHELGH IH +++ E   
Sbjct: 340 QHLDSEVRKGKRSGAFCWSVSPRLTPWVLLNYQGRADDVATMAHELGHAIHSMMAQE-HS 398

Query: 433 ILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDF 492
           I T ++SL LAETAS FGE +  D LL   S +  R+ LL  +++D   +I RQ  F  F
Sbjct: 399 IFTFHASLPLAETASTFGEMMLVDRLLAEESDEAVRRDLLFRQVDDSYATIQRQAFFALF 458

Query: 493 ELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVY 552
           E + H   R         + E +L   K+  G A ++SD E+   W+ +PH   + FYVY
Sbjct: 459 EKEAHEMVRQNAS--PDEMAEAYLRNLKDQFGDAVEVSD-EFRWEWVSIPHIYGTPFYVY 515

Query: 553 AYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERG 612
           AYAFG  LV SLY  +K    + FK +   IL AG S+    +L    +++   +FW+ G
Sbjct: 516 AYAFGQLLVLSLYRQFKQEG-ESFKPRLKQILAAGGSQSPESILRNAGVDIRQASFWQGG 574

Query: 613 LQTVEKMIDDVEKM 626
              + ++++ +E++
Sbjct: 575 FDVIAQLVNQLEQI 588


>gi|307298978|ref|ZP_07578780.1| peptidase M3A and M3B thimet/oligopeptidase F [Thermotogales
           bacterium mesG1.Ag.4.2]
 gi|306915403|gb|EFN45788.1| peptidase M3A and M3B thimet/oligopeptidase F [Thermotogales
           bacterium mesG1.Ag.4.2]
          Length = 598

 Score =  239 bits (611), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 176/597 (29%), Positives = 291/597 (48%), Gaps = 19/597 (3%)

Query: 29  SQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG 88
           S+ N   +  W+L  LY S D + I  D++ +  E       + G ++      +   L 
Sbjct: 2   SKLNEREIIEWDLTRLYASLDDETIFEDIKTVLREKDELVRDYRGRIS--GENISARELR 59

Query: 89  AAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINT 148
             + + E +    G+++ +A L+++   +    +K    ++   A  E  L+F  LE+  
Sbjct: 60  GLLEKSESLLNRAGKLSMFAYLNHSVLTADSATQKLVRKMDDLEAALESGLMFIKLELAR 119

Query: 149 LDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCEN 208
           + +    +    D L   Y  +   +R ++ H LS   E ++      G+ A+   F E 
Sbjct: 120 VSDDFFSELNECDELK-NYRHYFDLVRALRDHQLSEPEEDIIVRKDITGKMAMLNLFDEF 178

Query: 209 IESLRFKI--NDQKIPLTKAYKSFFDS--DREVRKSAAKALSHTFNKSSHIFSFITNTLA 264
             +  ++I  + ++  LT++      S  D  +RK A ++L     ++S I + I N+LA
Sbjct: 179 TSTFEYRIFIDGEEKVLTESEVENLRSHGDEGIRKKAFESLFRKTEENSVILTNIYNSLA 238

Query: 265 KDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDT 324
           KD ++    R +      R++ N V    ++ L+ +    Y      YY LK + +  + 
Sbjct: 239 KDWDLDASKRHFSSPISMRNIENEVSDESVQNLIDATTQGYS-IVQDYYRLKARVMNKEI 297

Query: 325 MYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKG 384
           +   D  APL   S+DI  ++ A++++L+    F  Q   I   FF   +I      GK 
Sbjct: 298 LLHSDIYAPL-ADSRDIFSWQEAKNMILEVMGNFDSQSGRIISGFFDGEYIHGSIIPGKR 356

Query: 385 SGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAE 444
           SGAF +   P VHPY+L+N+ GK  DV+TLAHELGHG+H VLSS+ Q  L   + LT+AE
Sbjct: 357 SGAFCYYASPEVHPYVLVNFGGKTSDVLTLAHELGHGLHGVLSSK-QTHLNYETPLTMAE 415

Query: 445 TASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTG 504
           TASIF E L  D LL   S K E+  L++ ++E++L S  RQ  F  FE+  H+   S  
Sbjct: 416 TASIFSEMLMTDFLLDNISGKAEKLSLISKRMEEILASTARQNMFTRFEMAAHS-IISRE 474

Query: 505 DIPTHRINEIWLETQKESLGPA---FDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLV 561
            +    +++++ E  K         F  S  E    W  +PH   + FY YAY F   LV
Sbjct: 475 FLSFKELSDLYFEELKLMFADTIVFFPESKFE----WARIPHIFHTPFYCYAYNFAQLLV 530

Query: 562 NSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
            SLY +Y  +  D FK +Y+ +L +G+S     LL  + I++S+P FWE GL  +++
Sbjct: 531 ISLYRMYLEDG-DVFKRRYIRLLESGSSDSPEILLKSVGIDISEPYFWENGLHFIQE 586


>gi|160903129|ref|YP_001568710.1| peptidase M3A and M3B thimet/oligopeptidase F [Petrotoga mobilis
           SJ95]
 gi|160360773|gb|ABX32387.1| peptidase M3A and M3B thimet/oligopeptidase F [Petrotoga mobilis
           SJ95]
          Length = 584

 Score =  232 bits (591), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 175/591 (29%), Positives = 285/591 (48%), Gaps = 22/591 (3%)

Query: 36  LPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYE 95
           + RW+L   Y S +  +I  D E    +      ++   L++ +     H L     E+E
Sbjct: 1   MSRWDLTFFYSSPEDSQIKEDFEESLRQIKKLYQQYYDKLSNPS--LTPHELKNFFQEFE 58

Query: 96  RICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALL- 154
           ++ ++      Y  L Y+ N    T +K Y       +  E    F+   +   +E  L 
Sbjct: 59  KVLKMHNFTYQYCHLLYDSNTQDETAQKLYAMAKDYDSKIEMESSFWKPRLLKQNEKKLN 118

Query: 155 EQSYAQDPLTLK-YSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLR 213
           E  YA++   LK Y+  ++ + K K H+LS D E +L+      R   +  +     S  
Sbjct: 119 ELMYAEE---LKDYTHVLQKLIKSKSHILSEDAEKVLAAMYNSSRGGFEELYGRLTSSYT 175

Query: 214 FKIN-DQKI-----PLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDE 267
           FK+  D ++     P  ++ +     D  +R+ A K     +++ S +F  I N++ K+ 
Sbjct: 176 FKLEIDGELKELTDPQVRSLRR--KPDVNLRRQAMKEFFKKYDEDSLLFEKIYNSIVKNY 233

Query: 268 EIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYF 327
           + +   R Y++    R+ +N VE  ++E +++   +  P   H+YY  K K L ++    
Sbjct: 234 DTEASLRNYKEPISMRNFNNEVEDEIVETVIKVTTDRTPMV-HQYYRWKGKRLGIEQT-L 291

Query: 328 WDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGA 387
            D  APL    ++   FE A+ +VL SY +F  ++  IAE FF    ID+    GK  GA
Sbjct: 292 ADIYAPLAKVQKEYT-FEEAQKIVLDSYYEFDEEIGEIAESFFKEKRIDSEIRKGKRGGA 350

Query: 388 FAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETAS 447
           +    +P+  P+ILLN+ G   DV TLAHELGHGIH  L+S+ Q I   +  LT+AE AS
Sbjct: 351 YTSYALPNRKPFILLNFTGTLADVSTLAHELGHGIHGTLASD-QNIWNYHPPLTMAEVAS 409

Query: 448 IFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIP 507
           +FGE L  D +L    S+ ER   L++ +E M +++ RQ     FE+  H      G   
Sbjct: 410 VFGEMLVIDKILPTL-SEAERTAYLSSNVEGMFSTMFRQNMIARFEISSHNLIEQNGSAN 468

Query: 508 THRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDI 567
              + E++ +  +   G +  +   EY   W  +PH   + FYVYAY F N LV +LY  
Sbjct: 469 WKELAELYKKELEIMFGDSVIIPQ-EYYYEWASIPHIFRTPFYVYAYNFANLLVIALYQQ 527

Query: 568 YKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
           YK      F  KY  +LR+G      ELL  + I++S+ +FWE+G + +E+
Sbjct: 528 YKVEG-KSFAPKYKELLRSGAKDSPKELLKKIGIDISNQDFWEKGFEFIER 577


>gi|154249568|ref|YP_001410393.1| peptidase M3A and M3B thimet/oligopeptidase F [Fervidobacterium
           nodosum Rt17-B1]
 gi|154153504|gb|ABS60736.1| peptidase M3A and M3B thimet/oligopeptidase F [Fervidobacterium
           nodosum Rt17-B1]
          Length = 578

 Score =  231 bits (590), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 163/550 (29%), Positives = 286/550 (52%), Gaps = 18/550 (3%)

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
           +K  + +   I E E   +   +   YA + Y+ N      +K    I +  ++  +   
Sbjct: 36  EKELNKIIKLIKEIEDSTDNFSKSIQYAWMRYSVNTKEKESQKLLGTIQSLESNVGEYFA 95

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
              + ++ L +  +++     P    Y+ +I+ I K KKHLLS + E +L+ TS   REA
Sbjct: 96  KLEVRLSKLSKKDIQELKKIAP---NYTHFIEVIEKRKKHLLSKEAEQVLALTSISRREA 152

Query: 201 LKRFFCENIESLRFKIN-DQKIPL-----TKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
           + +   +   S +FKI  D +I +      KA +   +SD  +RK A K     F + S 
Sbjct: 153 ISKIHNKLESSYKFKIEIDGEIKVLTPEEVKALRRSTNSD--LRKKAMKTFLKRFQEDSL 210

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
           + + + N + KD +++ + RK+ +    R+  N V   V+++L+++  N        YY+
Sbjct: 211 VITEVYNLVVKDYDLESKIRKFARPISMRNFENEVSDDVVDSLIETT-NENVNILREYYK 269

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
            K + +  + +   D  AP+   ++    F+ A++++L +Y  FS +   I + FF ++ 
Sbjct: 270 WKSEVMN-EKLTLADIYAPITTKARKF-SFDEAKEIILDAYYSFSNKAGDIVKSFFENSR 327

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           ID    +GK  GA+   +   +  Y+L N+ G   D+MTLAHELGHG+H  LS + Q   
Sbjct: 328 IDLYPREGKIGGAYCIYSTTKLPAYVLTNFNGDMYDIMTLAHELGHGLHGTLSKK-QTYF 386

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
             ++ LTLAE AS+FGE L FD  L+    KEER  L+++KIED   +  RQ  F +FE+
Sbjct: 387 NYDTPLTLAELASVFGEFLVFD-YLKGKLDKEERLALISSKIEDTFATTFRQNFFTNFEI 445

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
           + H    ++G      +N+I+ E  +++ G   ++    Y + W M+ HF E+ FYVY+Y
Sbjct: 446 RSHDLISNSGYADWEELNDIYYEELRKTFGEVVEIPQW-YKNEWAMISHFFETPFYVYSY 504

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
            F +CLV +LY  Y       F +KYL++L +G S   +ELL  + I++S  +FWE+   
Sbjct: 505 NFAHCLVIALYQKYLEEG-KSFTKKYLSLLESGGSLSPNELLSKVGIDISRSDFWEKAFD 563

Query: 615 TVEKMIDDVE 624
            ++ ++ +++
Sbjct: 564 FIDSLVKEIK 573


>gi|167042635|gb|ABZ07357.1| putative peptidase family M3 [uncultured marine crenarchaeote
           HF4000_ANIW133K13]
          Length = 589

 Score =  231 bits (588), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 175/607 (28%), Positives = 297/607 (48%), Gaps = 37/607 (6%)

Query: 35  NLPRWNLEDLYPSHDSQEISNDMECIEHESLAF---KTRWEGNLAHATNQKNCHSLGAAI 91
           +L +W+L++L       EI   +  +E  +  F   K     N++ A   K        I
Sbjct: 5   DLGKWDLKELVKKPTRAEIDKKLAKLESSTKRFEKTKKSLNSNISSAKFLK-------II 57

Query: 92  AEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL----EIN 147
            + E + E    I  YA L Y+ N  S       T I+   +D E  L+FF L    +++
Sbjct: 58  RDIETVSEKSSIIHGYASLCYSENTQSDEATSLLTRISKFASDIENRLLFFDLWWKKQVD 117

Query: 148 TLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCE 207
             +   L +S  Q      YS ++K+ R + K+ LS   E +++     G  AL + + +
Sbjct: 118 EKNAKRLIKSAGQ------YSEYLKHKRLLAKYSLSEPEEKIINTLDVTGASALVKIYDK 171

Query: 208 NIESLRFKI--NDQKIPLTKAYKSFFDSDR--EVRKSAAKALSHTFNKSSHIFSFITNTL 263
              +  + +  N ++  + +   +    ++  ++R+SA K+L   +N +  +   I   +
Sbjct: 172 ITNAFVYTVTVNGKRKTMNREQLTSLVRNKSAKIRESAYKSLLSKYNDNKGVTGEIYQNI 231

Query: 264 A---KDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWL 320
               +DE I    R +      R++SNN+    I+ L+   K    K   +Y+  K K L
Sbjct: 232 VLNLRDEGIG--MRGFSSPITIRNISNNIGDETIKTLLHVCKKN-SKIFQKYFRKKAKLL 288

Query: 321 KLDTMYFWDRLAPLPG-TSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQ 379
            +  +  +D  AP    +S+    ++ +  LVL+S +KFSP +S  A+  F    +D+  
Sbjct: 289 GMKKLRRYDLYAPRKSKSSEKTYSYDKSIKLVLESLSKFSPILSEYAKNVFRQRHVDSAL 348

Query: 380 YDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSS 439
             GK SGAF     P + PY+LLN+ GK +DV TLAHE+GH IH V S+  + IL + +S
Sbjct: 349 RPGKASGAFCSTPSPKITPYVLLNFTGKSRDVFTLAHEIGHAIHSV-SASNKSILVSEAS 407

Query: 440 LTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTE 499
           L LAETAS F E L +D+L       +E+KI+L+ KI+D   +I RQ  F  FE++ H  
Sbjct: 408 LPLAETASTFSEMLLYDNLSMMVGD-QEKKIILSEKIDDFYATIGRQSFFTLFEIEAH-- 464

Query: 500 RRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNC 559
           ++         +++ +L+   +  G +  +S+  +G  W  +PHF  + FY YAYAFGN 
Sbjct: 465 KQIANSTTVDELSKTYLQNLNQQFGNSVKVSE-NFGIEWSCIPHFHHAPFYCYAYAFGNL 523

Query: 560 LVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKM 619
           L  SL+  YK      F  +Y++IL +G SK   +LL    I+++   FW+ G   ++  
Sbjct: 524 LALSLFQRYKKEG-KSFALEYIDILSSGGSKKPEKLLAEFGIDITKSRFWQDGFDYIQDK 582

Query: 620 IDDVEKM 626
           + ++  +
Sbjct: 583 VKELSSL 589


>gi|328951690|ref|YP_004369025.1| peptidase M3A and M3B thimet/oligopeptidase F [Marinithermus
           hydrothermalis DSM 14884]
 gi|328452014|gb|AEB12915.1| peptidase M3A and M3B thimet/oligopeptidase F [Marinithermus
           hydrothermalis DSM 14884]
          Length = 597

 Score =  229 bits (585), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 167/592 (28%), Positives = 285/592 (48%), Gaps = 19/592 (3%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           RW L+DL       ++   +  ++    AF+      L     +     +   +   E I
Sbjct: 12  RWRLDDLLAGTGHPDLDAALRALDEAVTAFEAV-RDELGPELTEARFREI---LDRLEAI 67

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQS 157
            EL     + A L +  +   P  +     +  ++A+ +   +FF L    L++A   + 
Sbjct: 68  TELAHSAYALAGLRFAEDTQDPEAQAALARVRQRIAELQNRTLFFELWWKNLEDAAAAR- 126

Query: 158 YAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFF--CENIESLRFK 215
             Q   T +Y  W++++R  + H LS   E +++  +  GR+AL   +    N  + R +
Sbjct: 127 LMQGETTRRY--WLEHLRAFRAHTLSEPEERIINLKNVTGRQALDTLYDSITNRYTFRLE 184

Query: 216 INDQKIPLTKAYKSFF--DSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ-DR 272
           ++ +   LT+     +  D+  EVR +A + L   +     I   I   + +D   +  R
Sbjct: 185 VDGETKELTRGELMVYARDARPEVRAAAYRELYRVYGADGPILGQIYQGIVQDWRNEYVR 244

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
            R ++    +R+  N++    +EAL+ +V         RY+ LK +WL ++ +  +D  A
Sbjct: 245 LRGFKTPIAARNKMNDLPDEAVEALL-TVCRENASLFQRYFRLKARWLGMERLRRYDIYA 303

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           P+   S+   PF  A ++V  ++ +F P+ + +A + F    +D+    GK  GAF    
Sbjct: 304 PV-SESKRTYPFAEAVEMVRVAFERFHPRFAELALRVFEAGHVDSEVRKGKQGGAFCWSP 362

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
            P + P++LLNY G+ +DV T+AHELGH IH +L+     I T ++ L LAETAS FGE 
Sbjct: 363 SPRLVPWVLLNYQGRVEDVSTMAHELGHAIHAMLAGH-HSIFTFHAPLPLAETASTFGEM 421

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           L  D LL+       R+ +L  +++D   +I+RQ  F  FE   H E  + G   T  + 
Sbjct: 422 LLVDYLLEEERDPAVRRDILFAQVDDNYATILRQAFFALFEQTAH-EMIAEGAT-TEALA 479

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
           + +LE      G A ++ + E+   W+ +PH   + FYVYAYAFG  LV +LY  Y++  
Sbjct: 480 QAYLENLALQFGDAVEVGE-EFRWEWVSIPHIYGTPFYVYAYAFGQLLVLALYRQYRAEG 538

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVE 624
            + FK +   IL AG S   +ELL    I++ D  FW+ G +  E +I  +E
Sbjct: 539 -EAFKPRLERILAAGGSVAPAELLAREGIDVRDAAFWQGGFEVFEGLIRTLE 589


>gi|313679003|ref|YP_004056742.1| oligoendopeptidase, pepf/m3 family [Oceanithermus profundus DSM
           14977]
 gi|313151718|gb|ADR35569.1| oligoendopeptidase, pepF/M3 family [Oceanithermus profundus DSM
           14977]
          Length = 596

 Score =  223 bits (567), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 163/602 (27%), Positives = 286/602 (47%), Gaps = 36/602 (5%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           RW LEDL+    S      +E ++ ++ A +      L      +    +   + + E +
Sbjct: 13  RWTLEDLFGGPQSPGFKRALEELDQKAAALQAV-RDELKPGLPPERFLEI---VRQVEEL 68

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTL--DEA-LL 154
            +L+ R  + A L +  +  +P  +     +  K A+ E   +FF L    L  +EA  L
Sbjct: 69  ADLMHRAYAAAGLWFYEDTQNPEAQALLAQMRQKSAEIENQTLFFELWFKDLPDEEADRL 128

Query: 155 EQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF 214
            Q+  +     +Y  W++ +R  K + LS   E +++  +  GR AL   +       +F
Sbjct: 129 VQAAGE-----RYRYWLEQMRAWKPYTLSEGEEKIVNLKNATGRSALDTLYDTITSRYKF 183

Query: 215 --KINDQKIPLTKAYKSFF--DSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
             +++ +   LT+     +  D   EVR +A + L   + + + + + I   +  D    
Sbjct: 184 TLEVDGETKTLTRGELMVYARDPRPEVRAAAYRELYRVYAEDAPVLAQIYQNIVSD---- 239

Query: 271 DRW-------RKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLD 323
             W       R ++     R+  N++   V+E L++  +   P    RY+ LK + L ++
Sbjct: 240 --WKNEYLEVRGFKSAIAVRNKINDLPDAVVETLLEVSRRNAP-LFQRYFRLKARVLGME 296

Query: 324 TMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGK 383
            +  +D  AP+   ++    +  AR +V +++A F P+ + +A + F    +DA   +GK
Sbjct: 297 RLRRYDVYAPVT-KAEKRYGYAEARRMVDEAFAAFDPRFAELAARVFERRHVDAEVREGK 355

Query: 384 GSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLA 443
             GAF     P   P++LLNY G+P DV T+AHELGH +H +L+ E   + T ++ + LA
Sbjct: 356 AGGAFCWTPAPGTVPWVLLNYQGRPDDVSTMAHELGHAVHGMLAGE-HPVFTFHAPMPLA 414

Query: 444 ETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRST 503
           ETAS F E L  D LL   S  E R+ +L ++++    +I+RQ  F  FE++ H  RR  
Sbjct: 415 ETASTFAEMLLVDHLLATESDAEVRRQVLFDQMDGNYATILRQAYFALFEIEAH--RRIP 472

Query: 504 GDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNS 563
                  +   +    +E    A +LSD E+   W+ +PH   + FYVYAYAFG  LV +
Sbjct: 473 EGATADELKAAYRANLEEQFADAVELSD-EFDWEWISIPHIYGTPFYVYAYAFGQLLVLA 531

Query: 564 LYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDV 623
           LY  Y+    + FK +   IL AG S   +ELL     +++   FW+ G   + +++  +
Sbjct: 532 LYKRYREEG-EAFKPRLFRILEAGGSVAPAELLAREGFDVTAAAFWQGGFDVIAELLAKL 590

Query: 624 EK 625
           E+
Sbjct: 591 EE 592


>gi|167043811|gb|ABZ08501.1| putative peptidase family M3 [uncultured marine crenarchaeote
           HF4000_APKG3D24]
          Length = 590

 Score =  222 bits (566), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 175/610 (28%), Positives = 299/610 (49%), Gaps = 45/610 (7%)

Query: 36  LPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQK-NCHSLGAAIAEY 94
           L +WNL++L  + +       +  IE  +  F+      +  + N K +       + + 
Sbjct: 6   LGKWNLDELVKNPNRAVFDQKLAKIESNAKRFE-----KIKKSLNPKISSRKFLRLLRDI 60

Query: 95  ERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL----EINTLD 150
           E I E    I  YA L Y+ N  S       T I+   +D E  L+FF L    +++  +
Sbjct: 61  ENITEKSSVIGGYASLRYSENTQSDEATSLLTRISKFGSDIENRLLFFDLWWKKQVDEKN 120

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFF----- 205
              L +S  Q      +S +++  R + K+ LS   E +++     G  AL + +     
Sbjct: 121 ARRLIKSAGQ------FSEYLRFKRLLAKYSLSEPEERIINTLDVTGVSALVKLYDKITN 174

Query: 206 ----CENIESLRFKIN-DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFIT 260
                  ++  +  +N +Q   L ++ K+      + R++A K+L   +N++  +   I 
Sbjct: 175 AYVYVVTVDGKKRTMNREQLTTLVRSKKA------KTREAAYKSLFSKYNENKGVTGEIY 228

Query: 261 NTLA---KDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
             +    +DE I    R +      R++SNNV+    + L+   K    K   +Y+  K 
Sbjct: 229 QNIVLNWRDEGIG--MRGFSSPITIRNISNNVDNETTKTLLNVCKKN-SKIFQKYFLQKA 285

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDI-IPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWID 376
           K L +  +  +D  AP     ++    +  +  LVL+S AKFSP +S  A+  F    +D
Sbjct: 286 KLLGMKKLRRYDLYAPRKSKIKEKNYAYGKSVKLVLESLAKFSPVLSEYADNVFKKKHVD 345

Query: 377 APQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTN 436
           +    GK  GAF     P + PY+L+N+ GK +DV TLAHE+GH IH + +S+ + IL +
Sbjct: 346 SIIRPGKTVGAFCSTPSPKITPYVLVNFTGKSRDVFTLAHEIGHAIHSISASD-KSILVS 404

Query: 437 NSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKL 496
           ++SL LAETAS F E L +D L +   SK+E+K +L+ KI+D   +I RQ  F  FE++ 
Sbjct: 405 DASLPLAETASTFSEMLLYDKLSETV-SKQEKKTMLSEKIDDFYATIGRQSFFTLFEIEA 463

Query: 497 HTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAF 556
           H +  ++  I    I++ +L+   E  G +  +S+ ++G  W  +PHF  + FY YAYAF
Sbjct: 464 HKQIANSTTI--DEISKTYLQNLNEQFGNSVKVSE-DFGLEWSCIPHFHHAPFYCYAYAF 520

Query: 557 GNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTV 616
           GN L  SL+  YK      F   Y+ IL AG +K   +LL    ++++ P FW+ G   +
Sbjct: 521 GNLLALSLFQRYKKEG-KGFAPTYIEILSAGGTKKPEKLLRESGMDITKPRFWQDGFDYI 579

Query: 617 EKMIDDVEKM 626
           ++ + ++ K+
Sbjct: 580 QEQVKELSKL 589


>gi|167044238|gb|ABZ08918.1| putative peptidase family M3 [uncultured marine crenarchaeote
           HF4000_APKG5N21]
          Length = 590

 Score =  218 bits (555), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 173/610 (28%), Positives = 297/610 (48%), Gaps = 45/610 (7%)

Query: 36  LPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQK-NCHSLGAAIAEY 94
           L +WNL++L  +         +  IE  +  F+      +  + N K +       + + 
Sbjct: 6   LGKWNLDELVKNPTRAVFDQKLAKIESNAKRFE-----KIKKSLNPKVSSGKFLRLLRDI 60

Query: 95  ERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL----EINTLD 150
           E I E    I  YA L Y+ N  S       T I+   +D E  L+FF L    +++  +
Sbjct: 61  ENITEKSSVIGGYASLRYSENTQSDEATSLLTRISKFGSDIENRLLFFDLWWKKQVDEKN 120

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFF----- 205
              L +S  Q      +S +++  R + K+ LS   E +++     G  AL + +     
Sbjct: 121 ARRLIKSAGQ------FSEYLRFKRLLAKYSLSEPEERIINTLDVTGVSALVKLYDKITN 174

Query: 206 ----CENIESLRFKIN-DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFIT 260
                  ++  +  +N +Q   L ++ K+      + R++A K+L   +N++  +   I 
Sbjct: 175 AYVYVVTVDGKKRTMNREQLTTLVRSKKA------KTREAAYKSLFSKYNENKGVTGEIY 228

Query: 261 NTLA---KDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
             +    +DE I    R +      R++SNNV+    + L+   K    K   +Y+  K 
Sbjct: 229 QNIVLNWRDEGIG--MRGFSSPITIRNISNNVDNETTKTLLDVCKKN-SKIFQKYFLQKA 285

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDI-IPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWID 376
           K L +  +  +D  AP     ++    ++ +  LVL+S AKFSP +S  A+  F    +D
Sbjct: 286 KLLGMRKLRRYDLYAPGKSKIKEKNYAYDKSVKLVLESLAKFSPVLSEYADNVFKKKHVD 345

Query: 377 APQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTN 436
           +    GK  GAF     P + PY+L+N+ GK +DV TLAHE+GH IH + +S+ + IL +
Sbjct: 346 SIIRPGKTVGAFCSTPSPKITPYVLVNFTGKSRDVFTLAHEIGHAIHSISASD-KSILVS 404

Query: 437 NSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKL 496
           ++SL LAETAS F E L +D L +   SK+E+K +L+ KI+D   +I RQ  F  FE++ 
Sbjct: 405 DASLPLAETASTFSEMLLYDKLSETV-SKQEKKTMLSEKIDDFYATIGRQSFFTLFEIEA 463

Query: 497 HTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAF 556
           H  ++         I++ +L+   E  G +  +S+ ++G  W  +PHF  + FY YAYAF
Sbjct: 464 H--KQIANSTTVDEISKTYLQNLNEQFGNSVKVSE-DFGLEWSCIPHFHHAPFYCYAYAF 520

Query: 557 GNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTV 616
           GN L  SL+  YK      F   Y+ IL AG +K   +LL    ++++ P FW+ G   +
Sbjct: 521 GNLLALSLFQRYKKEG-KGFAPTYIEILSAGGTKKPEKLLRESGMDITKPRFWQDGFDYL 579

Query: 617 EKMIDDVEKM 626
           ++ + ++ ++
Sbjct: 580 QEHVTELSRL 589


>gi|161528685|ref|YP_001582511.1| pepF/M3 family oligoendopeptidase [Nitrosopumilus maritimus SCM1]
 gi|160339986|gb|ABX13073.1| oligoendopeptidase, pepF/M3 family [Nitrosopumilus maritimus SCM1]
          Length = 590

 Score =  218 bits (554), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 175/601 (29%), Positives = 298/601 (49%), Gaps = 28/601 (4%)

Query: 29  SQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG 88
           SQ  LG    WNL +L  +  S      ++ +E+++  F+ + +  L    + K    + 
Sbjct: 2   SQYQLG---MWNLSELAKNPKSSAFQKQIKELENQAEKFE-KIKSKLDPKMSSKKFMEI- 56

Query: 89  AAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINT 148
             +++ E I E + +I  YA LSY+ +  S       T ++   +D    ++FF L   T
Sbjct: 57  --LSQVEEISEKMSKIGGYASLSYSSDTQSDEATSLMTRMSKLGSDISNKILFFDLWWKT 114

Query: 149 LDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFF--C 206
             +    +   +D   L  S ++ + R I K+ LS   E +++     G  AL + +   
Sbjct: 115 QVDEKNAKRLIKDAGEL--SEYLAHKRLIAKYSLSEPEERIINTLDVTGISALVKLYDKI 172

Query: 207 ENIESLRFKINDQKIPLTKAYKSFF--DSDREVRKSAAKALSHTFNKSSHIFSFITNTLA 264
            N    + KI ++   +T+   + +   ++ ++R++A K +   +N++  +   I   +A
Sbjct: 173 TNAFEYQMKIGNKTKKMTREELTNYVRHTNPKIRETAYKTILGKYNENKGVVGEIYQNIA 232

Query: 265 ---KDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLK 321
              KDE I    R Y      R++ N+V+   IE+L+   K   P    +++  K K LK
Sbjct: 233 LNWKDEGID--IRGYRTPISMRNIGNDVDDKTIESLLLVCKKNAP-VFQKFFVQKAKMLK 289

Query: 322 LDTMYFWDRLAPLPGTSQDI-IPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQY 380
           +  +  +D  AP     ++    +  +  LV +S  KFS  +   A K F  N ID+   
Sbjct: 290 MKKLRRYDIYAPAAANIKEKNYSYNKSVKLVFESLGKFSNTLEDFARKVFNENHIDSEVR 349

Query: 381 DGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSL 440
            GK  GAF     P + PY+L+N+ GK +DV TLAHELGH +H   +++ + IL  ++ L
Sbjct: 350 QGKRDGAFCSTLTPKITPYVLVNFTGKSRDVFTLAHELGHAVH-SQAAQDRSILVQDAPL 408

Query: 441 TLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTER 500
            LAETAS F E L +D++    S  +E+KI+L+ KI+D+  +I+RQ  F  FE+  H   
Sbjct: 409 PLAETASTFSELLLYDNISDKISD-DEKKIMLSEKIDDLYATILRQSFFTIFEIDAH--- 464

Query: 501 RSTGDIPT-HRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNC 559
           +  G+  T   I++ +L+  K+  G + D++D ++   W  +PHF  + FY YAY+FGN 
Sbjct: 465 KQIGEGTTIDEISKTYLQNLKQQFGKSVDVTD-DFAIEWSCIPHFYHTPFYCYAYSFGNL 523

Query: 560 LVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKM 619
           L  SL+  YK    D F   Y++IL AG SK   +LL    +++    FW+ G   V   
Sbjct: 524 LALSLFQRYKKEGKD-FVPAYIDILAAGGSKKPEKLLKEHGLDIQSTKFWQEGFDYVNGQ 582

Query: 620 I 620
           +
Sbjct: 583 V 583


>gi|42557750|emb|CAF28724.1| putative oligoendopeptidase F [uncultured crenarchaeote]
          Length = 600

 Score =  217 bits (553), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 166/604 (27%), Positives = 294/604 (48%), Gaps = 29/604 (4%)

Query: 36  LPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYE 95
           + +W+L DL     +   +N +  I+ +   F    E N        +  S    + + E
Sbjct: 9   IGKWDLHDLIDDKSTSTFANLVNGIKKDVGEF----EANRQILKPDLDGPSFEGLVHKLE 64

Query: 96  RICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL-EINTLDEALL 154
            I ++   + S+A L Y  + SS        +     +     ++FF L  + T+D    
Sbjct: 65  NIMDVTSIVNSFAQLKYAADTSSNEAAALVLETEKMSSQISNQVLFFDLWFMKTVDTNNA 124

Query: 155 EQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF 214
           E+    D L   Y  ++K+ R + K+ L+   E +++     G  AL + +     +  F
Sbjct: 125 ER--LIDSLPSVYREYLKHKRLVAKYSLNESEEKIINTLEVTGTGALVKIYDRMTNNFEF 182

Query: 215 KINDQKIPLTKAYKSFFDSDREV----------RKSAAKALSHTFNKSSHIFSFITNTLA 264
            +  +K   T+  K F + ++ +          R++A KAL  T+ K+S +   I   L 
Sbjct: 183 SVV-KKHGKTRRIKIFKNKEKLLSLVRSPKAYERETAYKALFKTYEKNSGVLGEIYQNLV 241

Query: 265 ---KDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLK 321
              +DE I    R ++     R++ NN++   +E L+   K       H Y+  K K + 
Sbjct: 242 TQWRDENIS--IRGFKSPISVRNIYNNIDDTTVETLLAVCKEN-AHLFHDYFVEKAKLIG 298

Query: 322 LDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYD 381
           +  +  +D  AP+   +   I F  A  LVL ++ KF P+     E+ F  N ID+   +
Sbjct: 299 MKKLRRYDLYAPISSKNIPRITFRNATKLVLDTFHKFEPRFGQYTERLFKENHIDSEIRN 358

Query: 382 GKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLT 441
           GK  GAF +   P   PY+LLN+ G  +DV T+AHE GH IH + +S+ + IL  ++ L 
Sbjct: 359 GKTGGAFCYTVAPKRTPYVLLNFDGMMRDVSTMAHEFGHAIHSMFASD-KPILVAHAPLP 417

Query: 442 LAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERR 501
           LAETAS+FGE L  +  +     ++++KI LA +I+D+  +++RQ  F  FE++ H +  
Sbjct: 418 LAETASVFGEML-LNEEIYKKLKRQKKKIFLAEQIDDIYATVMRQAFFTLFEIEAHNQIV 476

Query: 502 STGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLV 561
             G +    I++++++  K   G +  +S+ ++   W+ +PHF  + FY YAY+FGN LV
Sbjct: 477 EKG-VTIDNISDLYIKNLKTQFGDSIRISE-DFKWEWLYIPHFYHTPFYCYAYSFGNLLV 534

Query: 562 NSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMID 621
            SLY  ++    + F  KY+ IL AG S+    LL     +++  +FW++G   ++  ID
Sbjct: 535 LSLYQQFREEG-NSFISKYIKILSAGGSEKPETLLKDSGFDITKASFWQQGFDLIKMKID 593

Query: 622 DVEK 625
            +++
Sbjct: 594 KLKE 597


>gi|121535192|ref|ZP_01667007.1| oligoendopeptidase F [Thermosinus carboxydivorans Nor1]
 gi|121306183|gb|EAX47110.1| oligoendopeptidase F [Thermosinus carboxydivorans Nor1]
          Length = 625

 Score =  215 bits (547), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 175/626 (27%), Positives = 295/626 (47%), Gaps = 22/626 (3%)

Query: 9   FFSNA-FFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAF 67
           F ++A FF  A ++S    +  +E + +  +W LED+Y S +  E   D   +++ SL  
Sbjct: 7   FLADAVFFPTAAKTSSTAGLPVREEIPDKYKWRLEDIYASEELWE--QDFAKLKN-SLPQ 63

Query: 68  KTRWEGNLAH-ATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYT 126
              ++G LAH A N   C      +   +      G++ +YA +  + N ++   +    
Sbjct: 64  LAAYKGQLAHSAQNLLKC------LKARDEAGITAGKLYAYARMRRDENSANAKYQALTG 117

Query: 127 DINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDM 186
              A LA+   V  F   EI  + E  L +   Q+    +YS +  N+ + KKH+LS   
Sbjct: 118 KTEALLAEMGAVTAFIEPEIIAMPEEKLNEFRRQEQGLAEYSFYFDNLMRQKKHVLSPAE 177

Query: 187 ECLLSDTSQVGREALKRFFCENIESLRF-KIND---QKIPLTKA-YKSFFDS-DREVRKS 240
           E +LS  S+V + A   F       LRF +I +   Q + L++  ++SF  S DR VR++
Sbjct: 178 EEILSRASEVTQAAENIFNMLAHADLRFPQIQNESGQTVTLSEGRFRSFIMSPDRRVRQA 237

Query: 241 AAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQS 300
           A   L +T+ +  + F+       K      R RKY    ++    +NV   V   L+ +
Sbjct: 238 AFTGLFNTYKQFRNTFAATLGGSVKKNIFYTRTRKYNSTLEAALEPDNVPLAVYNNLIAT 297

Query: 301 VKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSP 360
           V  + P   HRY  LKK+ L+LD ++ +D   PL    +  IP++ A  +V ++      
Sbjct: 298 VHEHLP-LLHRYVALKKQALRLDEIHMYDLYVPLVSDVRITIPYDEALQMVQEALKPLGA 356

Query: 361 QMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGH 420
           + S I  K  T  WID  +  GK +GA++ GT   VHP++LLNY  +  DV TLAHE+GH
Sbjct: 357 EYSEILNKGLTSGWIDVYENQGKQTGAYSWGTY-GVHPFVLLNYNDRYDDVSTLAHEMGH 415

Query: 421 GIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDML 480
            IH   S   Q   T + +   AE AS   E L  D +L+    K ++   L   +E + 
Sbjct: 416 AIHSYYSHANQPYATASYTTFTAEVASTTNEILLIDHMLKVTHDKRQKLYFLNQYLEAVR 475

Query: 481 NSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMM 540
            ++ RQ  F +FE  L+ +      I    ++++W E  ++  GP   + D E    W  
Sbjct: 476 GTVYRQTMFAEFEKLLYEKAEDGETITADMLDDLWRELNRKYYGPDI-VVDEEIAVEWAR 534

Query: 541 VPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLN 600
           +PHF    FYVY Y  G     +L +  +    +  +++Y+  L++G   +   +L    
Sbjct: 535 IPHFY-WHFYVYQYVTGYAAATALAEQIQREG-EPAQKRYIEFLKSGGCDYSINILKRAG 592

Query: 601 INLSDPNFWERGLQTVEKMIDDVEKM 626
           +++S P      L    + ++++EK+
Sbjct: 593 VDMSSPQPVAVTLNKFGERLNELEKL 618


>gi|217077257|ref|YP_002334975.1| oligoendopeptidase F [Thermosipho africanus TCF52B]
 gi|217037112|gb|ACJ75634.1| oligoendopeptidase F [Thermosipho africanus TCF52B]
          Length = 579

 Score =  214 bits (546), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 164/598 (27%), Positives = 281/598 (46%), Gaps = 33/598 (5%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           +W+L   Y + D ++I  D+E I   +  F  ++E  +    + +   +      E+E++
Sbjct: 2   KWDLTVFYETPDIEKIKKDLEDIFKRATNFVEKYEKLINENISAEQVRNY---FKEFEQL 58

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFY-------TDINAKLADFEKVLIFFALE-INTL 149
            E   +   Y+ L ++ N +    ++ Y       + I+  L+  +      + E +++L
Sbjct: 59  MEDGLKPIQYSSLLFSENTTDKVAQQLYGISEQYGSKISEILSPLQSAFAQLSEEKLDSL 118

Query: 150 DEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENI 209
            + + E SYA           I+ I+  KKH+LS D E +L+ TS   R+AL   + +  
Sbjct: 119 SKEISEYSYA-----------IEKIKLEKKHILSKDAERILAATSISRRDALSNLYEKLT 167

Query: 210 ESLRFKIN----DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAK 265
            S RFKI     ++++  ++        D  +RK A K     +           N + K
Sbjct: 168 SSYRFKIEIDGEEKELSGSQIRALRRSPDGNLRKKAMKLFFERYKADEITIGETYNIVVK 227

Query: 266 DEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTM 325
           D + + R R Y K    R+L N V    +E L++ +        H+YY+ K + +  + +
Sbjct: 228 DYDTEARLRNYPKPISMRNLENAVSDESVEKLIE-ITTENTNIVHKYYKWKAQEMN-EEL 285

Query: 326 YFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGS 385
              D  AP   +S+    F+ A+++VL +Y  F  +   I E FF  N I +    GK  
Sbjct: 286 TLADIYAPF-SSSEKKYTFDEAKEIVLDAYYSFDEKAGKIVESFFKENRIHSEIVPGKVG 344

Query: 386 GAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAET 445
           GAF       + P++LLN+ G   DVMTLAHELGHG+H  L S+ Q  +  ++ LT+AE 
Sbjct: 345 GAFCSYYTTQIKPFVLLNFNGNINDVMTLAHELGHGLHGTL-SQKQSFINYHTPLTMAEL 403

Query: 446 ASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGD 505
           AS+FGE L FD +      K E+K  +A+ +ED   ++ RQ  F  FE++ H      G 
Sbjct: 404 ASVFGEFLVFDKIKNELEGK-EKKHFIASTLEDTFATMFRQNMFARFEIQAHELIEKNGM 462

Query: 506 IPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLY 565
                +++++    K     +  + + EY   W  +PH   + FYVYAY + NCLV  LY
Sbjct: 463 ASFEELSKLYENELKIMFADSVKIPE-EYTYEWSSIPHIFHTPFYVYAYNYANCLVIGLY 521

Query: 566 DIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDV 623
             Y       F  KY+ +L +G       LL  + I+++   FW+   + +  M++++
Sbjct: 522 QKY-LEMGKKFVPKYIELLESGGKDSPERLLNKIGIDITKEEFWQGAFEFLNNMLNEI 578


>gi|196249193|ref|ZP_03147892.1| oligoendopeptidase F [Geobacillus sp. G11MC16]
 gi|196211422|gb|EDY06182.1| oligoendopeptidase F [Geobacillus sp. G11MC16]
          Length = 616

 Score =  213 bits (542), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 168/599 (28%), Positives = 276/599 (46%), Gaps = 32/599 (5%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           WNL D+YPS    E   D + + + +L     +EG L  A       SL       E+  
Sbjct: 29  WNLADIYPS--EAEWMRDYQAVNN-ALPKLAAFEGKLNDAKTIAKLFSLN------EQTA 79

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
             + +++ YA L  + N+   T  +    + A    + +   F   E+  L E  L++  
Sbjct: 80  RKLEKLSLYAHLKRDLNIKDKTAAQLEAKVKALATQYAEKTAFIEPELLALPEQTLKKLQ 139

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENI--------- 209
              PL   Y  +   +R+ K H L+   E LL+  +    EA      ENI         
Sbjct: 140 NSKPLK-AYRYYFTELREQKPHTLTKREERLLAKLAPALGEA------ENIYDHASRGDY 192

Query: 210 ESLRFKINDQK-IPLTKA-YKSFFD-SDREVRKSAAKALSHTFNKSSHIFSFITNTLAKD 266
           E    ++ D K + LT   Y +     DR  RK+A +A + ++       +       K 
Sbjct: 193 EPPSVRMPDGKTVTLTDHNYATLLQHPDRRYRKAAFEAKAKSYEALEQTAAATLYASVKA 252

Query: 267 EEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMY 326
           +E+    R+Y    D+   +++V   V + L+ +V  + P T HRY EL+K+ L LD ++
Sbjct: 253 DELYAEIRRYPSGLDAALAADDVPKKVFDNLITAVHRHLP-TLHRYIELRKQALGLDRVH 311

Query: 327 FWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSG 386
            +D   PL G +++ IP E A+ L+L+              + FT  W+D      K +G
Sbjct: 312 SYDLYVPLAGKTEESIPVETAKTLLLEGLRPLGDDYIEHVHRAFTERWLDVYPRPKKYTG 371

Query: 387 AFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETA 446
            +  G     HP+ILLNY G    V+T+AHELGH +H V ++ TQ    +  S+  AE A
Sbjct: 372 GYNTGAY-DTHPFILLNYNGSLDSVLTMAHELGHAMHSVYTNRTQPYHYSGHSIFTAEVA 430

Query: 447 SIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDI 506
           S   E L  D L + A +KEE+  LL  +IE +  ++  Q+ + +FE  +H + R  G +
Sbjct: 431 STANEWLMLDYLYKQAKTKEEKFRLLIEQIEQIRGTLYTQVMYSEFERVIHDKARQGGSL 490

Query: 507 PTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYD 566
               +N +WLE  K   GPA+  +D      W+ +PHF + +FYVY YA       ++  
Sbjct: 491 TADELNHLWLELLKTYYGPAY-AADPGAARGWLRIPHFYD-AFYVYKYATSLAASYAIVS 548

Query: 567 IYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEK 625
             K++      ++Y   LR+G S     LL    ++++     ER L+   K++D+++K
Sbjct: 549 DIKADKSGEALKRYKQFLRSGTSDDPLRLLKRAGVDMTSSEPVERVLRHFAKLVDELDK 607


>gi|138895360|ref|YP_001125813.1| oligoendopeptidase F [Geobacillus thermodenitrificans NG80-2]
 gi|134266873|gb|ABO67068.1| Oligoendopeptidase F [Geobacillus thermodenitrificans NG80-2]
          Length = 616

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 166/599 (27%), Positives = 277/599 (46%), Gaps = 32/599 (5%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           WNL D+YPS    E   D + + + +L     +EG L       +  ++    A  E+  
Sbjct: 29  WNLADIYPS--EAEWMRDYQAVNN-ALPKLAAFEGKL------NDAKTIAKLFALNEQTA 79

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
             + +++ YA L  + N+   T  +    + A    + +   F   E+  L E  L++  
Sbjct: 80  RKLEKLSLYAHLKRDLNIKDKTAAQLEAKVKALATQYAEKTAFIEPELLALPEQTLKKLQ 139

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENI--------- 209
              PL   Y  +   +R+ K H L+   E LL+  +    EA      ENI         
Sbjct: 140 NSKPLK-AYRYYFTELREQKPHTLTKREERLLAKLAPALGEA------ENIYDHASRGDY 192

Query: 210 ESLRFKINDQK-IPLTKA-YKSFFD-SDREVRKSAAKALSHTFNKSSHIFSFITNTLAKD 266
           E    ++ D K + LT   Y +     DR  RK+A +A + ++       +       K 
Sbjct: 193 EPPSVRMPDGKTVTLTDHNYATLLQHPDRRYRKAAFEAKAKSYEALEQTAAATLYASVKA 252

Query: 267 EEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMY 326
           +E+    R+Y    D+   +++V   V + L+ +V  + P T HRY EL+K+ L LD ++
Sbjct: 253 DELYAEIRRYPSGLDAALAADDVPKKVFDNLITAVHRHLP-TLHRYIELRKQALGLDRVH 311

Query: 327 FWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSG 386
            +D   PL G +++ IP E A+ L+L+              + FT  W+D      K +G
Sbjct: 312 SYDLYVPLAGKTEESIPVETAKTLLLEGLRPLGDDYIEHVHRAFTERWLDVYPRPKKYTG 371

Query: 387 AFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETA 446
            +  G     HP+ILLNY G    V+T+AHELGH +H V ++ TQ    +  S+  AE A
Sbjct: 372 GYNTGAY-DTHPFILLNYNGSLDSVLTMAHELGHAMHSVYTNRTQPYHYSGHSIFTAEVA 430

Query: 447 SIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDI 506
           S   E L  D L + A +KEE+  LL  +IE +  ++  Q+ + +FE  +H + R  G +
Sbjct: 431 STANEWLMLDYLYKQAKTKEEKFRLLIEQIEQIRGTLYTQVMYSEFERVIHDKVRQGGSL 490

Query: 507 PTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYD 566
               +N +WLE  K   GPA+  +D      W+ +PHF + +FYVY YA       ++  
Sbjct: 491 TADELNHLWLELLKTYYGPAY-AADPGAARGWLRIPHFYD-AFYVYKYATSLAASYAIVS 548

Query: 567 IYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEK 625
             K++      ++Y   LR+G S     LL    ++++     ER L+   K++D+++K
Sbjct: 549 DIKADKSGEALKRYKQFLRSGTSDDPLRLLKRAGVDMTSSEPVERVLRHFAKLVDELDK 607


>gi|325120023|emb|CBZ55576.1| putative oligoendopeptidase F [Neospora caninum Liverpool]
          Length = 506

 Score =  207 bits (528), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 145/478 (30%), Positives = 234/478 (48%), Gaps = 21/478 (4%)

Query: 154 LEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQ-VGREALKRFFCENIESL 212
           LEQ  + D    +Y +++  IR   + LL   +E  L   +     +   + + + + S 
Sbjct: 6   LEQLLSTDERVRQYYSFVDRIRTQGQFLLDETIEKALDIRAPWTSPDIAVKAYRKQLSSS 65

Query: 213 RFKINDQK--IPLTKAYKSFFDSDREVRKSAAKALSHTF--NKSSHIFSFITNTLAKDEE 268
            F++  Q      T+  +     ++E+R    +A+      N+     S   N +     
Sbjct: 66  TFRLAGQPDVFSYTQIRELMRSENQEIRHHGQQAIKDGIVENRIDKFASLALNMVVGSWS 125

Query: 269 IQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWL----KLDT 324
           I+ R R Y      R++ N +   +++AL+ +VK    + + R   LKK+ L    K+  
Sbjct: 126 IETRERGYPSPRSRRNVLNRISDEIVDALIAAVKKEGVELTRRALLLKKQLLTATGKIKA 185

Query: 325 MYFWDRLAPLP---GTSQDI---IPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAP 378
             F DRLAPL     +S D    IP+  A + V + YA FSP    + E       IDA 
Sbjct: 186 FSFVDRLAPLTLSRDSSMDANARIPWCQAVEKVKKGYASFSPVFVRLFENLLKEGRIDAA 245

Query: 379 QYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNS 438
             +GK +GAF  G  P+  P+IL+ + G   +V TLAHE GH IHF+L+ E QG L  + 
Sbjct: 246 PAEGKQTGAFCSGGTPATGPFILMTHTGVKANVQTLAHEAGHAIHFLLAYE-QGNLQYHP 304

Query: 439 SLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHT 498
            L LAETAS+ GET+ F  LL    S ++   +L   ++ ++ +I RQ+SF  FE  +H 
Sbjct: 305 PLPLAETASLMGETIVFYHLLDQTDSPQKVLEMLIEHVDSLVGTITRQVSFDRFEELVH- 363

Query: 499 ERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSF---WMMVPHFIESSFYVYAYA 555
           E R +G +     +++WL++ +E  G   D+ D +Y      W  V HF ++ FYVY+YA
Sbjct: 364 EARLSGIVGDEDFDQMWLQSTREFFGDEGDVFD-DYAGIEKDWSTVHHFTKAPFYVYSYA 422

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
             + LV SL      N    F+EK+++ L+AG++      L P  ++   P+FW   +
Sbjct: 423 LADLLVGSLLAARSKNNGSDFEEKFISFLQAGDTADLETALRPFGLDPKTPSFWREAI 480


>gi|257460431|ref|ZP_05625532.1| putative oligoendopeptidase F [Campylobacter gracilis RM3268]
 gi|257441762|gb|EEV16904.1| putative oligoendopeptidase F [Campylobacter gracilis RM3268]
          Length = 637

 Score =  207 bits (526), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 141/423 (33%), Positives = 211/423 (49%), Gaps = 25/423 (5%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGA-----AIAE 93
           WNL +L+   +  E S  ++    ++  F+ +++  L         H+L A     A+  
Sbjct: 3   WNLGELFA--NEAEFSGAIDSASAQARDFELKFKDKL---------HALSAEEFLDALEL 51

Query: 94  YERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEAL 153
           YE I E IG+I S+A L +  + S    +           D  + L+FF LE N LD A 
Sbjct: 52  YESISEQIGKIMSFAHLRFARDTSLGAQQ---AKTEQACNDISQSLLFFELEFNELDAAK 108

Query: 154 LEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLR 213
            ++  A      ++  ++  +++ K H LS   E +L  TS V  EA  R F E++  + 
Sbjct: 109 QDEFIAGGG---RFRYYLSLLKRRKAHQLSLPQESVLLKTSPVSGEAFSRLFDESMARMS 165

Query: 214 FKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRW 273
           F    QK+   +       SDREVRK AA +LS    ++SH+  +I N +  D +I+   
Sbjct: 166 FDFRGQKLGEEEILSLLHSSDREVRKDAAASLSAVLEQNSHLLGYIYNMIKTDLKIRCEL 225

Query: 274 RKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAP 333
           R Y+K     H  N +    ++AL+   +  +     ++Y  K++ L  D +Y +DR AP
Sbjct: 226 RGYDKAEAVMHEENQINIASVDALIAETERSFALVG-KFYAKKREILGYDALYDYDRYAP 284

Query: 334 LPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTI 393
           L G   +   F  A+ +VL ++ KFSP+   IA   F  NWIDA     K SGAF+H   
Sbjct: 285 LGGDESEF-SFGQAKQIVLAAFEKFSPKFKQIALIAFERNWIDAMPTQNKQSGAFSHSGS 343

Query: 394 PSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETL 453
              HP++LLN+  K +DV TLAHELGH IH  LS    G   + + LT AETAS+F E L
Sbjct: 344 RDTHPFVLLNFTRKRRDVFTLAHELGHAIHQYLSYGV-GYFNSFTPLTTAETASVFCEML 402

Query: 454 TFD 456
            FD
Sbjct: 403 VFD 405



 Score =  108 bits (269), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 90/167 (53%), Gaps = 4/167 (2%)

Query: 456 DSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIW 515
           D+  Q A+ K   + +LA KIED+  ++ RQI F  FE ++H    S  ++   R+ E+W
Sbjct: 471 DTPSQTANDKAALRAMLAAKIEDIFATLYRQIGFTTFERRVHA---SADELSIERLGELW 527

Query: 516 LETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDC 575
           +E  ++       L D  Y S+W  +PHF+ + FY Y+YA+   LV + Y +YKS  ++ 
Sbjct: 528 MEESRKMFAGELILQD-HYKSWWSYIPHFVHTPFYCYSYAYAQLLVLAFYGLYKSGRLEN 586

Query: 576 FKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
           F + Y   L +G S    +L+     +++   FW  G++ V  ++D+
Sbjct: 587 FVQIYTEFLSSGGSDAPQKLVAKFGFDINKSEFWRIGIEQVAALVDE 633


>gi|284116397|ref|ZP_06386726.1| Peptidase M3B, oligoendopeptidase-related clade 3 [Candidatus
           Poribacteria sp. WGA-A3]
 gi|283829517|gb|EFC33874.1| Peptidase M3B, oligoendopeptidase-related clade 3 [Candidatus
           Poribacteria sp. WGA-A3]
          Length = 449

 Score =  206 bits (524), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 140/452 (30%), Positives = 230/452 (50%), Gaps = 18/452 (3%)

Query: 182 LSNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQ--KIPLTKAYKS--FFDSDREV 237
           LS   E +++  +  GREAL   +      L F++  +    PL++ + +  F D    V
Sbjct: 2   LSEAEEQIINVKNTTGREALDSLYDVITNGLTFQLKSRYGSQPLSREHLTVHFRDPSARV 61

Query: 238 RKSAAKALSHTFNKSSHIFSFITNTLAKD--EEIQDRWRKYEKIADSRHLSNNVEPYVIE 295
           R+ A   L   ++  S     I   L  D   E  D  R Y      R+L N++    + 
Sbjct: 62  RRQAYDELFRVYSNHSDTLGDIYKALVTDWKNERLD-LRGYASPIAVRNLDNDIPDKAVS 120

Query: 296 ALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSY 355
            L+Q+ ++        Y+ +K +      M  +D  AP P   + + PF+ A  LV  +Y
Sbjct: 121 TLLQTCRDNR-DVFQEYFRIKARICGFPKMTRYDLYAP-PRIKKGVYPFDQALKLVFDAY 178

Query: 356 AKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLA 415
            +FSP ++  A + F    +DA    GK  GAF +  +PS+ PY+LLNY G  +DV TLA
Sbjct: 179 QQFSPTLADHARQVFAERHVDAAPSPGKMGGAFCYSVLPSLTPYVLLNYSGDARDVATLA 238

Query: 416 HELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANK 475
           HELGH +H +++ +   + T +++L LAETAS+FGE L  D+LL  A+    ++ LL  +
Sbjct: 239 HELGHAVHSMMARK-HSVFTFHATLPLAETASVFGEQLLSDALLADAAGARVKQRLLLGQ 297

Query: 476 IEDMLNSIVRQISFYDFELKLH--TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLE 533
           ++D+  +I+RQ  F +FE + H    + +T D     + + ++   +E  G    +S   
Sbjct: 298 LDDLYATILRQAYFVEFENQAHDLIAQGTTVD----GLAQAYVHLLREQFGRTMTISK-A 352

Query: 534 YGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYS 593
           +   W+ +PH   S FY YAY+FGN LV +L+  YK      F  +YL +L  G S+   
Sbjct: 353 FQWEWLAIPHIFRSPFYCYAYSFGNLLVLALFQRYKKEG-KPFIPRYLELLSHGGSQSPE 411

Query: 594 ELLLPLNINLSDPNFWERGLQTVEKMIDDVEK 625
            +L PL I+L   +FW+ G   + ++++ +EK
Sbjct: 412 TMLKPLGIDLCKKSFWQAGFNRIRELVEALEK 443


>gi|260584975|ref|ZP_05852718.1| oligoendopeptidase F [Granulicatella elegans ATCC 700633]
 gi|260157281|gb|EEW92354.1| oligoendopeptidase F [Granulicatella elegans ATCC 700633]
          Length = 579

 Score =  206 bits (524), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 163/588 (27%), Positives = 278/588 (47%), Gaps = 25/588 (4%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
            W LEDLYPS +SQE   D+E  +    A K ++E      T + +   +   +   E  
Sbjct: 3   EWTLEDLYPSFESQEFKQDVESYK----ALKGKFES----LTLEDSIEGITQVVKLLEES 54

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQS 157
             L GR+ +Y  L+   + +  T  +    +    AD +      +  + T+     +  
Sbjct: 55  TVLTGRLYNYIHLTLATDTTHETATQVEVQLAGVSADLQATYAKVSKFLGTI-----QTD 109

Query: 158 YAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIN 217
              DP   +Y  + +  +K   HLLS+++E +L+  S  G +A  + F     S + +  
Sbjct: 110 ITTDPFLAEYRYYFEEAKKEAAHLLSDELEEVLAKMSISGGKAWSQLFDFMWSSAQGEYK 169

Query: 218 DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYE 277
            + + L++     +DSD EVRKSA +A    ++      +F  N + K+     + R +E
Sbjct: 170 GEVVTLSEIRGKAYDSDAEVRKSAYEAELKMYDAIKEPIAFSLNHIKKEVLTTSQLRGFE 229

Query: 278 KIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDT-MYFWDRLAPLPG 336
                   ++ +    ++AL+++++ Y P    +Y   K   L  +  + F+D  AP+ G
Sbjct: 230 SPLAHTLEASRMSHETLDALLEAIREYLPNF-RKYLRHKAALLGHENGLPFYDLFAPV-G 287

Query: 337 TSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSV 396
            S      E ++D +++++  FS  ++ + E+FF  ++ID     GK  GAF    +P +
Sbjct: 288 NSSRTFTVEESKDYLIENFKTFSADLAEMTEEFFDKHYIDFYPRKGKVGGAFC-ANLPMI 346

Query: 397 -HPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTF 455
               +L N+ G   DV+TLAHELGH  H  L  E    L  + S+ +AETAS F E +  
Sbjct: 347 KQSRVLTNFTGSLSDVVTLAHELGHAYH-GLHIENHRPLNQDYSMPVAETASTFNENIIM 405

Query: 456 DSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIW 515
           ++ ++ AS  EE+  L+ ++++D    IV   S Y FE  +  E R    + +  + E+ 
Sbjct: 406 NTAIKEASD-EEKIALIESQLQDTTQIIVDIYSRYLFETAVF-ENRKQSFMFSKDLEEMM 463

Query: 516 LETQKESLGPAFDLSDLEYGSFWMMVPHFIES--SFYVYAYAFGNCLVNSLYDIYKSNTV 573
           L  QKE+ G   D S L +   W   PH+  +  SFY + YAFG      LY IY+    
Sbjct: 464 LSAQKEAYGDGLDQSYL-HPYMWACKPHYYSTGLSFYNFPYAFGGLFSKGLYAIYQEQP- 521

Query: 574 DCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMID 621
           + F EKY  +LRA       +    L +++S P FW++ L  V + I+
Sbjct: 522 EGFVEKYQELLRATTVSSVEDTAKVLGVDVSTPEFWKKALAEVAESIE 569


>gi|239826981|ref|YP_002949605.1| oligoendopeptidase F [Geobacillus sp. WCH70]
 gi|239807274|gb|ACS24339.1| oligoendopeptidase F [Geobacillus sp. WCH70]
          Length = 622

 Score =  206 bits (523), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 163/604 (26%), Positives = 278/604 (46%), Gaps = 35/604 (5%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           +WNL D+Y S  +     D + +  ++L   + +EG LA A+N     +L       ERI
Sbjct: 32  QWNLADIYVSEAN--FKRDYQAVA-DALPKLSSYEGKLARASNVAKLFALN------ERI 82

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQS 157
              + +++ YA L  + N+   T       +   ++D+     F   E+ +L E  L + 
Sbjct: 83  ARKLEKLSLYAHLKQDLNIEDKTAAHLKAQVETLISDYAAKTAFIEPELLSLSERTLAKL 142

Query: 158 YAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENI-------- 209
               PL   Y  + + +R+ KKH LS   E LL+  S +  +       ENI        
Sbjct: 143 QKSKPLK-PYRYYFEELRERKKHTLSKREEQLLAKLSPIMSD------PENIYNNAARGD 195

Query: 210 -ESLRFKINDQK-IPLTKA--YKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAK 265
            +    +  D K + LT     K+    DR  RK A +    ++    +  +       K
Sbjct: 196 YDPPSVRTPDGKTVSLTDENYTKALEHPDRNYRKRAFQTRFQSYETIENTSAATLYASVK 255

Query: 266 DEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTM 325
            +E+  + RKY+   D+   +++V   V   L+ +V  + P + HRY EL+KK L +D +
Sbjct: 256 ADELYAKARKYKSGLDAALSADDVPKQVFTNLISTVNTHLP-SLHRYVELRKKALGVDRV 314

Query: 326 YFWDRLAPLPGTS---QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDG 382
           + +D   PL   +   +   PFE A+ L+L+              + F   WID      
Sbjct: 315 HTYDMSVPLVEETIAKKMKFPFETAQSLILEGLKPLGDDYIQNVRRAFEQRWIDVYPRPK 374

Query: 383 KGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTL 442
           K +G +  G     HP+ILLNY G    ++T AHE+GH ++ V +++TQ    +  S+  
Sbjct: 375 KYTGGYNTGAY-DTHPFILLNYDGSLDGLLTTAHEIGHAMNSVYTNKTQPYHYSRQSIFT 433

Query: 443 AETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRS 502
           AE AS   E L  D  L+ A + EE+  LL  +I+ +  ++  Q+ + +FE  +H + R 
Sbjct: 434 AEVASTANEWLMMDYFLKQAKTDEEKLYLLNQQIDQIRGTLYTQVMYSEFEQAIHDKVRQ 493

Query: 503 TGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVN 562
            G +    +NE+WL   K+  GPA+  +D E    W+ +PHF + +FYVY YA       
Sbjct: 494 GGSLTAAELNELWLRLLKKYYGPAY-AADPEAARGWLRIPHFYD-AFYVYKYATSLAASF 551

Query: 563 SLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
            L    K++      ++YL  LR+G S     LL    ++++ P   E  L   + ++ +
Sbjct: 552 ELVKQMKADETGEATKRYLQFLRSGTSDDPIRLLQKAGVDMTSPKPLENLLSYFDSLVRE 611

Query: 623 VEKM 626
           +E++
Sbjct: 612 MEQL 615


>gi|258515238|ref|YP_003191460.1| oligoendopeptidase F [Desulfotomaculum acetoxidans DSM 771]
 gi|257778943|gb|ACV62837.1| oligoendopeptidase F [Desulfotomaculum acetoxidans DSM 771]
          Length = 594

 Score =  206 bits (523), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 175/598 (29%), Positives = 290/598 (48%), Gaps = 27/598 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  ++PS  + E  + ++ I+ E  +  T  +GNL       +  +L AA+A+ +R+ 
Sbjct: 11  WDLTAIFPSDTAWE--DALKQIQ-ELTSKVTSMQGNLT-----VSAENLYAALADIDRLS 62

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
             + +  SYA L+++ ++   T +  Y  I+A  +  +  L F   E+  L+E       
Sbjct: 63  IKLEQAYSYARLAFDTSMGDNTAKTRYERIDALSSGIDAQLSFVEPELLQLNEESFLSYK 122

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF---- 214
            Q P    YS   + +  +KKH+LS D+E +L+  + +GR   K F    +  L F    
Sbjct: 123 KQLPELEIYSFKFEKLFALKKHVLSPDIEQILTKMNSLGRSFKKIFDDIAVNDLDFPEVA 182

Query: 215 KINDQKIPLTKA--YKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNT---LAKDEEI 269
             + QK    +A   K     DR +R++  K L +T+  +SH  S IT+T     K+   
Sbjct: 183 GSDGQKFTAGEANYLKCMTSQDRVLRENYFKGLLNTY--ASHKNS-ITSTYYGAVKNSIF 239

Query: 270 QDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWD 329
               R +    D    SN + P V + L+ +V++   K   RY  L++K L L  ++F+D
Sbjct: 240 TAGIRNFSSSLDMALSSNFIPPGVYDNLISTVRSNVDKL-QRYIALRQKILGLPEIHFYD 298

Query: 330 RLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFA 389
              P+         FE ARD+VL++ A        I ++ F+  WID     GK SGA+A
Sbjct: 299 LFVPVVKDMNKTYTFEEARDIVLEALAVLGEDYVGILKRAFSERWIDVYPAKGKRSGAYA 358

Query: 390 HGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIF 449
            G I   HP+ LLN+ G  +D+ TLAHELGH +H   S+E Q  + ++  +  AE AS  
Sbjct: 359 MG-IYGTHPFSLLNFSGTVEDIFTLAHELGHVMHSYFSNENQPYINSHYVIFTAEVASTV 417

Query: 450 GETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTH 509
            ETL  + LL+ ++S++E+  LL+  ++ + +++ RQ  F DFE ++H        +   
Sbjct: 418 NETLLLNFLLKKSTSEQEKANLLSMHLDSIRSTLYRQTFFADFEKQVHETVEKNQPLTPE 477

Query: 510 RINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG-NCLVNSLYDIY 568
            +  ++ +  K   G  F + D E    W+ +PHF  S FYVY YA G +  ++    I 
Sbjct: 478 TLQTVYKDLYKLYYGENFVI-DTELTCEWLRIPHFY-SPFYVYQYATGISAAISIAAGIL 535

Query: 569 KSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
             N    F   Y N L++G SKH   LL    +++S P   +  L   E  +  +  +
Sbjct: 536 NKNR--SFLTGYKNFLKSGGSKHPINLLQEAGVDMSTPQPIQDALNDFENSVKQLSSI 591


>gi|159898341|ref|YP_001544588.1| peptidase M3A and M3B thimet/oligopeptidase F [Herpetosiphon
           aurantiacus ATCC 23779]
 gi|159891380|gb|ABX04460.1| peptidase M3A and M3B thimet/oligopeptidase F [Herpetosiphon
           aurantiacus ATCC 23779]
          Length = 597

 Score =  204 bits (520), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 150/544 (27%), Positives = 255/544 (46%), Gaps = 19/544 (3%)

Query: 90  AIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTL 149
           AI ++E I   I R++ YA L    +  +P  +   T I+  +       +FF L    L
Sbjct: 63  AIRDFETITTFIKRLSGYAELWIAEDTQNPHAQACATLIDIVITKATNKTLFFPLWWKNL 122

Query: 150 DEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFF--CE 207
            E +        P   +Y+ W++ +R    H L   +E  ++  +  G  AL+  +    
Sbjct: 123 PEDVAASILGDIP---QYAYWLRQMRSAVIHTLPEPVEQAINLKNSTGVTALRALYDAIT 179

Query: 208 NIESLRFKINDQKIPLTKAYKSFFDS--DREVRKSAAKALSHTFNKSSHIFSFITNTLAK 265
           +  S   + + Q   LT +    + S  D  VR  A   L   +++ + +   I  TL +
Sbjct: 180 SRYSFTLEADGQIHHLTDSGIWGYASHPDPAVRDRAFVELYRVYSQDASLLGRIYFTLVQ 239

Query: 266 D---EEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKL 322
           D   E I+   R+Y      R+  N++   +IE L +  +   P   HRY+ LK +WL +
Sbjct: 240 DWYQEYIE--LRRYSSPLAVRNQMNDIPDALIETLFRVCRTNTP-LFHRYFRLKARWLGM 296

Query: 323 DTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDG 382
           + M   D  AP+    Q    ++ A ++ L ++  F P    +A + F  N +D+    G
Sbjct: 297 ERMRRCDLAAPIITKKQSYT-WKQAVEMTLATFESFDPLFYQLAHRIFQANHVDSEVRSG 355

Query: 383 KGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTL 442
           K  G +     P++ P++ +++ G+  D+  L HE GH IH +L +E Q +L    S+ L
Sbjct: 356 KRRGCWCLDFGPTITPWVQIDFNGRVDDIAALIHEFGHAIHGML-AEHQSVLQYAPSIPL 414

Query: 443 AETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRS 502
           AE  ++F E L  D LLQ     E R  L   ++ D    + RQI F  FE   H   + 
Sbjct: 415 AEVGALFCELLFADHLLQQTHDPEVRIGLRFKQLNDSFAFLHRQIYFTFFECTAHDLIQQ 474

Query: 503 TGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVN 562
              I    + + +L+T +E  G   D+ D      W ++ H     FY+Y+YAFG  L  
Sbjct: 475 GASIDD--VAQAYLDTVREEFGDTIDIPDAMRWE-WTLIFHLFHYPFYMYSYAFGQLLAL 531

Query: 563 SLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
           +LY  Y+    + FK+++  ILRAG+S H   +L    +N++DP FW+ G   ++ M++D
Sbjct: 532 ALYQQYRQEG-NSFKDRFFEILRAGSSDHPVAILSKAGVNIADPLFWQGGYDVIQIMLED 590

Query: 623 VEKM 626
           +E++
Sbjct: 591 IEQI 594


>gi|329765529|ref|ZP_08257105.1| pepF/M3 family oligoendopeptidase [Candidatus Nitrosoarchaeum
           limnia SFB1]
 gi|329137967|gb|EGG42227.1| pepF/M3 family oligoendopeptidase [Candidatus Nitrosoarchaeum
           limnia SFB1]
          Length = 590

 Score =  202 bits (515), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 164/599 (27%), Positives = 292/599 (48%), Gaps = 23/599 (3%)

Query: 36  LPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYE 95
           L +W+L +L    D +  +   +  E E LA   ++E   +    + +       + + E
Sbjct: 6   LDKWDLSELV--KDPKSPAFQKQITELEGLA--KKFEKIKSKLNPKMSSKEFMNILHQIE 61

Query: 96  RICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLE 155
           +I E + +I  YA L Y+ N  S       T ++   ++    ++FF L   T  +    
Sbjct: 62  KISEKMNQIGGYASLEYSSNTQSDEATSLMTRMSKLGSEISNKILFFDLWWKTKVDDSNA 121

Query: 156 QSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFK 215
           +   +D   L  S ++ + R   K+ LS   E +++     G  AL + + +   + ++K
Sbjct: 122 KRLIKDSGEL--SEYLNHKRLFAKYALSEPEEKIINTLDVTGISALVKLYDKMTSAYQYK 179

Query: 216 I---NDQKIPLTKAYKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLA---KDEE 268
           +   N  K    +   +F  S + + R++A K +   ++++  +   I   +    KDE 
Sbjct: 180 MKIGNKTKTMTREEITNFIRSTNPKTRETAYKTILTRYSENKGVLGEIYQNIVLNWKDEG 239

Query: 269 IQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFW 328
           I+   R Y+     R++ N+V+   IE+L+   +   P    +++  K K LK+  +  +
Sbjct: 240 IE--IRGYKSPISMRNIGNDVDDKTIESLLTVCRKNSP-VFQKFFVQKAKMLKMKKLRRY 296

Query: 329 DRLAPLPGTSQDI-IPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGA 387
           D  AP     ++    ++ +  LV +S  +FSP++   A+K F    +D+    GK  GA
Sbjct: 297 DLYAPSAANIKEKNYQYDKSVKLVFESLGRFSPKLEEFAKKVFNEKHVDSSIRPGKRDGA 356

Query: 388 FAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETAS 447
           F     P + P++LLN+ GK +DV TLAHELGH +H   +++ + IL   + L LAETAS
Sbjct: 357 FCSTLTPKITPFVLLNFTGKTRDVFTLAHELGHAVH-SQAAQNRSILVQEAPLPLAETAS 415

Query: 448 IFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIP 507
            F E L +D+L    +   E+K +L+ KI+D+  +I+RQ  F  FE+  H E+   G   
Sbjct: 416 TFSELLLYDNLSDKITD-NEKKTMLSEKIDDLYATIMRQAYFTIFEVAAH-EQIGKG-TT 472

Query: 508 THRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDI 567
              I++ +++  KE  G +  +S+ ++   W  +PHF  + FY YAY+FGN L  SL+  
Sbjct: 473 VDEISKTYIQNLKEQFGRSVAISE-DFAVEWSCIPHFYHTPFYCYAYSFGNLLALSLFQR 531

Query: 568 YKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           YK      F   Y+ IL AG S+   +LL    ++++   FW+ G   VE  +  + K+
Sbjct: 532 YKKEG-SSFVPSYIEILAAGGSEKPEKLLARHGLDITSQKFWQEGFDYVENQVKILSKL 589


>gi|303240135|ref|ZP_07326656.1| oligoendopeptidase F [Acetivibrio cellulolyticus CD2]
 gi|302592404|gb|EFL62131.1| oligoendopeptidase F [Acetivibrio cellulolyticus CD2]
          Length = 602

 Score =  202 bits (515), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 166/603 (27%), Positives = 285/603 (47%), Gaps = 35/603 (5%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           +WNL D+Y S D  E  ND++ ++ + +    +++G L +         L   +     +
Sbjct: 20  KWNLGDMYQSIDKWE--NDLKTVK-QLIEQIVKYKGTLVNGP-----EILLECLKASNEM 71

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQS 157
             L   I  YA +  + +  +PT +      +    +    + F   +I ++ + +LE  
Sbjct: 72  MALNDMIYVYARMKRDEDNGNPTYQALSDRASTLSTEVYASISFIVPKITSIPQDVLESF 131

Query: 158 YAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI- 216
            +       Y  +   I + K+H+LS   E +L+ +S++   +   F   N   L+F   
Sbjct: 132 ISSSEGLKVYRQFFNEIVRQKEHILSEKEEEILALSSEMASSSRDIFTMFNNADLKFPFI 191

Query: 217 ---NDQKIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
              N + I LTK  Y  F +S DR VRK A  AL  T+ K S+  +       K  +   
Sbjct: 192 KDENGEDIELTKGRYTKFLESEDRRVRKDAFTALYDTYGKFSNTLATSLTGNMKANKFYS 251

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRL 331
              KY+   ++   ++N+   V + L+ +V N  P   HRY +L++K LKL+ ++ +D  
Sbjct: 252 TVSKYKSSLEASLDADNISQEVYDNLIDTVNNNLP-LLHRYLKLRRKALKLEELHMYDLY 310

Query: 332 APLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHG 391
            P+   S+  IP+E A  LV Q  +    +     ++ F   W+D  +  GK SGA++ G
Sbjct: 311 VPIVKESKKNIPYEEALKLVEQGLSPMGDEYIGYLKEGFNSGWVDVFENQGKTSGAYSWG 370

Query: 392 TIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE 451
              S HPY+LLNY G   DV T+AHE+GH +H   +++TQ  + +   + +AE AS   E
Sbjct: 371 AYKS-HPYVLLNYQGTINDVFTIAHEMGHALHSYYTNKTQPYVYSEYKIFVAEVASTVNE 429

Query: 452 TLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRI 511
           +L  + LL+  SSKEE+  LL + +E    +I RQ+ F +FE   H+  +    +    +
Sbjct: 430 SLLMEHLLKNTSSKEEKAYLLNHYLEQFRGTIFRQVMFAEFEKITHSNLQDGEALTADVL 489

Query: 512 NEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG--------NCLVNS 563
           + I+L+  K+       + D      W  +PHF  +SFYVY YA G        N ++N 
Sbjct: 490 SNIYLDLNKKYFEAEVSVDD-AIKMEWARIPHFY-TSFYVYKYATGFSSAVAISNMILNE 547

Query: 564 LYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDV 623
                    +D +KE     L+ G+S +  +LL    ++L  P   +  L   EK++ ++
Sbjct: 548 -----GKPAIDRYKE----FLKGGSSDYPLDLLKRAGVDLYTPKPVQDALDVFEKILTEL 598

Query: 624 EKM 626
           E +
Sbjct: 599 EAL 601


>gi|118575679|ref|YP_875422.1| oligoendopeptidase F [Cenarchaeum symbiosum A]
 gi|118194200|gb|ABK77118.1| oligoendopeptidase F [Cenarchaeum symbiosum A]
          Length = 589

 Score =  202 bits (513), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 149/546 (27%), Positives = 258/546 (47%), Gaps = 28/546 (5%)

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALE-INTLDE 151
           E E I E    +  YA L Y+ +  S       +      AD    L+FF L    T+D+
Sbjct: 59  ELESIHEKTSIVHGYASLDYSADTQSDKATALLSRAGKMGADVANSLVFFDLWWKKTIDD 118

Query: 152 ALLEQSYAQDPLTLKYSAWIKNI----RKIKKHLLSNDMECLLSDTSQVGREALKRFFCE 207
               +        +K S  + N+    R + ++ L+   E +++     G  AL + + +
Sbjct: 119 KNARR-------LIKESGDLANLLSHKRLVARYSLTEPEERIINTLDVTGASALVKLYDK 171

Query: 208 NIESLRFKINDQKIPLTKAYKSFF----DSDREVRKSAAKALSHTFNKSSHIFSFITNTL 263
              +  +++  +    T   +        +D   R+SA ++L   +  +  +   I   +
Sbjct: 172 ITNAFLYEVRVRGKKKTMGREELVTLVRGTDAAARESAYRSLLGKYESNRGVLGEIYQNI 231

Query: 264 A---KDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWL 320
               +DE +    R Y+     R+ +N+++   I +L++  K    +    ++ LK K L
Sbjct: 232 VLNWRDEGVD--IRGYDSPISMRNTANDIDDATISSLLKVCKGN-ARVFRDFFSLKAKML 288

Query: 321 KLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQY 380
            +  M  +D  AP     +    ++ +  LVL+S  +FSP +S  A + F    +D+   
Sbjct: 289 GMKKMRRYDLYAPAAKDGEKNYTYDKSVKLVLESLERFSPVLSEYASRVFESRHVDSSVR 348

Query: 381 DGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSL 440
            GK  GAF     P + PY++L++ GK +DV TLAHELGH +H + S+  + IL   + L
Sbjct: 349 KGKRGGAFCSTISPGITPYVMLSFDGKSKDVFTLAHELGHAVHSI-SASKRSILVQEAPL 407

Query: 441 TLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTER 500
            LAETAS F E L +D+L  +    E+R +L+  K++D+  SI+RQ  F  FE++ H  +
Sbjct: 408 PLAETASTFSELLLYDNLSDSMPDDEKRSMLV-EKVDDLYASIMRQSFFTIFEMEAH--K 464

Query: 501 RSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCL 560
              G      ++  +L   +   G + D+SD ++   W  +PHF  + FY YAY+FGN L
Sbjct: 465 LIAGSATVDELSGAYLGGLRGQFGSSVDVSD-DFAIEWSCIPHFHHAPFYCYAYSFGNLL 523

Query: 561 VNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMI 620
             SL+  +K    D F   YL IL +G S+   +LL    I++S   FW+ G   + + +
Sbjct: 524 ALSLFRRFKKEG-DDFVPSYLAILSSGGSQKPEKLLAEHGIDISSEKFWQDGFDQIREQV 582

Query: 621 DDVEKM 626
             + K+
Sbjct: 583 RSLAKL 588


>gi|282856715|ref|ZP_06265981.1| oligoendopeptidase F [Pyramidobacter piscolens W5455]
 gi|282585480|gb|EFB90782.1| oligoendopeptidase F [Pyramidobacter piscolens W5455]
          Length = 616

 Score =  201 bits (510), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 165/555 (29%), Positives = 260/555 (46%), Gaps = 21/555 (3%)

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
           +  SL  AI   ER+  L+GR+  YA++  + + ++   +              +   F 
Sbjct: 70  SAASLLKAITLDERLDYLLGRLYCYAVMRSHEDTAAEGPKALAARATQLSVRAAEASAFL 129

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
           + EI   DEA +E   AQ+P    Y   ++ I   KKH+LS + E +++   ++     +
Sbjct: 130 SPEILAADEAKIETFLAQEPKLELYRLMLRRILLEKKHVLSAEQEAVMAAMGELAGAPDE 189

Query: 203 RFFCENIESLRF-KINDQK---IPLTK-AYKSFFDS-DREVRKSAAKALSHTFNKSSHIF 256
            F       ++F +I D+K    PLT+ +Y  +  S DR VR+ A + +  TF K  +  
Sbjct: 190 IFSMLTDADMQFGEIADEKGEKRPLTQESYGRYISSPDRRVRREAFEGIHRTFAKFRNTL 249

Query: 257 SFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELK 316
                   K +    R R+Y    ++    N +   V + L+ +V    P   H Y  LK
Sbjct: 250 GATYAASVKKDATFARLRRYASALEASLYGNEIPVSVYDGLVAAVNGKLPAL-HEYVALK 308

Query: 317 KKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWID 376
           KK L ++ M  WD  AP     +    +E A+ LVL++ A    + +    + F+  WID
Sbjct: 309 KKALGVERMEPWDLYAPFTKELKRTFSYETAQKLVLEAVAPLGEEYARAMRRAFSERWID 368

Query: 377 APQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTN 436
             +  GK SGA++ G    VHPY+LLNY G   DV TLAHE GH IH  +S+  Q  +  
Sbjct: 369 VYENRGKRSGAYSWGCW-GVHPYMLLNYGGTFSDVSTLAHEGGHSIHTWMSNAAQPQVYA 427

Query: 437 NSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKL 496
             +L +AE AS   ETL  + LL     +EE+  LL+ ++E +  +I RQ  F +FE   
Sbjct: 428 GYTLFVAEVASTVNETLLAEHLLGNTRDREEKIFLLSQQLELIRLTIYRQTLFAEFERDA 487

Query: 497 HTERRSTGDIPTHRINEIW--LETQ--KESLGPAFDLSDLEYGSFWMMVPHFIESSFYVY 552
           H        +    +N +W  L T+   E +G   DL+     + W  +PHF  ++FYVY
Sbjct: 488 HALAEKGEPLTPELLNRMWSKLYTRYYGEEVGANPDLA-----AEWSRIPHFY-NAFYVY 541

Query: 553 AYAFGNCLVNSLYD-IYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWER 611
            YA       +L D I      +  ++ YLN+LR G SK    LL    I++S     ER
Sbjct: 542 QYATSLAAALALVDRILAGGRAE--RDAYLNLLRGGCSKDPISLLRDAGIDMSTSEPVER 599

Query: 612 GLQTVEKMIDDVEKM 626
            L   E+   ++ ++
Sbjct: 600 ALAVFERKTAELGEL 614


>gi|297530023|ref|YP_003671298.1| oligoendopeptidase F [Geobacillus sp. C56-T3]
 gi|297253275|gb|ADI26721.1| oligoendopeptidase F [Geobacillus sp. C56-T3]
          Length = 618

 Score =  201 bits (510), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 159/599 (26%), Positives = 271/599 (45%), Gaps = 32/599 (5%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           WN+ D+YPS    E   D + +++ +L     +EG L  A       +L       E+  
Sbjct: 29  WNVADIYPS--EHEWMRDYKAVKN-ALPKLAAFEGKLDDAKTIAKLFALN------EQTA 79

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
             + +++ YA L  + N+   T  +    + A  A +     F   E+  L E  L +  
Sbjct: 80  RKLEKLSLYAHLKRDINIEDETAARLGAKVEALAAQYAAKTAFIEPELLALPERTLRKLQ 139

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENI--------- 209
              PL   Y  +   +R+ K H L+   E LL+  S    EA      ENI         
Sbjct: 140 KSKPLK-AYRYYFHELREQKPHTLTKREEQLLAKLSPALGEA------ENIYDHAARGDY 192

Query: 210 ESLRFKI-NDQKIPLTK-AYKSFFD-SDREVRKSAAKALSHTFNKSSHIFSFITNTLAKD 266
           E    K+ N + + LT   Y +  +  DR  RK+A +A + ++       +       K 
Sbjct: 193 EPPSVKMPNGKTVTLTDDQYAAMLEHPDRRYRKAAFEAKAKSYEAMEQTAAATLYASVKA 252

Query: 267 EEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMY 326
           +E+    R+Y     +   +++V   V + L+ + + + P   HRY EL+++ L LD ++
Sbjct: 253 DELYANVRRYPSGLAAALAADDVPKEVFDHLIAATRRHLPAL-HRYVELRRRALGLDRVH 311

Query: 327 FWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSG 386
            +D   PL G +   IP E A+ L+++              + F   W+D      K +G
Sbjct: 312 SYDLYVPLVGETMKPIPVETAKTLIVEGLKPLGADYIKQVHRAFQERWLDVFPRPKKYTG 371

Query: 387 AFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETA 446
            +  G     HP+ILLNY G    V+T+AHELGH +H V ++  Q    +  S+  AE A
Sbjct: 372 GYNTGAY-DTHPFILLNYNGSLDSVLTMAHELGHAMHSVYTNRAQPYHYSGHSIFTAEVA 430

Query: 447 SIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDI 506
           S   E L  D L + A +KEE+  LL  +IE +  ++  Q+ + +FE  +H + R  G +
Sbjct: 431 STANEWLMLDYLYKQAKTKEEKLRLLIEQIEQIRGTLYTQVMYSEFERMIHDKVRQGGSL 490

Query: 507 PTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYD 566
               +N +WL   K   GPA+  +D      W+ +PHF + +FYVY YA       ++  
Sbjct: 491 TADELNHLWLGLLKTYYGPAY-AADPGAAHGWLRIPHFYD-AFYVYKYATSLAASYTIVS 548

Query: 567 IYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEK 625
             +++T     ++Y   LR+G S     LL    ++++ P   ER L    +++D++++
Sbjct: 549 DIQTDTSGKAVKRYKQFLRSGASDDPIRLLKRAGVDMTSPEPIERVLGHFAELVDELDR 607


>gi|218290987|ref|ZP_03495035.1| oligoendopeptidase F [Alicyclobacillus acidocaldarius LAA1]
 gi|218239069|gb|EED06273.1| oligoendopeptidase F [Alicyclobacillus acidocaldarius LAA1]
          Length = 609

 Score =  200 bits (509), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 154/595 (25%), Positives = 279/595 (46%), Gaps = 19/595 (3%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           RWNLED+YP  D +E   D + +   +  F   + G L +A+ +   H+L A    ++ +
Sbjct: 24  RWNLEDIYP--DQEEWRKDADRVRALAEQF-VYFRGQL-NASGETLLHALRA----HDEV 75

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQS 157
            +++ ++  YA +  + + +    +  + +     A+ + +  FF  E+  L    +E  
Sbjct: 76  SQILWKLFVYAKMKLDEDTTESWRQALFAEAQRLAAEIQALTSFFYPELVQLSPEQVEGW 135

Query: 158 YAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI- 216
                    Y  +++   + + H+L+ + E LL+  S+V     + F   N     F + 
Sbjct: 136 LETVEGLGLYRFFLEETLRQRDHVLTPEQEELLAQFSEVLHAPSEIFEMYNNADTVFPVI 195

Query: 217 ---NDQKIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
              N + + +T A Y    +  DR VR+ A  A+  T+ K  +  + +     K   +  
Sbjct: 196 RDENGEDVQVTHALYHELLERRDRGVRERAFHAVYDTYKKHRNTIAALYAASVKRNVVNA 255

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRL 331
           R R+Y    D+   ++ +   V E L+++V+   P     Y  L+K+ L LD ++ WD  
Sbjct: 256 RVRRYPSALDAALDADRIPRSVYENLIRAVRESVP-VLQSYLALRKRALGLDELHMWDLY 314

Query: 332 APLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHG 391
            PL G     +P+  AR+ VL++   F    +  A +     W+D  +  GK SG ++ G
Sbjct: 315 VPLVGEIDWKVPYAEARETVLKAVQVFGDTYASAAREGLYGRWVDVYETRGKRSGGYSWG 374

Query: 392 TIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE 451
           T    HPYILLNY    QD+ TLAHELGH +H   S +TQ  + ++ ++ +AE AS   E
Sbjct: 375 TY-GTHPYILLNYTDSVQDMFTLAHELGHSMHSYFSRKTQPYIYSDYTIFVAEVASTVNE 433

Query: 452 TLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRI 511
            + +D LL        R  LL  ++E +  ++V Q  + +FE + H    S G I    +
Sbjct: 434 AILYDDLLGREQDPLRRAYLLNRQVETIRTTLVAQTLYAEFEKRTHERIESGGAITADWL 493

Query: 512 NEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSN 571
           +E++ E  +    P   + D +    WM +PHF  S+FYVY YA G     +L +  +  
Sbjct: 494 DEVFYELNQAYYAPEVAVDD-DIAHGWMRIPHFY-SAFYVYKYATGISAALALVEKIRRE 551

Query: 572 TVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
             +    +YL  L +G+S    ELL    ++++      + L+   ++ +++ ++
Sbjct: 552 GDEAVA-RYLQFLSSGSSNTSIELLRMAGVDMTSDAPVRQALERFGRLTEELGEL 605


>gi|220931661|ref|YP_002508569.1| Oligoendopeptidase F [Halothermothrix orenii H 168]
 gi|219992971|gb|ACL69574.1| Oligoendopeptidase F [Halothermothrix orenii H 168]
          Length = 598

 Score =  199 bits (507), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 165/600 (27%), Positives = 285/600 (47%), Gaps = 29/600 (4%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           +W+LED+Y +   +E   D   ++ + L     ++G L +++  +N       I E E  
Sbjct: 16  KWDLEDIYKT--DEEWEKDFNRVK-DKLKDIATFQGKLVNSS--QNLLDGLNLIMEVE-- 68

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQS 157
            E+  R+ +YA +  + +    + +  +    +   +   +  F   EI TL    + + 
Sbjct: 69  -EVATRLYAYAHMRQDEDTRDQSYQSLFNRAQSLHNELASITSFMVPEILTLSREQMNK- 126

Query: 158 YAQDPLTLK-YSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI 216
           Y ++   LK Y   + NI + K H LS   E L++   +V +     F   N   L F I
Sbjct: 127 YLEEKEGLKLYRHLLDNILRQKDHYLSAKEERLIAMAGEVTQGPYNIFSMMNNADLTFPI 186

Query: 217 -NDQKIPLTKAYKSFF-----DSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
             D+K    +     F     + +R VRK A KAL   +N+  + F+   NT  K     
Sbjct: 187 IKDEKGEEVRVTHGRFIELMENKNRRVRKDAFKALYSKYNEFINTFASTLNTAVKSHIYY 246

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
            R RKY    +S    +NV   V   L++++K+   K  ++Y +L+K+ L +D ++ +D 
Sbjct: 247 ARVRKYNSALESALDDDNVPVDVYNNLIKTIKDNL-KPMYKYMKLRKEILGVDELHMYDI 305

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
             PL       IP+E A+++V+        +   I ++ F   WID  +  GK SGA++ 
Sbjct: 306 YTPLVSDLDIKIPYEEAKEMVINGLKPLGDEYLNILKEGFNSGWIDVYENKGKRSGAYSS 365

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
           G    VHPY+LLNY     +V TLAHE+GH IH   S++ Q  +  N  + +AE AS   
Sbjct: 366 GCY-GVHPYVLLNYTDNLDNVFTLAHEMGHAIHTYYSNKNQPFVYANYKIFVAEVASTLN 424

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           ETL    LL+    ++++K L+ + +E    ++ RQ  F +FE  +H +      + +  
Sbjct: 425 ETLLIKYLLENTQDEKKKKYLINHYLEQFRGTVYRQTMFAEFEKIIHEKVEQGQPLTSGL 484

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
           + EI+ +  +E  GP   +SD E    W  +PHF   +FYVY YA G     +L     +
Sbjct: 485 LKEIYKKLNEEYYGPDV-VSDEEIALEWARIPHFY-YNFYVYKYATGFSAATAL-----A 537

Query: 571 NTV----DCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           N +    D   ++Y+  L++G+S +   +L    +++S P   E  + T ++ +D  EK+
Sbjct: 538 NKILEEGDKAVQRYIQFLKSGDSDYPLNVLKKAGVDMSSPEPIESAISTFKEFVDRFEKL 597


>gi|295400333|ref|ZP_06810312.1| oligoendopeptidase F [Geobacillus thermoglucosidasius C56-YS93]
 gi|294977608|gb|EFG53207.1| oligoendopeptidase F [Geobacillus thermoglucosidasius C56-YS93]
          Length = 619

 Score =  199 bits (506), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 165/605 (27%), Positives = 276/605 (45%), Gaps = 37/605 (6%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           +WNL D+Y S    +   D + I  ++L   T +EG L  A N     +L       ERI
Sbjct: 29  QWNLADIYSSE--TDFERDYQAIV-DALPKLTAYEGKLQSAANVSKLFALN------ERI 79

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQS 157
              + +++ YA L  + N+   T  +    +    +DF     F   E+  L E  L + 
Sbjct: 80  ARKMEKLSLYAHLKQDLNIEDGTAAQLKAKVETLTSDFASKTAFIEPELLALPEQTLAK- 138

Query: 158 YAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENI-------- 209
             +  L   Y  + K +R+ KKH LS   E LL+  S +  +       ENI        
Sbjct: 139 LQKSKLLKPYRYYFKELREQKKHTLSKREEQLLAKLSPIMNDP------ENIYNHAARGD 192

Query: 210 ---ESLRFKINDQKIPLTKA--YKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLA 264
               SLR   + + +PLT     K+    DR  RK A +    ++    +  +       
Sbjct: 193 YKPPSLRTP-DGKTVPLTDENYTKALEHMDRSYRKRAFQIRFQSYEAIENTSAATLYASV 251

Query: 265 KDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDT 324
           K +E+  + RKY+   D+   +++V   V   L+ +V ++ P + HRY  L+KK L +D 
Sbjct: 252 KADELYAKVRKYQSGLDAALSADDVPKQVFTNLISTVNDHLP-SLHRYVGLRKKALGIDR 310

Query: 325 MYFWDRLAPLPGTS---QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYD 381
           ++ +D   PL   +   +   P E A+ L+L+              + F   WIDA    
Sbjct: 311 VHSYDMFVPLVDETVAKKMKFPIETAQTLLLEGLKPLGGDYIKHVRRAFEQGWIDAYPRP 370

Query: 382 GKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLT 441
            K +G +  G     HP+ILLNY      ++TLAHE+GH ++ V +++TQ    +  S+ 
Sbjct: 371 KKYAGGYNTGAY-DTHPFILLNYDESLDGMLTLAHEIGHAMNSVYTNKTQPYHYSGQSIF 429

Query: 442 LAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERR 501
            AE AS   E L  D L++ A + EE   LL  +IE +  ++  Q+ + +FE  +H + +
Sbjct: 430 TAEVASTANEWLMMDYLMKRAKTDEEMLYLLNQQIEQIRGTLYTQVMYSEFEQAVHDKVQ 489

Query: 502 STGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLV 561
             G +    +N++WL   K+  GPA+  +D E    W+ +PHF + +FYVY YA      
Sbjct: 490 KGGSLTAAELNDLWLRLLKKYHGPAY-AADPEAARGWLRIPHFYD-AFYVYKYATSLAAS 547

Query: 562 NSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMID 621
             L    K++      ++YL  L AG S     LL    ++++ P   E  L   + ++ 
Sbjct: 548 FELVKQMKTDKTGEATKRYLQFLSAGASDDPIRLLQKTGVDMTSPEPLENLLSYFDSLVR 607

Query: 622 DVEKM 626
           ++E++
Sbjct: 608 EMEQL 612


>gi|219669074|ref|YP_002459509.1| oligoendopeptidase F [Desulfitobacterium hafniense DCB-2]
 gi|219539334|gb|ACL21073.1| oligoendopeptidase F [Desulfitobacterium hafniense DCB-2]
          Length = 599

 Score =  199 bits (505), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 156/596 (26%), Positives = 276/596 (46%), Gaps = 21/596 (3%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTR-WEGNLAHATNQKNCHSLGAAIAEYER 96
           +W+LED++PS  + E     E ++ E L  +   ++G+L       +  +L       + 
Sbjct: 17  KWHLEDIFPSDQAWE----EEFLKAEKLLERAESFQGHLG-----DSAEALLTCFDWMDE 67

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQ 156
           + + +G I +YA +  + +  +   +       A        L F   EI  L E  L++
Sbjct: 68  VGQSVGEIYTYARMRRDEDNRNAHYQALTDRAGALSVRVGSALAFVVPEILALPEGRLQE 127

Query: 157 SYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI 216
               +     Y   +++I + ++H+LS+  E LL++  ++       F   N   L+F  
Sbjct: 128 FRQANEKMALYDHALEDILRKREHVLSSQEEKLLAEMGEIAEGPSTIFGMANNADLKFPS 187

Query: 217 ----NDQKIPLTKA-YKSFFDSD-REVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
                D+++ LTK  Y  F +S+ R VR+ A + L  T+ K  + ++ I N+  K +   
Sbjct: 188 IKNEQDEEVELTKGNYIQFMESENRRVRQEAFETLYGTYQKQINTWAAILNSNIKGDVFF 247

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
            R R+Y    ++    + V   V +AL+ +V+ + P+  HRY +L+KK L LD ++ +D 
Sbjct: 248 ARARRYPSAIEASLHDDKVPLGVYDALIDTVREFLPEM-HRYVKLRKKALGLDELHMYDI 306

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
             P+    +  IP++ A  +  +           + E+ FT +WID  +  GK SGA++ 
Sbjct: 307 YVPIVSEVKMTIPYQEAVAMCREGLKPLGSDYGKVLEEGFTSHWIDVYENQGKTSGAYSW 366

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
           GT  S HPY+LLN+      + T+AHE+GH +H   S+ TQ  +     + +AE AS   
Sbjct: 367 GTYRS-HPYVLLNHQDTLDSMFTIAHEMGHSLHTYFSNRTQPHIYAGYKIFVAEVASTLN 425

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E L  D LL+     +    LL + +E    ++ RQ  F +FE K H        +    
Sbjct: 426 EALVMDHLLKTTEDPKLLAYLLNHYLEQFRGTVFRQTMFAEFEKKTHALVEQGEALTAEL 485

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
           ++  +L+  ++  GP   + D +    W  +PHF  ++FYVY YA G     +L      
Sbjct: 486 LSSTYLKLNEDYYGPDV-VMDPQIAIEWARIPHFY-NAFYVYKYATGFSAATALARKILD 543

Query: 571 NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
                  E+YL  L +G+S +  ELL    +++  P      LQ    ++D +E +
Sbjct: 544 EGEPAV-ERYLRFLSSGSSDYPIELLREAGVDMETPVPVREALQVFTSLLDRLEGL 598


>gi|89894637|ref|YP_518124.1| hypothetical protein DSY1891 [Desulfitobacterium hafniense Y51]
 gi|89334085|dbj|BAE83680.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 601

 Score =  198 bits (504), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 156/596 (26%), Positives = 276/596 (46%), Gaps = 21/596 (3%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTR-WEGNLAHATNQKNCHSLGAAIAEYER 96
           +W+LED++PS  + E     E ++ E L  +   ++G+L       +  +L       + 
Sbjct: 19  KWHLEDIFPSDQAWE----EEFLKAEKLLERAESFQGHLG-----DSAEALLTCFDWMDE 69

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQ 156
           + + +G I +YA +  + +  +   +       A        L F   EI  L E  L++
Sbjct: 70  VGQSVGEIYTYARMRRDEDNRNAHYQALTDRAGALSVRVGSALAFVVPEILALPEGRLQE 129

Query: 157 SYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI 216
               +     Y   +++I + ++H+LS+  E LL++  ++       F   N   L+F  
Sbjct: 130 FRQANEKMALYDHALEDILRKREHVLSSQEEKLLAEMGEIAEGPSTIFGMANNADLKFPS 189

Query: 217 ----NDQKIPLTKA-YKSFFDSD-REVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
                D+++ LTK  Y  F +S+ R VR+ A + L  T+ K  + ++ I N+  K +   
Sbjct: 190 IKNEQDEEVELTKGNYIQFMESENRRVRQEAFETLYGTYQKQINTWAAILNSNIKGDVFF 249

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
            R R+Y    ++    + V   V +AL+ +V+ + P+  HRY +L+KK L LD ++ +D 
Sbjct: 250 ARARRYPSAIEASLHDDKVPLGVYDALIDTVREFLPEM-HRYVKLRKKALGLDELHMYDI 308

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
             P+    +  IP++ A  +  +           + E+ FT +WID  +  GK SGA++ 
Sbjct: 309 YVPIVSEVKMTIPYQEAVAMCREGLKPLGSDYGKVLEEGFTSHWIDVYENQGKTSGAYSW 368

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
           GT  S HPY+LLN+      + T+AHE+GH +H   S+ TQ  +     + +AE AS   
Sbjct: 369 GTYRS-HPYVLLNHQDTLDSMFTIAHEMGHSLHTYFSNRTQPHIYAGYKIFVAEVASTLN 427

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E L  D LL+     +    LL + +E    ++ RQ  F +FE K H        +    
Sbjct: 428 EALVMDHLLKTTEDPKLLAYLLNHYLEQFRGTVFRQTMFAEFEKKTHALVEQGEALTAEL 487

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
           ++  +L+  ++  GP   + D +    W  +PHF  ++FYVY YA G     +L      
Sbjct: 488 LSSTYLKLNEDYYGPDV-VMDPQIAIEWARIPHFY-NAFYVYKYATGFSAATALARKILD 545

Query: 571 NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
                  E+YL  L +G+S +  ELL    +++  P      LQ    ++D +E +
Sbjct: 546 EGEPAV-ERYLRFLSSGSSDYPIELLREAGVDMETPVPVREALQVFTSLLDRLEGL 600


>gi|332981322|ref|YP_004462763.1| oligopeptidase F [Mahella australiensis 50-1 BON]
 gi|332699000|gb|AEE95941.1| oligopeptidase F [Mahella australiensis 50-1 BON]
          Length = 596

 Score =  198 bits (504), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 164/612 (26%), Positives = 285/612 (46%), Gaps = 26/612 (4%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           M  +  +E +    +W+LED+Y S D  E   D + ++    A + +++G L  A     
Sbjct: 1   MNALPKREEIDKKYKWHLEDIYSSDDEWE--RDFKRLKDMVPAME-KYKGRLNSAD---- 53

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
             SL  A+   + I +L  R+ +YA +  + + ++   +       + + + +  L F  
Sbjct: 54  --SLYNALKLRDEISQLAERLFTYARMRRDEDNANTKYQALADRAMSLIIEIQSALSFIV 111

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            EI  +    +     ++P    Y  +I +I + K H+LS   E +L+   ++   A   
Sbjct: 112 PEILAIPADEVYGYMIEEPNLELYRHYIDDIMRQKAHVLSASEERILAQAGEMAEAADII 171

Query: 204 FFCENIESLRFKI----NDQKIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFS 257
           F   N   ++F      N  ++ LTK  Y  F +S DR VRK A +AL  T+ K  +  S
Sbjct: 172 FTMINDADIKFPSIKDENGNEVELTKGRYMQFMESQDRRVRKDAFEALYDTYGKLKNTLS 231

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
              ++  K +    R RKY     +    +NV   V + L++++ +      +RY +L+K
Sbjct: 232 ATLSSNVKKDIFFSRVRKYPSSLAASLDDDNVPTSVYDGLIKAIHDNM-DLMYRYVKLRK 290

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           K L +D ++ +D   PL    +  + +E A D VL+       +   + E  F + WIDA
Sbjct: 291 KMLGVDELHMYDLYVPLVPDIKVKVSYEEAIDKVLEGLRPLGQEYISLLEHGFKNGWIDA 350

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK SGA++ G    VHP++LLN+ G   D+ T+AHE+GH +H   S   Q  +   
Sbjct: 351 YENQGKTSGAYSWGCY-GVHPFVLLNFQGTLDDIFTIAHEMGHSLHTHYSFSAQPYIYAE 409

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
             + +AE AS   E L  D +L+    +  +  L+ + +E    ++ RQ  F +FE  +H
Sbjct: 410 YRIFVAEVASTLNEALLMDHMLKTTDQRSMKLYLINHYLEQFRGTVYRQTMFAEFEKIVH 469

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAF---DLSDLEYGSFWMMVPHFIESSFYVYAY 554
            +  +   +    ++ I+    ++  GP     D  DLE    W  +PHF  SSFYVY Y
Sbjct: 470 DKAETGESLTPDMMSSIYHNLNEKYYGPNIVVDDRIDLE----WSRIPHFY-SSFYVYKY 524

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     +L     S       ++Y+N L++G S +  ELL    ++++ P   E  L+
Sbjct: 525 ATGFSAATALSQQILSEGKTAV-DRYINFLKSGGSDYPIELLKKAGVDMTTPKPVEAALK 583

Query: 615 TVEKMIDDVEKM 626
               ++D +E M
Sbjct: 584 VFAGLLDQMESM 595


>gi|154496475|ref|ZP_02035171.1| hypothetical protein BACCAP_00767 [Bacteroides capillosus ATCC
           29799]
 gi|150274558|gb|EDN01635.1| hypothetical protein BACCAP_00767 [Bacteroides capillosus ATCC
           29799]
          Length = 600

 Score =  198 bits (503), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 163/596 (27%), Positives = 265/596 (44%), Gaps = 23/596 (3%)

Query: 39  WNLEDLYPSHDS-QEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           W + DLYPS  + +E   ++  +  +  A++ R   + A         +L A +   + I
Sbjct: 17  WAITDLYPSDQAWREACENVRGLVRDLAAYRGRLGESAA---------TLLAFLRLQDEI 67

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQS 157
                R+ SYA    + +  +P  ++        L +  + L F   E+  +++A LE  
Sbjct: 68  DLQGDRMISYAFRKSDEDTRNPVYQEMSAQAQNFLVELSQALSFQTPELLAIEDATLESF 127

Query: 158 YAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFK-I 216
           Y Q+P    Y   +K IR  K H LS D E LL+   ++G+     F   N   + +   
Sbjct: 128 YEQEPALAHYRLMLKRIRSRKDHTLSPDCEALLASAERMGQAPDDIFSLLNDADMTYPDA 187

Query: 217 NDQKI---PLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
            D K    P+T   Y +   S DR +R+SA ++L   + +  +  + I     K  +   
Sbjct: 188 TDSKGETHPVTHGNYVALLQSADRTLRQSAFQSLYSVYGQFRNTCAAILGAQMKQLQFFA 247

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRL 331
             R+Y     +      V+P +   L+Q+V +      HRY  L+KK L +D ++++D  
Sbjct: 248 DARRYPSALHAALAETEVDPQIYHNLIQTVHDNL-DAMHRYVRLRKKLLGVDKLHYYDLY 306

Query: 332 APLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHG 391
            P+       IPFE A+D+  ++          I  + F + WID  +  GK SGA++ G
Sbjct: 307 TPIVADEDASIPFEQAKDMAREALKPLGEDYLKILNEGFDNRWIDVYENQGKRSGAYSAG 366

Query: 392 TIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE 451
            +  VHPY+LLNY     DV TL HE+GH +H  LS+ TQ +      + +AE AS   E
Sbjct: 367 -VYGVHPYVLLNYTDTLDDVFTLVHEMGHALHSYLSNHTQSVTYAGYKIFVAEVASTCNE 425

Query: 452 TLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRI 511
            L    LL   +  + R  L+ + +E    ++ RQ  F +FEL    + R    +    +
Sbjct: 426 ALLMQHLLSKTTEPKCRAYLINHFLEQFRGTLYRQTMFAEFELWCSEQTRKGQPLTAESL 485

Query: 512 NEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYD-IYKS 570
           NE + E  +   G   +  D E    W  +PHF   +FYVY YA G     +L   I K 
Sbjct: 486 NEKYAELNRLYYGEDIE-PDPEIALEWARIPHFY-YNFYVYQYATGFTSAIALSQRILKE 543

Query: 571 NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
                  E YL  L  G S     LL    +++S P      L+  + +I ++E++
Sbjct: 544 GRPAV--EDYLRFLSGGCSADPVSLLKGAGVDISSPAPIVDALKLFDTLIGEMEQL 597


>gi|20808843|ref|NP_624014.1| oligoendopeptidase F [Thermoanaerobacter tengcongensis MB4]
 gi|20517496|gb|AAM25618.1| Oligoendopeptidase F [Thermoanaerobacter tengcongensis MB4]
          Length = 587

 Score =  197 bits (501), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 166/596 (27%), Positives = 295/596 (49%), Gaps = 28/596 (4%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           RW+LE LY S DS+E   D+E I       ++  E N    T +K+   L   I     +
Sbjct: 2   RWSLEALYTSFDSEEFQKDVEKITSSIEHIRSWTEENFT--TYEKSKEKLEYYIRFKNEL 59

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYT---DINAKLADFEKVLIFFALEINTLDEALL 154
            +L+ ++  Y+ LS + ++ +    K      +I+  LA+ E     + L +  L+E + 
Sbjct: 60  GDLMVKVRGYSALSLSVDVKNEKALKALESLENISTMLAEPETKFKRWLLNMPNLEETIQ 119

Query: 155 EQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF 214
             SY ++     +  +IK   K   HLLS   E +++     G EA  +       +L  
Sbjct: 120 SSSYLKE-----HEFFIKETVKEAMHLLSEKEEMIIAKMKNTGSEAWAKLHDLLTSTLLV 174

Query: 215 KIN----DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
            IN    ++K+PL+      +D D  +RK+A  A  +++ K     +   N +  +    
Sbjct: 175 DININGEEKKLPLSVVRNMAYDKDPYIRKTAYFAELNSYKKIEDASAACLNGIKGEVLTV 234

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLK-LDTMYFWD 329
              RKY    +     + ++   +EA++++++ Y P+   RY + K + L   D + F+D
Sbjct: 235 TELRKYSSPLEMTLQRSRMDSETLEAMLEAIEEYLPEF-RRYLKEKARLLGHKDGLPFYD 293

Query: 330 RLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFA 389
             AP+ G       F+ A++ +++++  FS  ++  A+K F ++WIDA   +GK  GAF 
Sbjct: 294 LFAPV-GKLDKKFTFDEAKEFIVENFNSFSEDLAQFAKKAFENSWIDAEPREGKRGGAFC 352

Query: 390 HGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIH-FVLSSETQGILTNNSSLTLAETASI 448
           +   P     IL N+ G   +V+TLAHELGHG H  +L++ET  ++ +   + +AETASI
Sbjct: 353 YNLHPIKESRILANFDGSFSNVLTLAHELGHGYHGHLLANET--LINSRYPMPIAETASI 410

Query: 449 FGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPT 508
           F E +  +S L+ A SKEE+  ++ N ++    +IV   S + FE ++  +RR    +  
Sbjct: 411 FNEHIIVNSALKTA-SKEEKLSIIENSLQRSTQTIVDIYSRFLFEDEV-IKRRKDHSLSV 468

Query: 509 HRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIES--SFYVYAYAFGNCLVNSLYD 566
             + +I +E QK++ G   D + L +   W+  PH+ ++  ++Y + YAFG   V  L  
Sbjct: 469 EELKQIMIEAQKKTYGDGLDQNYL-HPYMWINKPHYYDADLNYYNFPYAFGELFVKGL-- 525

Query: 567 IYKSNT-VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMID 621
           IYK N     F E+Y N+L     K+  +L   +  +L   +FW + L  +++ I+
Sbjct: 526 IYKYNQEGKKFVEEYKNLLPQTGKKNLYDLGKIVGFDLHSKDFWRKSLDVIKEEIN 581


>gi|56420353|ref|YP_147671.1| thimet oligopeptidase [Geobacillus kaustophilus HTA426]
 gi|56380195|dbj|BAD76103.1| thimet oligopeptidase [Geobacillus kaustophilus HTA426]
          Length = 614

 Score =  197 bits (501), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 157/599 (26%), Positives = 269/599 (44%), Gaps = 32/599 (5%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           WN+ D+YPS    E   D + +++ +L     +EG L  A       +L       E+  
Sbjct: 29  WNVADIYPS--EHEWMRDYKAVQN-ALPKLAAFEGKLDDAKTIAKLFALN------EQTA 79

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
             + +++ YA L  + N+   T  +    + A  A +     F   E+  L E  L +  
Sbjct: 80  RKLEKLSLYAHLKRDINIEDETAARLGAKVEALAAQYAAKTAFIEPELLALPERTLRKLQ 139

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFK--- 215
              PL   Y  +   +R+ K H L+   E LL+  S    EA      ENI     +   
Sbjct: 140 KSKPLK-AYRHYFNELREQKPHTLTKREERLLAKLSPALGEA------ENIYDHAARGDY 192

Query: 216 -------INDQKIPLTK-AYKSFFD-SDREVRKSAAKALSHTFNKSSHIFSFITNTLAKD 266
                   N + + LT   Y +  +  DR  RK+A +A + ++       +       + 
Sbjct: 193 EPPSVTMPNGKTVTLTDDQYAAMLEHPDRRYRKAAFEAKAKSYEAIEQTAAATLYASVQA 252

Query: 267 EEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMY 326
           +E+    R+Y     +   +++V   V + L+ + + + P   HRY EL+++ L LD ++
Sbjct: 253 DELYANVRRYPSGLAAALAADDVPKEVFDHLIAATRRHLPAL-HRYVELRRRALGLDRVH 311

Query: 327 FWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSG 386
            +D   PL G +   IP E A+ L+++              + F   W+D      K +G
Sbjct: 312 SYDLYVPLVGETMKPIPVETAKTLIVEGLKPLGADYIKQVHRAFQERWLDVYPRPKKYTG 371

Query: 387 AFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETA 446
            +  G     HP+ILLNY G    V+T+AHELGH +H V ++ TQ    +  S+  AE A
Sbjct: 372 GYNTGAY-DTHPFILLNYNGSLDSVLTMAHELGHAMHSVYTNRTQPYHYSGHSIFTAEVA 430

Query: 447 SIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDI 506
           S   E L  D L + A +KEE+  LL  +IE +  ++  Q+ + +FE  +H + R  G +
Sbjct: 431 STANEWLMLDYLYKQAKTKEEKLRLLIEQIEQIRGTLYTQVMYSEFERIIHDKVRQGGSL 490

Query: 507 PTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYD 566
               +N +WL   K   GPA+  +D      W+ +PHF + +FYVY YA       ++  
Sbjct: 491 TADELNNLWLGLLKTYYGPAY-AADPGSALGWLRIPHFYD-AFYVYKYATSLAASYAIVS 548

Query: 567 IYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEK 625
             +++      ++Y   LR+G S     LL    ++++ P   ER L+    ++D+++K
Sbjct: 549 DIQTDKSGKAVKRYKQFLRSGASDDPIRLLKRAGVDMTSPEPIERVLRHFTALVDELDK 607


>gi|261420016|ref|YP_003253698.1| oligoendopeptidase F [Geobacillus sp. Y412MC61]
 gi|319766831|ref|YP_004132332.1| oligoendopeptidase F [Geobacillus sp. Y412MC52]
 gi|261376473|gb|ACX79216.1| oligoendopeptidase F [Geobacillus sp. Y412MC61]
 gi|317111697|gb|ADU94189.1| oligoendopeptidase F [Geobacillus sp. Y412MC52]
          Length = 618

 Score =  197 bits (500), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 157/599 (26%), Positives = 271/599 (45%), Gaps = 32/599 (5%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           WN+ D+YPS    E   D + +++ +L     +EG L  A       +L       E+  
Sbjct: 29  WNVTDIYPS--EHEWMRDYKAVKN-ALPKLAAFEGKLDDAKTIAKLFALN------EQTA 79

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
             + +++ YA L  + N+   T  +    + A  A +     F   E+  L +  L +  
Sbjct: 80  RKLEKLSLYAHLKRDINIEDETAARLGAKVEALTAQYAAKTAFIEPELLALPKRTLRKLQ 139

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENI--------- 209
              PL   Y  +   +R+ K H L+   E LL+  S    EA      ENI         
Sbjct: 140 KSKPLK-AYRYYFHELREQKPHTLTKREEQLLAKLSPALGEA------ENIYDHAARGDY 192

Query: 210 ESLRFKI-NDQKIPLTK-AYKSFFD-SDREVRKSAAKALSHTFNKSSHIFSFITNTLAKD 266
           E    K+ N + + LT   Y +  +  DR  RK+A +A + ++       +       K 
Sbjct: 193 EPPSVKMPNGKTVTLTDDQYAAMLEHPDRRYRKAAFEAKAKSYEAMEQTAAATLYASVKA 252

Query: 267 EEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMY 326
           +E+    R+Y     +   +++V   V + L+ + + + P   HRY EL+++ L LD ++
Sbjct: 253 DELYANVRRYPSGLAAALAADDVPKEVFDHLIAATRRHLPAL-HRYVELRRRALGLDRVH 311

Query: 327 FWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSG 386
            +D   PL G +   IP E A+ L+++              + F   W+D      K +G
Sbjct: 312 SYDLYVPLVGETMKPIPVETAKTLIVEGLKPLGADYIKQVHRAFQERWLDVFPRPKKYTG 371

Query: 387 AFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETA 446
            +  G     HP+ILLNY G    V+T+AHELGH +H V ++  Q    +  S+  AE A
Sbjct: 372 GYNTGAY-DTHPFILLNYNGSLDSVLTMAHELGHAMHSVYTNRAQPYHYSGHSIFTAEVA 430

Query: 447 SIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDI 506
           S   E L  D L + A +KEE+  LL  +IE +  ++  Q+ + +FE  +H + R  G +
Sbjct: 431 STANEWLMLDYLYKQAKTKEEKLRLLIEQIEQIRGTLYTQVMYSEFERMIHDKVRQGGSL 490

Query: 507 PTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYD 566
               +N +WL   K   GPA+  ++      W+ +PHF + +FYVY YA       ++  
Sbjct: 491 TADELNHLWLGLLKTYYGPAY-AAEPGAAHGWLRIPHFYD-AFYVYKYATSLAASYTIVS 548

Query: 567 IYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEK 625
             +++T     ++Y   LR+G S     LL    ++++ P   ER L    +++D++++
Sbjct: 549 DIQTDTSGKAVKRYKQFLRSGASDDPIRLLKRAGVDMTSPEPIERVLGHFAELVDELDR 607


>gi|258510737|ref|YP_003184171.1| oligoendopeptidase F [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|257477463|gb|ACV57782.1| oligoendopeptidase F [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 609

 Score =  197 bits (500), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 152/595 (25%), Positives = 277/595 (46%), Gaps = 19/595 (3%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           RWNLED+YP  D +    D + +   + AF  ++ G L + + +   H+L A    ++ +
Sbjct: 24  RWNLEDIYP--DQEAWRKDADRVRALAEAF-VQFRGRL-NTSGETLLHALRA----HDEL 75

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQS 157
            +++ ++  YA +  + + +    +  + +     A+ +    FF  E+  L    +E  
Sbjct: 76  SQILWKLFVYAKMKLDEDTTESWRQALFAEAQRLAAEIQATTSFFYPELVQLSPEQVEGW 135

Query: 158 YAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI- 216
                    Y  +++   + + H+L+ + E LL+  S+V     + F   N     F + 
Sbjct: 136 LETVEGLGLYHFFLEETLRQRDHVLTPEQEELLAQFSEVLHAPSEIFEMYNNADTVFPVI 195

Query: 217 ---NDQKIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
              N + + +T A Y    +  DR VR+ A  A+  T+ K  +  + +     K   +  
Sbjct: 196 RDENGEDVQVTHALYHELLERRDRGVRERAFHAVYDTYKKHRNTIAALYAASVKRNAVNA 255

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRL 331
           R R+Y    D+   ++ +   V E L+++V+   P     Y  L+K+ L LD +  WD  
Sbjct: 256 RVRRYPSALDAALDADRIPRSVYENLIRAVRESLPAL-QSYLALRKRALGLDELRMWDLY 314

Query: 332 APLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHG 391
            PL G     +P+  AR+ VL++   F    +  A +     W+D  +  GK SG ++ G
Sbjct: 315 VPLVGEIDWKVPYAEARETVLKAVQVFGDTYASAAREGLYGRWVDVYETRGKRSGGYSWG 374

Query: 392 TIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE 451
           T    HPYILLNY    QD+ TLAHELGH +H   S +TQ  + ++ ++ +AE AS   E
Sbjct: 375 TY-GTHPYILLNYTDSVQDMFTLAHELGHSMHSYFSRKTQPYIYSDYTIFVAEVASTVNE 433

Query: 452 TLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRI 511
            + +D LL        R  LL  ++E +  ++V Q  + +FE + H    S G I    +
Sbjct: 434 AILYDDLLGREQDPLRRAYLLNRQVETIRTTLVAQTLYAEFEKRTHERIESGGAITADWL 493

Query: 512 NEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSN 571
           +E++ +  +    P   + D +    WM +PHF  S+FYVY YA G     +L +  +  
Sbjct: 494 DEVFYDLNRAYYAPEVAVDD-DIAHGWMRIPHFY-SAFYVYKYATGISAALALVEKIRRE 551

Query: 572 TVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
             +    +YL  L +G+S    ELL    ++++      + L+   ++  +++++
Sbjct: 552 GDEAVA-RYLQFLSSGSSNTSIELLRMAGVDMTSDAPVRQALERFARLTAELDEL 605


>gi|312111141|ref|YP_003989457.1| oligoendopeptidase F [Geobacillus sp. Y4.1MC1]
 gi|311216242|gb|ADP74846.1| oligoendopeptidase F [Geobacillus sp. Y4.1MC1]
          Length = 619

 Score =  197 bits (500), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 164/604 (27%), Positives = 276/604 (45%), Gaps = 35/604 (5%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           +WNL D+Y S    +   D + I  ++L   T +EG L  A N     +L       ERI
Sbjct: 29  QWNLADIYSSE--TDFERDYQAIV-DALPKLTAYEGKLQSAANVSKLFALN------ERI 79

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQS 157
              + +++ YA L  + N+   T  +    +    +DF     F   E+  L E  L + 
Sbjct: 80  ARKMEKLSLYAHLKQDLNIEDGTAAQLKAKVETLTSDFASKTAFIEPELLALPEQTLAK- 138

Query: 158 YAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENI-------- 209
             +  L   Y  + K +R+ KKH LS   E LL+  S +  +       ENI        
Sbjct: 139 LQKSKLLKPYRYYFKELREQKKHTLSKREEQLLAKLSPIMNDP------ENIYNHAARGD 192

Query: 210 -ESLRFKINDQK-IPLTKA--YKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAK 265
            E    +  D K +PLT     K+    DR  RK A +    ++    +  +       K
Sbjct: 193 YEPPSLRTPDGKTVPLTDENYTKALEHMDRSYRKRAFQIRFQSYEAIENTSAATLYASVK 252

Query: 266 DEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTM 325
            +E+  + RKY+   D+   +++V   V   L+ +V ++ P + HRY  L+KK L +D +
Sbjct: 253 ADELYAKVRKYQSGLDAALSADDVPKQVFTNLISTVNDHLP-SLHRYVGLRKKALGIDRV 311

Query: 326 YFWDRLAPLPGTS---QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDG 382
           + +D   PL   +   +   P E A+ L+L+              + F   WIDA     
Sbjct: 312 HSYDMFVPLVDETVAKKMKFPIETAQTLLLEGLKPLGGDYIKHVRRAFEQGWIDAYPRPK 371

Query: 383 KGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTL 442
           K +G + + +    HP+ILLNY      ++TLAHE+GH ++ V +++TQ    +  S+  
Sbjct: 372 KYAGGY-NTSAYDTHPFILLNYDESLDGMLTLAHEIGHAMNSVYTNKTQPYHYSGQSIFT 430

Query: 443 AETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRS 502
           AE AS   E L  D L++ A + EE   LL  +IE +  ++  Q+ + +FE  +H + + 
Sbjct: 431 AEVASTANEWLMMDYLMKRAKTDEEILYLLNQQIEQIRGTLYTQVMYSEFEQAVHDKVQK 490

Query: 503 TGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVN 562
            G +    +N++WL   K+  GPA+  +D E    W+ +PHF + +FYVY YA       
Sbjct: 491 GGSLTAAELNDLWLRLLKKYHGPAY-AADPEAARGWLRIPHFYD-AFYVYKYATSLAASF 548

Query: 563 SLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
            L    K++      ++YL  L AG S     LL    ++++ P   E  L   + ++ +
Sbjct: 549 ELVKQMKTDKTGEATKRYLQFLSAGASDDPIRLLQKTGVDMTSPEPLENLLSYFDSLVRE 608

Query: 623 VEKM 626
           +E++
Sbjct: 609 MEQL 612


>gi|269928844|ref|YP_003321165.1| oligoendopeptidase F [Sphaerobacter thermophilus DSM 20745]
 gi|269788201|gb|ACZ40343.1| oligoendopeptidase F [Sphaerobacter thermophilus DSM 20745]
          Length = 601

 Score =  196 bits (499), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 162/599 (27%), Positives = 278/599 (46%), Gaps = 29/599 (4%)

Query: 38  RWNLEDLYPSHDS-----QEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           RW+L  L+PS ++     Q +   +  IE    AF+    G L  +  Q     L AA++
Sbjct: 14  RWDLTHLFPSAEAWEAERQAVQAALPDIE----AFR----GTLGQSPQQ-----LLAALS 60

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
             ++I E + R+ +YAML  + +  +    + Y  + A +    +   +   E+ TL + 
Sbjct: 61  LADQIDERLERLFAYAMLERDEDTRNTAAIQRYEQVMALVVAAGRATAWIQPELLTLTDE 120

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
            L      +P    +   I+   + + H+ S ++E +L++T+++ + A   F   +   +
Sbjct: 121 QLRGFLDAEPGLEPFRRLIERTIRQRPHVRSAEVEEVLAETAEMAQTASNVFTFFDNADI 180

Query: 213 RFKI----NDQKIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAKD 266
           RF      +  +I LTKA Y    +S DR VR+ A + L   ++   +    +     + 
Sbjct: 181 RFGTVIDSDGTEIELTKARYLRLLESRDRRVRRDAYETLHAPYHAHRNTLGALLTASNQR 240

Query: 267 EEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMY 326
           +    R R+Y    ++     N+   V   L+ +V  Y P   HRY  L+K+ L LD ++
Sbjct: 241 DAFFARVRRYNSALEAALKPENIPLEVYTNLIDTVHRYLPLL-HRYVSLRKRVLGLDEVH 299

Query: 327 FWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSG 386
            +D   PL    +    ++ A D V+ ++A    +      +     WID  +  GK SG
Sbjct: 300 MYDLYVPLVEMPKRTFDYQEATDTVVAAFAPLGERYVNAVSEGLRSRWIDVHETPGKRSG 359

Query: 387 AFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETA 446
            +  G +  VHPY+LLN+ G   DV TLAHELGH +H   S+E Q   T++ ++ +AE A
Sbjct: 360 GYNLG-VYGVHPYVLLNWGGTLNDVFTLAHELGHAMHSHFSAENQPHPTSSYTIFVAEVA 418

Query: 447 SIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDI 506
           S F E L    LL+ ++   ER  L+ + +E +  +I RQ  F +FEL  H    +   +
Sbjct: 419 STFNEALLRAYLLERSTDPRERAYLVNDALEGIRTTIFRQTMFAEFELLTHQVVEANEGL 478

Query: 507 PTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYD 566
              R+   +        GP F   D +    W  VPHF   +FYVY YA G     +L  
Sbjct: 479 TPERMMNEYTRLATMYHGPDFAADD-QLAVEWSRVPHFYR-AFYVYQYATGLIAAMALAS 536

Query: 567 IYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEK 625
              S      +++YL  L AG+SK   +LL    ++L+    ++    T+E+ ++ +E+
Sbjct: 537 AVLSGDEQA-RDRYLAFLAAGSSKDSLDLLRDAGVDLTTAAPYDAAFATMEEYLNTLEE 594


>gi|312880956|ref|ZP_07740756.1| oligopeptidase F [Aminomonas paucivorans DSM 12260]
 gi|310784247|gb|EFQ24645.1| oligopeptidase F [Aminomonas paucivorans DSM 12260]
          Length = 626

 Score =  196 bits (499), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 157/597 (26%), Positives = 266/597 (44%), Gaps = 23/597 (3%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           RW LED+YP+ ++ E          E+L     + G L      ++   L A +   + +
Sbjct: 41  RWKLEDIYPTDEAWEADY---AAAKEALPRMQSFRGTLG-----RSPRDLLACLVARDDL 92

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQS 157
              +G++  YA +  + + ++P  +      +       +   F   EI ++ E  L+  
Sbjct: 93  GIRVGKLVVYATMRSHEDTANPVYQALADRASTLSVQVSEAGSFVVPEILSVPEKTLQDF 152

Query: 158 YAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF-KI 216
             ++P    Y   +  + + K H+LS   E LL+   +V +     F       L+F +I
Sbjct: 153 QTREPGLAPYRFTLSELLRQKAHVLSQPEEALLAGMGEVLQAPEGAFSMLTNADLKFPQI 212

Query: 217 NDQK---IPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
            D+K   + L++  Y  F  S DR+VR++A + L  T+ K  +      +   K      
Sbjct: 213 TDEKGKTVELSEERYAKFLRSPDRKVREAAFRGLFETYGKLRNTLGATFSGAVKGSAFVA 272

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSV-KNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
           R RKY     +    + +   V   ++ ++ KN  P   HRY  L+++ L L  +  WD 
Sbjct: 273 RARKYPSSLAAALDGDAIPESVYHNVVDTIEKNLAPL--HRYMALRRRILGLAKLAPWDL 330

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
             PL       IP+E A + V        P      +   +  W+D  +  GK SGA++ 
Sbjct: 331 YVPLVADPDREIPWERAVEQVTAGLTPLGPDYLGDLKAGLSSQWVDVLENQGKRSGAYSW 390

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
           G+    HPYIL+NY G   DV TLAHELGH +H   S+ +Q       +  +AE AS   
Sbjct: 391 GSY-GTHPYILMNYNGTLHDVFTLAHELGHSLHSFYSNRSQPYADAGYTTFVAEVASTTN 449

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E L  D LL+ A  +  +  LL  ++E +  ++ RQ  F  FE  +H    +   +    
Sbjct: 450 EALLLDHLLREARDQNTKLFLLNQRLEQIRTTVYRQALFASFERTVHRRVEAGEALTPED 509

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSL-YDIYK 569
           + ++W +  +   GP  ++  L  G  W  +PHF  S FYV+ YA G     SL   I K
Sbjct: 510 LGKLWHQLNERYYGPDLEVDPLLDGE-WSRIPHFY-SPFYVFQYATGYAAATSLSRQIQK 567

Query: 570 SNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
               +  +++YL++L  G S H  +LL    ++++ P      L+  E+ +D  E++
Sbjct: 568 GG--EPARKRYLHMLTRGGSAHPIDLLRDAGVDMATPQPLLDTLRVFEETLDAFEEL 622


>gi|225378022|ref|ZP_03755243.1| hypothetical protein ROSEINA2194_03682 [Roseburia inulinivorans DSM
           16841]
 gi|225210023|gb|EEG92377.1| hypothetical protein ROSEINA2194_03682 [Roseburia inulinivorans DSM
           16841]
          Length = 600

 Score =  196 bits (499), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 165/595 (27%), Positives = 276/595 (46%), Gaps = 21/595 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           WN++D+YP+ ++ E  N+++ I  E +     +EG++A         +L A +       
Sbjct: 17  WNVKDMYPTTEAWE--NELKVIT-EIVDKIASYEGSVA-----ATAENLLAVLEHLASAG 68

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           E I +  +YA   ++ + ++ T +     + +  A       F   EI    +  LE  Y
Sbjct: 69  EKIEKAFNYAERLFDEDQTNTTHQAMSAKVYSLYAAMGSKTAFVDPEIIAATDETLEAFY 128

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF---- 214
            + P    Y   I  IR++K+H LS +ME LL+ T+++ +     F   N   L F    
Sbjct: 129 KELPALELYRKQIAEIRRMKEHCLSAEMEKLLAMTAEMSQTPADTFSILNNADLVFPEIE 188

Query: 215 KINDQKIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
             N +K+ +T   Y  F  S DR VRK A + L  T+ +  +  + +     K +    +
Sbjct: 189 DENGEKVRITHGRYGQFLQSADRRVRKDAFENLYQTYKQFLNTSASLYCGNVKQQVFHAK 248

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
            RKY    +    +NNV   V   L+ +V     K  H+Y  L+KK L ++ ++ +D   
Sbjct: 249 ARKYASSLECAVDANNVSSSVYHNLIDTVNKNLDKM-HQYVSLRKKCLGVEELHMYDIYT 307

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           P+       I FE A++ VL++ A          ++ F + WID  +  GK SGA++ G 
Sbjct: 308 PMIADVAKKISFEEAKETVLKALAPLGEDYVNKVKEGFENRWIDVYENQGKRSGAYSAGA 367

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
               HPY+LLNY G   D+ TLAHE+GH +H   S+E Q  +     + +AE AS   E 
Sbjct: 368 Y-GCHPYVLLNYNGTLDDMFTLAHEMGHAMHSNYSNEAQPYIYAGYKIFVAEVASTCNEI 426

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           L  + LL+  + K+ER  LL + ++    ++ RQ  F ++E+  +        +    ++
Sbjct: 427 LLMEYLLKNTTDKKERAYLLNHYLDSFKGTVYRQTQFAEYEMLTNKMYEDGESLTADNLS 486

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSL-YDIYKSN 571
            ++LE  K+  G    +SD +    W  +PHF   +FYVY YA   C   S+ + I +  
Sbjct: 487 SVYLELNKKYYGSDI-ISDDQIAYEWARIPHFY-YNFYVYQYATSYCAAFSVAHKILEEG 544

Query: 572 TVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           T     E+Y   L  G S    ELL    +NL  P   +  L    ++I ++E +
Sbjct: 545 TPAV--ERYKKFLSGGCSMAPVELLKIAGVNLETPAPIQDALNAFGEIIKEMETL 597


>gi|229824994|ref|ZP_04451063.1| hypothetical protein GCWU000182_00343 [Abiotrophia defectiva ATCC
           49176]
 gi|229790741|gb|EEP26855.1| hypothetical protein GCWU000182_00343 [Abiotrophia defectiva ATCC
           49176]
          Length = 599

 Score =  196 bits (497), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 164/604 (27%), Positives = 286/604 (47%), Gaps = 39/604 (6%)

Query: 39  WNLEDLYPSHDS-QEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           W +ED++ S    +E  N+   +  E + F       +   T  ++  +L   +  YE+ 
Sbjct: 17  WKIEDIFVSEKEWEEALNEALSLADEIVEF-------IGKVT--ESADTLYKVLETYEKY 67

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTD-INAKLADFEKVLIFFALEINTLDEALLEQ 156
                 +  YA    + + +S + +K Y+  ++A++   EK L F   EI     A +E+
Sbjct: 68  SLKFHLVTGYAFKIRDVDTTSTSGQKLYSKAMSAEVIASEK-LAFMEPEIIAASAATIER 126

Query: 157 SYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF-K 215
            Y + P   KY  +I  IR+ K+H LS ++E LL+ T+++     + F   +   L+F +
Sbjct: 127 FYYEKPELAKYKIFIAEIRRGKEHSLSPELEKLLAGTNELTELPYEGFATLSNADLKFPE 186

Query: 216 INDQK-----------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLA 264
           I ++K           +PL ++       DR +RK   +    TF    + ++ +     
Sbjct: 187 ITNEKGESIQITNGRFVPLQES------KDRALRKEVFEKYYETFGSFKNTWAVLYAGQV 240

Query: 265 KDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDT 324
           K      R RKY    ++   S NV P V + L++++ +   K  HRY +L+K  L++D 
Sbjct: 241 KQLMFNARARKYSTTLEAAVDSTNVSPEVYKNLVETINDNLDKM-HRYVKLRKNLLEVDE 299

Query: 325 MYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKG 384
           ++ +D   P+    +     E A++LVL++          + +K F   WID  + +GK 
Sbjct: 300 LHMYDIYVPIVKDYEAKYTIEEAKELVLRAVEPLGTNYVNLLQKAFAERWIDVVENEGKR 359

Query: 385 SGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAE 444
            GA++ G +  VHP++LLN+ G   DV TLAHE+GH +H   S+E Q  L +   + +AE
Sbjct: 360 GGAYSSG-VYGVHPFVLLNFNGTLDDVFTLAHEMGHAMHSYFSNEGQNFLDSRYKIFVAE 418

Query: 445 TASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTG 504
            AS   E L  + +L+ A   +ER  LL + ++    ++ RQ  F +FE K   E   +G
Sbjct: 419 VASTTNEVLLMEYMLKNARDNKERTYLLNHYMDSFKGTVYRQTMFAEFE-KTSNELAESG 477

Query: 505 DIPTHR-INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG-NCLVN 562
           +  TH  +  ++LE  K+  G    +SD   G  WM +PHF   +FYVY YA G +  V 
Sbjct: 478 EPLTHENLTGLYLELNKKYYGEDM-VSDELIGYEWMRIPHFY-YNFYVYQYATGFSAAVA 535

Query: 563 SLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
             + I K          Y+  L +G +     LL    ++++        L+  E++I +
Sbjct: 536 IAHRILKEGETAV--NDYMKFLHSGCTDDPVSLLKIAGVDMASKEPINSALKIFERVIAE 593

Query: 623 VEKM 626
           +E +
Sbjct: 594 MEGL 597


>gi|269791717|ref|YP_003316621.1| oligoendopeptidase F [Thermanaerovibrio acidaminovorans DSM 6589]
 gi|269099352|gb|ACZ18339.1| oligoendopeptidase F [Thermanaerovibrio acidaminovorans DSM 6589]
          Length = 619

 Score =  195 bits (495), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 161/617 (26%), Positives = 285/617 (46%), Gaps = 44/617 (7%)

Query: 34  GNLP---------RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC 84
           G+LP         RW LED+YP+  S E   +   ++ E L     + G L+       C
Sbjct: 22  GDLPSRDQVPQELRWRLEDIYPTDASWE--EEFRAVQ-EQLPRLEAFRGKLSSPKELAAC 78

Query: 85  HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI-FFA 143
             L       +++   +G++ +YA++  + + ++PT +   +D  + LA        F  
Sbjct: 79  LKL------RDQLSIAVGKLYAYAVMRSHEDTANPTYQAL-SDRASSLATLLGAKTSFIE 131

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            E+  L   LL +S+  +P    +  ++  + +   H+LS + E L++   +V  E  +R
Sbjct: 132 PELVQLPRELL-RSFLDEPSLKDHRFFLSEVIRKSPHVLSREAEELVASMGEV-LEVPER 189

Query: 204 FF--CENIESLRFKINDQK-----IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIF 256
            F    N +     I D+K     +   + Y+     DR VR+ A ++L   ++   +  
Sbjct: 190 SFEMLTNADMTFAPIRDEKGKRVEMSEERYYRFLRSKDRRVRREAYESLYDAYSAHENTL 249

Query: 257 SFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELK 316
                 + K      + RKY  +       + +   V   L+ +V++   K  HRY +L+
Sbjct: 250 GATFGGMLKASSFLAKTRKYPSVLAMELFDDAIPEEVYRQLVDTVESNL-KPLHRYIDLR 308

Query: 317 KKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWID 376
            K LKLD +  +D   PL       IP++ A+++VL++ +         A +     W+D
Sbjct: 309 AKALKLDQLAPYDLHVPLAEEIHRDIPWDRAKEMVLEALSPLGEDYVRKAREGLASGWVD 368

Query: 377 APQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTN 436
             +  GK  GA++ G+    HPYIL+NY G   DV TLAHELGH +H + S  TQ   T+
Sbjct: 369 VVENRGKRGGAYSWGSY-GTHPYILMNYNGTISDVFTLAHELGHSMHTLYSHSTQPYPTS 427

Query: 437 NSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKL 496
           + S+ +AE AS   E L  + L++ A   +E+  L+  +++ + +++ RQ  F  FE ++
Sbjct: 428 DYSIFVAEVASTVNEMLLLEHLIRNAKDPKEKLYLINYQLDQIRSTLYRQTMFASFEREV 487

Query: 497 HTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAF 556
           H   +         + ++W +  +   GP F + D      W  +PHF  S FYV+ YA 
Sbjct: 488 HRRHQEGEPTSPRELRDLWGKLNRRYHGPNFQV-DQRITMEWARIPHFY-SPFYVFQYAT 545

Query: 557 GNCLVNSLYD-IYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDP-------NF 608
           G     SL + I K  +    +++YLN+L  G S H  ELL    ++++ P         
Sbjct: 546 GISAAISLSEAILKDPSA---RDRYLNMLSRGGSAHPIELLKDAGVDMTSPRPVLDAIGL 602

Query: 609 WERGLQTVEKMIDDVEK 625
           ++R L  +E ++D   +
Sbjct: 603 FDRRLGEMETLLDQAGR 619


>gi|253573281|ref|ZP_04850624.1| oligoendopeptidase F [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251846809|gb|EES74814.1| oligoendopeptidase F [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 612

 Score =  194 bits (494), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 163/623 (26%), Positives = 288/623 (46%), Gaps = 31/623 (4%)

Query: 15  FRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEIS-NDMECIEHESLAFKTRWEG 73
           F    R   M+T+  +  +     W L+DL+P   + + S ND++ ++ ++  F    EG
Sbjct: 8   FYPVQRRIPMSTVMKRSEVPKEHTWQLQDLFPDQAAWDKSYNDLKKLKDKAAEF----EG 63

Query: 74  NLAHATNQKNCHSLGAAIAEYERICEL-IGRIASYAMLSYNCNLSSPTIRKFYTDINAKL 132
            L  A + K       A+ E E    L I R+  YA L ++ + ++PT +          
Sbjct: 64  KLTDAEHIK-------AVFELEDELSLQIERLYVYAHLHHDEDTTNPTYQALVQKAKKLS 116

Query: 133 ADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSD 192
            +  + L F   EI  L E  L++    DP+   Y   ++ I++ K H+LS   E LL+ 
Sbjct: 117 VEVSEALSFITPEILALPEQELDK-LINDPVLADYKFTLQEIKREKAHVLSKTEEALLAQ 175

Query: 193 TSQVGREALKRFFCENIESLRF-KINDQ---KIPLTK-AYKSFFDS-DREVRKSAAKALS 246
              + +   + F   N   ++F KI D+   ++ LT  +Y  F ++ +REVR+ A KA+ 
Sbjct: 176 VGNLSQAPQQIFGMINNADMKFPKIKDENGNEVDLTHGSYIQFLENPNREVRERAFKAVY 235

Query: 247 HTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYP 306
            T+ K  +  +   +          R RKY  + +     +N+   V   L+ +V    P
Sbjct: 236 ETYRKQKNTIAATLSANVNKNMFYSRVRKYPSVLEMSLYGDNIPKEVYTNLIDAVHESLP 295

Query: 307 KTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIA 366
               RY +L+KK L +D ++ +D  APL    +  IP+E A+ +V +       +   + 
Sbjct: 296 -LLQRYMKLRKKLLGVDELHMYDLFAPLVEEYKWEIPYEDAKKMVEEGLKPLGEEYLKVL 354

Query: 367 EKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVL 426
            + F + WID  + +GK +GA++ G     HPY+LLN+      + TLAHE+GH +H   
Sbjct: 355 REGFENRWIDVYENEGKRTGAYSWGAY-GTHPYVLLNHKDNLNSMFTLAHEMGHALHSYF 413

Query: 427 SSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQ 486
           S E         ++ LAE AS   E L  D LL+ ++  +++  LL    +    ++ RQ
Sbjct: 414 SDEALKYRDAQYTIFLAEVASTTNEALLMDYLLKKSTDPKQKLYLLTYYADQFRTTLFRQ 473

Query: 487 ISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIE 546
             F +FE  +H    +   +    ++EI+ +   +  G    + D +    W  +PHF  
Sbjct: 474 TMFAEFEKLIHERAEAGESLTPQELSEIYYDLNVKYHGKDM-VVDQDIEMEWARIPHFY- 531

Query: 547 SSFYVYAYAFGNCLVNSLYDIYKSNTVDCFK---EKYLNILRAGNSKHYSELLLPLNINL 603
           +SFYVY YA G     S    +    ++  K   ++YL  L++G S +   +L    +++
Sbjct: 532 TSFYVYKYATGFSAATS----FSKQILEEGKPAVDRYLGFLKSGGSDYSINILKKAGVDM 587

Query: 604 SDPNFWERGLQTVEKMIDDVEKM 626
           S P      +   E +I+ +E++
Sbjct: 588 SSPQPIREAMSVFENVIEQMEQL 610


>gi|154249891|ref|YP_001410716.1| pepF/M3 family oligoendopeptidase [Fervidobacterium nodosum
           Rt17-B1]
 gi|154153827|gb|ABS61059.1| oligoendopeptidase, pepF/M3 family [Fervidobacterium nodosum
           Rt17-B1]
          Length = 586

 Score =  194 bits (492), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 161/600 (26%), Positives = 274/600 (45%), Gaps = 35/600 (5%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           RWNL ++YPS DS+   ND++ I+ E   F    + NL +  N      L   I +   +
Sbjct: 2   RWNLSNIYPSFDSESFKNDLQRIDKELSGFLNWMDENLINEGNGLEAK-LEYVINKLNEL 60

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADF-------EKVLIFFALEINTLD 150
             L G++ +YA L+ + N +  T  K+   I +K  +         K L    ++ + L 
Sbjct: 61  SLLAGKLYNYASLTLSANANDETAAKYLDIIRSKFVNLSLARTKLRKFLKNVEIDFSNLK 120

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIE 210
              L+           +  +I+  + + K+LLS + E ++S     G  A    + +   
Sbjct: 121 SETLKS----------HKFFIEEQKILSKYLLSENEEKIISLMRLTGGNAWNNLYEKTTS 170

Query: 211 SL--RFKINDQ--KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKD 266
           +L    +IN +  K+PL +     +D   E+RK A +A       +S + +   N++  +
Sbjct: 171 NLLCEVEINGELKKLPLMRVRNMAYDESAEIRKKAYEAELKACENASQVVAQCLNSIKGE 230

Query: 267 EEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMY 326
              +   R Y    +   + N +     +A+M +VK   P    +Y   K + L      
Sbjct: 231 FLTEVNLRGYSSPLEPMLMENRISKETFDAMMSAVKGSMP-ILRKYLRKKAELLGHKNGL 289

Query: 327 FW-DRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGS 385
            W D  AP+ G ++    F+ AR  +++  + FS ++    +  F ++WIDA    GK  
Sbjct: 290 PWYDLFAPIGGYNKKW-SFDEARKFIVEKLSNFSDELGKFIDNAFENHWIDAETRPGKRG 348

Query: 386 GAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIH-FVLSSETQGILTNNSSLTLAE 444
           GAF           IL+++ G   +V+TLAHELGH  H + L  ET   L + +  TLAE
Sbjct: 349 GAFCSSVKALKESRILMSFDGTLDNVLTLAHELGHAFHNYCLKDETP--LNSTTPATLAE 406

Query: 445 TASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTG 504
           TASIF ETL  + +   A+ K+E+  LL  ++ D +  I+   S + FE ++  ERR + 
Sbjct: 407 TASIFNETLLMNQIKNEATLKDEKLALLDKELSDAVQIIIDIYSRFLFESEVF-ERRKSR 465

Query: 505 DIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVY--AYAFGNCLVN 562
            I      EI L+ QKE+ G   D  +  +   W++ PH+   +F+ Y   Y FG     
Sbjct: 466 PISVEEFKEIMLKAQKEAYGEGLD-ENYMHPYMWLVKPHYYSPTFHFYNFPYTFGMLFGL 524

Query: 563 SLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
            +Y + K N    F E Y  +L +       E+ + + I++    FW+  L  +EK +D+
Sbjct: 525 GVYSM-KDNP--NFFEMYKKLLSSTGKGTAEEVAMSVGIDIQKEEFWKNSLSVIEKAVDE 581


>gi|319646548|ref|ZP_08000777.1| YjbG protein [Bacillus sp. BT1B_CT2]
 gi|317391136|gb|EFV71934.1| YjbG protein [Bacillus sp. BT1B_CT2]
          Length = 681

 Score =  192 bits (489), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 153/613 (24%), Positives = 295/613 (48%), Gaps = 33/613 (5%)

Query: 27  MDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS 86
           + S+E +     W LED++PS D+   + + + ++ E L   + ++G L H+ +      
Sbjct: 82  LPSREEVKQEDTWRLEDIFPSDDAW--NEEFQAVK-ELLPKLSEFKGKLGHSAD-----D 133

Query: 87  LGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADF----EKVLIFF 142
           L  A+   +++ E +G++ +YA + Y+ +    T   FY  +N K A+          + 
Sbjct: 134 LYEALTYQDKVMERLGKLYTYAHMRYDQD----TGNSFYQGLNDKAANLYTQAASATAYM 189

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
             EI ++ E  L+Q   +      YS  ++ I K + H+LS + E +L++ S V      
Sbjct: 190 VPEILSIQEEKLQQFLLEKEELKLYSHALEEINKERPHVLSEEEEGILAEASDVLSSPSN 249

Query: 203 RFFCENIESLRF----KINDQKIPLTKA-YKSFFDSD-REVRKSAAKALSHTFNKSSHIF 256
            F   N   + F      N +K+ LT   Y +F +S+ R+VR++A KA+  T+ +  +  
Sbjct: 250 TFGMLNNADMEFPEITDENGEKVQLTHGNYITFLESENRDVRRAAFKAVYETYGRFKNTL 309

Query: 257 SFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELK 316
           +   +   K +    + + Y+   ++    N++   V + L+ ++  + P   HRY E++
Sbjct: 310 ASTLSGAVKKDNFYAKVKHYKSAREAALSRNSIPEEVYDNLVSTINKHLP-LLHRYVEIR 368

Query: 317 KKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWID 376
           KK L+LD ++ +D   PL   S   + +E A+D +L+  A    + S I ++   + W+D
Sbjct: 369 KKVLELDEVHMYDLYTPLVKDSGMKVTYEQAKDYMLKGLAPLGEEYSSILKEGLNNRWVD 428

Query: 377 APQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTN 436
             +  GK SGA++ GT    +PYIL+N+     ++ TL HE GH +H   + + Q     
Sbjct: 429 VYENKGKRSGAYSSGTY-GTNPYILMNWQDNVNNLFTLVHEFGHSVHSYYTRKYQPYPYG 487

Query: 437 NSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKL 496
           N S+ +AE AS   E L  + LL     +++R  +L + +E    ++ RQ  F +FE ++
Sbjct: 488 NYSIFVAEVASTTNEALLGEYLLNTIEDEKQRLYILNHMLEGFKGTVFRQTMFAEFEHEI 547

Query: 497 HTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHF---IESSFYVYA 553
           H + +    +    +  I+ +  K+  G   ++ D E G  W  +PHF        Y   
Sbjct: 548 HVKAQEGEPLTPELLTSIYYDLNKKYFGDNIEI-DKEIGLEWSRIPHFYYNYYVYQYATG 606

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           ++    L   +    KS  VD    +Y+  L+AG+S +  E+L    ++++     E   
Sbjct: 607 FSAAQALSQQILKEGKS-AVD----RYIEFLKAGSSDYPIEVLKKAGVDMTSSEPIEAAC 661

Query: 614 QTVEKMIDDVEKM 626
           +  E+ ++++E++
Sbjct: 662 KKFEEQLNEMEEL 674


>gi|52079656|ref|YP_078447.1| oligoendopeptidase F,Pz peptidase [Bacillus licheniformis ATCC
           14580]
 gi|52785018|ref|YP_090847.1| YjbG [Bacillus licheniformis ATCC 14580]
 gi|52002867|gb|AAU22809.1| oligoendopeptidase F,Pz peptidase [Bacillus licheniformis ATCC
           14580]
 gi|52347520|gb|AAU40154.1| YjbG [Bacillus licheniformis ATCC 14580]
          Length = 667

 Score =  192 bits (489), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 153/613 (24%), Positives = 295/613 (48%), Gaps = 33/613 (5%)

Query: 27  MDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS 86
           + S+E +     W LED++PS D+   + + + ++ E L   + ++G L H+ +      
Sbjct: 68  LPSREEVKQEDTWRLEDIFPSDDA--WNEEFQAVK-ELLPKLSEFKGKLGHSAD-----D 119

Query: 87  LGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADF----EKVLIFF 142
           L  A+   +++ E +G++ +YA + Y+ +    T   FY  +N K A+          + 
Sbjct: 120 LYEALTYQDKVMERLGKLYTYAHMRYDQD----TGNSFYQGLNDKAANLYTQAASATAYM 175

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
             EI ++ E  L+Q   +      YS  ++ I K + H+LS + E +L++ S V      
Sbjct: 176 VPEILSIQEEKLQQFLLEKEELKLYSHALEEINKERPHVLSEEEEGILAEASDVLSSPSN 235

Query: 203 RFFCENIESLRF----KINDQKIPLTKA-YKSFFDSD-REVRKSAAKALSHTFNKSSHIF 256
            F   N   + F      N +K+ LT   Y +F +S+ R+VR++A KA+  T+ +  +  
Sbjct: 236 TFGMLNNADMEFPEITDENGEKVQLTHGNYITFLESENRDVRRAAFKAVYETYGRFKNTL 295

Query: 257 SFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELK 316
           +   +   K +    + + Y+   ++    N++   V + L+ ++  + P   HRY E++
Sbjct: 296 ASTLSGAVKKDNFYAKVKHYKSAREAALSRNSIPEEVYDNLVSTINKHLP-LLHRYVEIR 354

Query: 317 KKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWID 376
           KK L+LD ++ +D   PL   S   + +E A+D +L+  A    + S I ++   + W+D
Sbjct: 355 KKVLELDEVHMYDLYTPLVKDSGMKVTYEQAKDYMLKGLAPLGEEYSSILKEGLNNRWVD 414

Query: 377 APQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTN 436
             +  GK SGA++ GT    +PYIL+N+     ++ TL HE GH +H   + + Q     
Sbjct: 415 VYENKGKRSGAYSSGTY-GTNPYILMNWQDNVNNLFTLVHEFGHSVHSYYTRKYQPYPYG 473

Query: 437 NSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKL 496
           N S+ +AE AS   E L  + LL     +++R  +L + +E    ++ RQ  F +FE ++
Sbjct: 474 NYSIFVAEVASTTNEALLGEYLLNTIEDEKQRLYILNHMLEGFKGTVFRQTMFAEFEHEI 533

Query: 497 HTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHF---IESSFYVYA 553
           H + +    +    +  I+ +  K+  G   ++ D E G  W  +PHF        Y   
Sbjct: 534 HVKAQEGEPLTPELLTSIYYDLNKKYFGDNIEI-DKEIGLEWSRIPHFYYNYYVYQYATG 592

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           ++    L   +    KS  VD    +Y+  L+AG+S +  E+L    ++++     E   
Sbjct: 593 FSAAQALSQQILKEGKS-AVD----RYIEFLKAGSSDYPIEVLKKAGVDMTSSEPIEAAC 647

Query: 614 QTVEKMIDDVEKM 626
           +  E+ ++++E++
Sbjct: 648 KKFEEQLNEMEEL 660


>gi|229541378|ref|ZP_04430438.1| oligoendopeptidase F [Bacillus coagulans 36D1]
 gi|229325798|gb|EEN91473.1| oligoendopeptidase F [Bacillus coagulans 36D1]
          Length = 604

 Score =  192 bits (489), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 163/599 (27%), Positives = 288/599 (48%), Gaps = 29/599 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W LED++PS D  + + + + ++ E LA    ++G L  +  Q     L  A+   + + 
Sbjct: 22  WRLEDIFPSDD--DWNKEYQAVK-EKLADAASYQGKLGESAEQ-----LYHALKFQDEVT 73

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKL----ADFEKVLIFFALEINTLDEALL 154
           E  G++ +YA + Y+ +    T   FY  I++K     A       F   EI +++EA L
Sbjct: 74  ERFGKLYTYAHMRYDQD----TTNAFYQGIDSKAKSLAAQVGSAFAFVVPEILSIEEAKL 129

Query: 155 EQSY-AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLR 213
            Q   A +PL L Y   ++ I +++ H+LS + E LL+  S+V   +   F   N   L 
Sbjct: 130 NQFLEAYEPLQL-YRHALEEINEMRPHILSKEEEALLAQVSEVLNTSSTTFGMLNNADLE 188

Query: 214 FKI----NDQKIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAKDE 267
           F      N  ++ +T   +    +S DR VRK A + L  T+ K ++ F+   +   K  
Sbjct: 189 FPTVIDENGNEVQITHGRFTRLLESKDRRVRKEAFQKLYATYKKFTNTFASTLSGQVKKN 248

Query: 268 EIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYF 327
            +  + R Y    ++   +N++   V + L+++V N +    HRY  L+KK L+LD ++ 
Sbjct: 249 NVVAQIRHYHSAREAALSANHIPEKVYDQLVETV-NKHLGLLHRYVALRKKALQLDEVHM 307

Query: 328 WDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGA 387
           +D   PL   +   + +E A+++VL        +   I ++ F + WID  +  GK SGA
Sbjct: 308 YDLYTPLVQDADMEVTYEKAKEIVLDGLHPLGEEYRSILQQAFENRWIDVVENKGKRSGA 367

Query: 388 FAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETAS 447
           ++ G     +PYILLN+     +V TLAHELGH +H   + + Q     + S+ +AE AS
Sbjct: 368 YSSGAY-GTNPYILLNWQDNIDNVFTLAHELGHSVHSYYTRKNQPYPYGDYSIFVAEVAS 426

Query: 448 IFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIP 507
              E L  D LL+    +++R  LL + +E    ++ RQ  F +FE  +H + +    + 
Sbjct: 427 TCNEALLNDYLLKTIKDEKQRIYLLNHYLEGFRGTVFRQTMFAEFEHLIHQKAQHGEALT 486

Query: 508 THRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDI 567
              + + + +  ++  G    + D E G  W  +PHF    + VY YA G     +L   
Sbjct: 487 AELLTDEYYKLNQKYYGTDTAI-DQEIGLEWARIPHFYYDYY-VYQYATGFSAATALSKQ 544

Query: 568 YKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
                    K +Y+  L AG+S++  E+L    ++++ P   E  L+  E+ + ++E +
Sbjct: 545 ILEEGEPAVK-RYIGYLSAGSSEYPIEVLKKAGVDMTSPQPVEDALKVFEEKLTEMENL 602


>gi|46446812|ref|YP_008177.1| putative oligoendopeptidase F [Candidatus Protochlamydia
           amoebophila UWE25]
 gi|46400453|emb|CAF23902.1| putative oligoendopeptidase F [Candidatus Protochlamydia
           amoebophila UWE25]
          Length = 614

 Score =  192 bits (488), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 169/637 (26%), Positives = 294/637 (46%), Gaps = 58/637 (9%)

Query: 19  LRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHA 78
           ++   +    S+E +    RWN+E+LY SH++ E             AF+T      ++A
Sbjct: 1   MKQRKLNMTKSREEVSLSDRWNVEELYLSHEAWE------------QAFQT-----FSNA 43

Query: 79  TNQKN--CHSLGAAIAEYERICELI--------------GRIASYAMLSYNCNLSSPTIR 122
            +Q+   C ++ A      R  E +               ++ +YA L ++ ++++P  +
Sbjct: 44  GSQQTSLCPAIQALQGSLHRGPEYVKNTLDLMMSMDRELSKLYTYAHLRHDEDIANPIFK 103

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           K Y  I      F + + +F  E+  L    LE+ Y   P  + Y   ++ I + KKH L
Sbjct: 104 KSYEQILTIAHKFSQEISWFQPELLALSNEQLEE-YLNSPALVAYKFHLEKIIRTKKHTL 162

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFK-INDQKI---PLTKAYKSFF--DSDRE 236
           S + E LL+   Q  + + K F   +    +F  I D K     L+ A  S +  D DR 
Sbjct: 163 SFENEKLLAFAGQALQTSYKAFNAISDADFKFAPIKDDKGSEHALSHATYSLYIRDQDRF 222

Query: 237 VRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEA 296
           +R+ A     H +    +    + +   ++   Q R R Y    +S     N+   V  A
Sbjct: 223 LREKAFNQYHHQYLAYENTLCELLSGQVQNHLFQARSRHYTSCLESALFPKNIPTSVYHA 282

Query: 297 LMQSVKNYYPKTS--HRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQS 354
           L+++V     K S  HRY  L+K+ LKLD ++ +D   PL       + ++ A D+V++S
Sbjct: 283 LIEAVTE---KISVLHRYMGLRKRILKLDQLHLYDIYVPLTSAVDIRLSYKEAEDIVIES 339

Query: 355 YAKFSPQ-MSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMT 413
            A    +  S++A+      W+D  +   K SGA++ G   S+ PYIL+NY    +DV T
Sbjct: 340 VAPLGSEYQSLLAKGLKEERWVDRYENQNKRSGAYSSGCFDSM-PYILMNYKNLLRDVFT 398

Query: 414 LAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLA 473
           LAHE GH +H + S  TQ    ++  + LAE AS F E L    L+       E+  L+ 
Sbjct: 399 LAHEAGHSMHSLYSRRTQPYQYSDYPIFLAEVASTFNEDLLSRLLINRCQDPIEKIFLVN 458

Query: 474 NKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLS--- 530
            K+ED+  ++ RQ  F +FEL +H +      +    + + + +   +  GP   +    
Sbjct: 459 QKVEDIRATLFRQTMFAEFELLIHEQVEQDIPLTPQLLKQEYRKLNHKYFGPDVIIDKAI 518

Query: 531 DLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYD-IYKSNTVDCFKEKYLNILRAGNS 589
           D+E    W  +PHF   +FYV+ YA G     ++ D +      D  +E YLN L+ G S
Sbjct: 519 DIE----WARIPHFY-YNFYVFQYATGISAALAIADKVVNGQQQD--RENYLNFLKGGCS 571

Query: 590 KHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           ++  E+L    I++  P   +  +Q  +++++++E +
Sbjct: 572 QYPIEMLKMAGIDMESPLPVKSTIQKFDQLLNELESL 608


>gi|320528284|ref|ZP_08029446.1| oligoendopeptidase F [Solobacterium moorei F0204]
 gi|320131198|gb|EFW23766.1| oligoendopeptidase F [Solobacterium moorei F0204]
          Length = 601

 Score =  192 bits (488), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 163/617 (26%), Positives = 285/617 (46%), Gaps = 39/617 (6%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDS-QEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           MT +  +  +    +W+L  L+ S ++  E    ++ +  E+ +F+ +            
Sbjct: 1   MTELKERNQIEQKYKWDLSTLFESDEAWNEALTKLDALISEAASFQGKL----------N 50

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
           N  SL A     + + + +  + +YAML ++ +  +   +  Y+    K  +      F 
Sbjct: 51  NTESLLAYFTVSDELDKALNNVFTYAMLRHSEDTRATDAQGMYSKAYGKYVEAVSATSFA 110

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQV----GR 198
             EI   DE +L++ +  DP    ++  ++N+ + K H LS   E LLS   +V    GR
Sbjct: 111 QPEILGNDEEVLKR-FIADPSLNDFAFLLENLVRNKAHTLSAAEEKLLSTFGEVFSAPGR 169

Query: 199 --EAL---KRFF--CENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNK 251
             EAL      F   ++ E    ++N     L +        DRE+RK++  +L   + +
Sbjct: 170 TSEALMDADMVFDAAKDGEGNSHEVNGSSYILLQG-----SDDRELRKNSFTSLYKGYKQ 224

Query: 252 SSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHR 311
             + F+   +T  K   I  + R +E    +   S+N+   V + L+++V  + P T +R
Sbjct: 225 HINTFASTYSTTVKAASIDAKVRHHESSRQAAMFSDNIPVSVYDNLVETVHKHLP-TMYR 283

Query: 312 YYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFT 371
           Y +L+KK L LD ++++D  APL   S     +E A+++VL++      + + + +    
Sbjct: 284 YVKLRKKMLDLDELHYYDVYAPLLKGSAKDYSYEEAKEMVLEAVEPLGTEYTDVVKAGLE 343

Query: 372 HNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQ 431
           + W+D     GK  GA++ GT  S +PYIL NY G    V TLAHE+GH +H   ++ TQ
Sbjct: 344 NRWVDVYPNKGKRGGAYSSGTYTS-NPYILCNYTGTLDSVSTLAHEMGHSMHSYRTNHTQ 402

Query: 432 GILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYD 491
            +   N ++ +AE AS   E L  + LLQ  +   +R  LL   +E    +I RQ  F +
Sbjct: 403 PVHYANYTMFVAEVASTVNENLLIEQLLQKETDPAQRMALLNQYMEGFKGTIYRQTMFAE 462

Query: 492 FELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYV 551
           FE + H        +    +N+++L   K+  G    + D E    W  +PHF    FYV
Sbjct: 463 FEKEAHAASERGESLTPEFLNQLYLNLVKKYFGEELVIDD-EVQYEWARIPHFYR-PFYV 520

Query: 552 YAYAFGNCLVNSLYDIYKSNTVDCFKE---KYLNILRAGNSKHYSELLLPLNINLSDPNF 608
           Y YA G     ++        +   KE   KYL  L  G+S +  + L    ++L+ P  
Sbjct: 521 YVYATGYSTAVAI----SEGILHGGKEKVQKYLEFLSMGSSAYPIDELKHAGVDLTTPEP 576

Query: 609 WERGLQTVEKMIDDVEK 625
            +  L+   K++DD E+
Sbjct: 577 IDIALEKFAKILDDAEE 593


>gi|295111136|emb|CBL27886.1| oligopeptidase F. Metallo peptidase. MEROPS family M03B
           [Synergistetes bacterium SGP1]
          Length = 659

 Score =  191 bits (486), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 154/599 (25%), Positives = 276/599 (46%), Gaps = 27/599 (4%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           RW+LE +YPS ++ E +      + ++LA    + G L     +         + EY + 
Sbjct: 75  RWDLEAIYPSFEAWERAFSDLTPKIDALA---GFAGRLGEGPKK---------LLEYLKA 122

Query: 98  CELIG----RIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEAL 153
            E +     ++  YA +  + +L      +  + I A  A    V  FFA E+  L E  
Sbjct: 123 EEAVSLELEKLYVYANMKSHEDLRETRPMELASRIEALSARHGVVTAFFAPEVLELPEDE 182

Query: 154 LEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLR 213
           L +    +P    Y+ +++ + + ++H+L    E LL+   +        F       L+
Sbjct: 183 LRRWVRGEPGLKLYAFFVERLLREREHILPRAEEALLASAREATAAPENAFSLLTNADLK 242

Query: 214 FK-INDQK---IPLT--KAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDE 267
           F  I D++   + LT  + YK      R+VR++A + +  T+    +  + +     K +
Sbjct: 243 FPTIRDEEGRSVELTEERWYKLSRSPSRDVRRAAFEGIYGTYGSFKNALAALYAGSVKGD 302

Query: 268 EIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYF 327
               R R+Y+   ++    +NV   V E ++ +     P   HR   L+K+ LKLD +++
Sbjct: 303 LFYARARRYKDSLEAALFGDNVPRSVYENVVDTAARCAP-LMHRLVALRKRALKLDRLHY 361

Query: 328 WDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGA 387
           +D   P+    ++ IP+E A  +V ++ A          ++     WID  +  GK  GA
Sbjct: 362 YDLNVPIAEEPREDIPYERACRMVAEALAPLGEDYVANFKRGLAERWIDVYENRGKRKGA 421

Query: 388 FAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETAS 447
           ++ G+  + HPY+LLNY G   DV TLAHE+GH +H   S   Q  +  + ++ LAE AS
Sbjct: 422 YSWGSY-ATHPYVLLNYNGTLNDVFTLAHEMGHSMHSWYSHRNQPQVYGDYTILLAEVAS 480

Query: 448 IFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIP 507
              E L    LL+ A ++EERK LL+     +  +  RQ  F DFEL++H      G + 
Sbjct: 481 TTNEALLLGHLLKTAKTEEERKWLLSYYYNMVRTTFFRQAMFADFELQVHARAEEGGALT 540

Query: 508 THRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDI 567
              ++ +W E  +   GP     +L +   W  +PHF  S+FYVY Y  G    N+    
Sbjct: 541 PEWMSGLWRELNERCYGPDMAPDELLWVE-WARIPHFY-SAFYVYKYVTGFTAANAFASA 598

Query: 568 YKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
             +       ++YL  L++G S     +L    ++L+    ++R ++  ++ +++ E++
Sbjct: 599 ILAGEPGAV-DRYLTFLKSGGSDESLNILRRAGVDLTSREPFDRTMKLFQERLEEGERV 656


>gi|167037394|ref|YP_001664972.1| oligoendopeptidase F [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|320115808|ref|YP_004185967.1| oligoendopeptidase F [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|166856228|gb|ABY94636.1| oligoendopeptidase F [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|319928899|gb|ADV79584.1| oligoendopeptidase F [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
          Length = 596

 Score =  191 bits (485), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 170/613 (27%), Positives = 290/613 (47%), Gaps = 28/613 (4%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDS-QEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           M  +  +  + +  +W LED+Y + +  +E  N  + +  E + FK    G +  + N  
Sbjct: 1   MEVLKDRSEIEDKYKWRLEDIYENENLWEEDYNKTKELLKEIVKFK----GKINTSRNLL 56

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKL-ADFEKVLIF 141
               L       ++I     +I +YA +  + + ++P  +   TD   +L  +      F
Sbjct: 57  EVLKLN------DQIGMTASKIFAYARMRRDEDNTNPKYQAL-TDKAMRLNIEVMSATSF 109

Query: 142 FALEINTLD-EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
            A EI ++D + L+E     + L + Y  +++++ + K H+LS++ E +L++   +    
Sbjct: 110 IAPEILSIDTQKLMEMIEGLEELKI-YKQYLEDLIRFKPHVLSSEEEKILAEAETLAESV 168

Query: 201 LKRFFCENIESLRFK-INDQK---IPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSH 254
              +   N   +RF  I D++   + LT   +  F  S DR VRK+A  A+  T+ K  +
Sbjct: 169 SNVYTMLNNADMRFSTIKDEEGKEVELTHGNFVRFMQSKDRNVRKAAFNAMYDTYKKFIN 228

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
            F+       K +    + RKY    ++    +NV   V   L+++V +      HRY  
Sbjct: 229 TFASTMAGNVKKDIFYAKTRKYNSSLEASLFEDNVSVEVYNNLIETVHSRLD-VLHRYVR 287

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           LKKK L LD ++ +D   PL         +E A +LVL+       +   +  K F   W
Sbjct: 288 LKKKLLGLDELHMYDLYVPLIQEYDKKFTYEEAINLVLEGLQPLGDEYINLLRKGFNSRW 347

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D  +  GK SGA++ GT  + HPY+LLNY GK  DV T+AHE+GH +H   S+ TQ  +
Sbjct: 348 VDVYENRGKTSGAYSWGTYGT-HPYVLLNYQGKLNDVFTIAHEMGHSLHTYYSNATQPYV 406

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
                + +AE AS   E L  D LL+ +  ++ER  LL +  E+   ++ RQ+ F +FE 
Sbjct: 407 YAGYKIFVAEVASTCNEALLMDYLLKNSKDEKERLYLLNHFFEEFRGTVYRQVMFAEFEK 466

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSF-WMMVPHFIESSFYVYA 553
            +H        +    +N+ + E  K   G   D+   E  S+ W  +PHF   +FYVY 
Sbjct: 467 LIHEMAERGEPLTAEVLNKKYYELNKLYYGD--DIVVDEGISYEWARIPHFY-RNFYVYK 523

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YA G     ++  +   N  +   E+Y   L++G+S +   LL    ++L+ P      L
Sbjct: 524 YATGFSAAIAISQMI-LNEGEKAVERYKEFLKSGSSDYPLNLLKKAGVDLTTPKPVNDAL 582

Query: 614 QTVEKMIDDVEKM 626
              EK++D+ EKM
Sbjct: 583 DVFEKLLDEFEKM 595


>gi|167628683|ref|YP_001679182.1| oligoendopeptidase f [Heliobacterium modesticaldum Ice1]
 gi|167591423|gb|ABZ83171.1| oligoendopeptidase f [Heliobacterium modesticaldum Ice1]
          Length = 604

 Score =  191 bits (485), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 157/599 (26%), Positives = 282/599 (47%), Gaps = 27/599 (4%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           +W LED+YP+ D+ E   D + +    L   T  +G L     Q+   +L A +   + +
Sbjct: 18  KWKLEDIYPTDDAWE--KDFQAVP-ALLDKITALKGKL-----QEKSANLLAVLQLQDEL 69

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTD----INAKLADFEKVLIFFALEINTLDEAL 153
            + + +I +YA +  + + ++PT +   TD    +NA+ A       F   EI  + + +
Sbjct: 70  GKGLEKIFTYARMRRDEDNTNPTYQAL-TDRAVALNARAAGETS---FITPEILAIPDDI 125

Query: 154 LEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLR 213
           L++   ++     Y   + ++++ K H+L+ D E +L+  S++G+   + F   N   L 
Sbjct: 126 LQRFQKEEQGLALYRFLLDDLKRQKAHVLTADEEAILAQASELGQSPGQIFTMLNNADLT 185

Query: 214 F-KINDQK---IPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAKDE 267
           F  I D++   + +T   Y    +S DR VRK A   L  T+ K  +  +    +  K +
Sbjct: 186 FPTIRDEEGREVEITHGRYGQLMESKDRRVRKEAFYGLYGTYKKLENTLAATFTSAIKRD 245

Query: 268 EIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYF 327
               R R+Y    ++    +NV   V + L+ +V+ +     HRY  L+KK L +D ++ 
Sbjct: 246 VFFSRVRRYPSALEAALFGDNVPKDVYDNLIGTVRKH-NDAMHRYVRLRKKLLGVDQLHM 304

Query: 328 WDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGA 387
           +D   P+       + ++ A ++V Q           + ++ F   WID  +  GK SGA
Sbjct: 305 YDLYVPMVADVDWKVTYKEALEMVKQGLEPLGDDYGRVLDESFKTGWIDVYENKGKTSGA 364

Query: 388 FAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETAS 447
           ++ G     HPY+LLNY  +  DV TLAHE+GH +H   S + Q  + +  ++ +AE AS
Sbjct: 365 YSWGPY-GTHPYVLLNYQDRLDDVFTLAHEMGHALHSYYSHKEQPYIYSAYTIFVAEVAS 423

Query: 448 IFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIP 507
              ETL    LL+    K  R  L+ + +E    ++ RQ  F +FE  +H +  +   + 
Sbjct: 424 TVNETLLIRHLLEREQDKSRRLYLINHYLEQFRGTLYRQTMFAEFEKIVHAKIEAAEALT 483

Query: 508 THRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDI 567
              + +I+     +  GP   + D      W  +PHF  ++FYVY YA G     +L   
Sbjct: 484 LQELKQIYHRLNVDYYGPDIIVDDDIDIE-WARIPHFY-NNFYVYKYATGFSAATALSAQ 541

Query: 568 YKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
             +       E+YL  L++G S +  ELL    +++      E+ L    +++D++EK+
Sbjct: 542 ILAEGQPAV-ERYLTFLKSGGSDYPLELLKRAGVDMGTAEPIEKALSVFRELLDEMEKL 599


>gi|285808492|gb|ADC36016.1| oligoendopeptidase F [uncultured bacterium 259]
          Length = 641

 Score =  191 bits (484), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 157/597 (26%), Positives = 274/597 (45%), Gaps = 19/597 (3%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           +WNL DLY S ++   + D    E   +A    ++G LA +  +     L  A+    R+
Sbjct: 52  KWNLTDLYASDEAWRSAKDELVPE---IAKAAAFKGTLATSPAK-----LAEALDTVNRL 103

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQS 157
            + + R   YA L  + +      +    ++    A F + + +   EI  +D+A L+  
Sbjct: 104 GKELQRAYLYASLISDQDTRVSKYQGMQQEMQQLGAKFGEAIAYIEPEILKIDKATLDTW 163

Query: 158 YAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQV---GREALKRFFCENIESLRF 214
            AQ+P    Y  ++ ++++ + H LS++ E LL+ +S V   G          +      
Sbjct: 164 AAQEPKLKIYRHYLDDLQRRRPHTLSDNEERLLAASSVVTATGSSVYNILSNADFPYPSV 223

Query: 215 KINDQK-IPLTKAYKSFFDS--DREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
            ++D K + L  +  S +    +RE RK    A  +T       F    N   +  E   
Sbjct: 224 TLSDGKTVKLDASAFSLYRGVPNREDRKKVMAAFFNTLGDYKGTFGATLNGQVQANEFYA 283

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRL 331
             R Y+   ++   + N+   V  +L+  V    P T  RY +L+KK + L  ++++D  
Sbjct: 284 NARHYKTALEAALDAPNIPAAVYTSLVDGVNQGLP-TFQRYLQLRKKMMNLPDLHYYDLY 342

Query: 332 APLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHG 391
           APL  ++      E A+  VL + A   P      ++ FT  WID    +GK SGA+++G
Sbjct: 343 APLVASADLSYTPEEAQSNVLAALAPLGPDYIAAVKRAFTERWIDLLPTEGKKSGAYSNG 402

Query: 392 TIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE 451
               VHPY+L+N+ GK  D+ T AHELGH +   LS++ Q     N    +AE AS F E
Sbjct: 403 AGYDVHPYMLINFNGKYADMSTEAHELGHTMQSYLSNKAQPFPLANYPTFVAEVASTFNE 462

Query: 452 TLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRI 511
            L  + +L+       R  LL N +E++  ++ RQ  F +FEL++H        I    +
Sbjct: 463 ALLIEHMLKTIKDDNTRLSLLGNYLENIKGTVFRQTQFAEFELRIHQAAERGQPITGETL 522

Query: 512 NEIWLETQKESLG--PAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYK 569
           ++++L+  ++  G      + D      W  +PHF    FYV+ YA       +L +   
Sbjct: 523 DQLYLDIVRKYYGHDKGVCVVDDYVAHEWAFIPHFY-LDFYVFQYATSFTASAALSEKVL 581

Query: 570 SNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           +      K +YL  L AG SK+  ELL    ++++     +  +Q + +++D++EK+
Sbjct: 582 AGDPAATK-RYLAFLSAGGSKYPIELLKDAGVDMTTNEPLQLTVQKMNRIMDEMEKL 637


>gi|240144112|ref|ZP_04742713.1| oligoendopeptidase F [Roseburia intestinalis L1-82]
 gi|257203904|gb|EEV02189.1| oligoendopeptidase F [Roseburia intestinalis L1-82]
          Length = 600

 Score =  191 bits (484), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 138/493 (27%), Positives = 233/493 (47%), Gaps = 13/493 (2%)

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           F   EI  +DEA+LE  Y + P    Y   I+ I + K H LS +ME L++ T  +   +
Sbjct: 111 FIVPEILAMDEAVLEGYYKELPELELYRKQIEEIERTKAHTLSAEMEKLVAMTGDMAETS 170

Query: 201 LKRFFCENIESLRF-KINDQKIPLTKAYKSFF-----DSDREVRKSAAKALSHTFNKSSH 254
            + +   N     F +I D++    +     F      +DR VRK A +     + + ++
Sbjct: 171 GQVYSIINNADFVFPEIKDEEGDTVRLSHGNFVPFEESADRRVRKDAFEGFYGVYKQYAN 230

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
             + + N   K +      R Y    ++   +NNV P V   L+ ++     K  HRY  
Sbjct: 231 TLAALYNGQVKQQVFYANARHYHSTLEAAVDANNVSPTVYHNLIDTINKNMDKM-HRYVR 289

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+KK L +D ++ +D   P+   +   I FE A++ VL++ A    +     ++ F   W
Sbjct: 290 LRKKCLGVDELHMYDVYTPMIADAAKKISFEEAKETVLKALAPLGEEYVAKVKEGFESRW 349

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           ID  + +GK SGA++ G   S HPY+LLN+     ++ TLAHE+GH +H   S+ +Q  +
Sbjct: 350 IDVYENEGKRSGAYSAGAYGS-HPYVLLNHNDTLDNMFTLAHEMGHAMHSYYSNSSQPYI 408

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
            +   + +AE AS   E L  + LL+  + K+ER  LL + ++    ++ RQ  F ++E+
Sbjct: 409 YSQYKIFVAEVASTCNEVLLMEYLLKNTTDKKERAYLLNHYLDSFKGTVYRQTMFAEYEM 468

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
             +        +    +N+++ +   +  GP   +SD E    W  +PHF   +FYVY Y
Sbjct: 469 LSNKMVEEGESLTAETLNKLYYDLNCKYFGPDM-VSDSEIAYEWARIPHFY-YNFYVYQY 526

Query: 555 AFG-NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           A G +  V   + I K        E+Y   L  G S    ELL    +NL  P   +  L
Sbjct: 527 ATGFSSAVALAHGILKEGAPAV--ERYKKFLSGGCSASPVELLKIAGVNLETPKPIQEAL 584

Query: 614 QTVEKMIDDVEKM 626
               +++D++E +
Sbjct: 585 DVFGEVLDEIEAL 597


>gi|291536237|emb|CBL09349.1| oligopeptidase F. Metallo peptidase. MEROPS family M03B [Roseburia
           intestinalis M50/1]
          Length = 599

 Score =  190 bits (482), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 138/493 (27%), Positives = 232/493 (47%), Gaps = 13/493 (2%)

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           F   EI  +DEA+LE  Y + P    Y   I+ I + K H LS +ME L++ T  +   +
Sbjct: 111 FIVPEILAMDEAVLEGYYKELPELELYRKQIEEIERTKAHTLSAEMEKLVAMTGDMAETS 170

Query: 201 LKRFFCENIESLRF-KINDQKIPLTKAYKSFF-----DSDREVRKSAAKALSHTFNKSSH 254
            + +   N     F +I D+     +     F      +DR VRK A +     + + ++
Sbjct: 171 GQVYSIINNADFVFPEIKDEDGDTVRLSHGNFVPFEESADRRVRKDAFEGFYGVYKQYAN 230

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
             + + N   K +      R Y    ++   +NNV P V   L+ ++     K  HRY  
Sbjct: 231 TLAALYNGQVKQQVFYANARHYHSTLEAAVDANNVSPTVYHNLIDTINKNMDKM-HRYVR 289

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+KK L +D ++ +D   P+   +   I FE A++ VL++ A    +     ++ F   W
Sbjct: 290 LRKKCLGVDELHMYDVYTPMIADAAKKISFEEAKETVLKALAPLGEEYVAKVKEGFESRW 349

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           ID  + +GK SGA++ G   S HPY+LLN+     ++ TLAHE+GH +H   S+ +Q  +
Sbjct: 350 IDVYENEGKRSGAYSAGAYGS-HPYVLLNHNDTLDNMFTLAHEMGHAMHSYYSNSSQPYI 408

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
            +   + +AE AS   E L  + LL+  + K+ER  LL + ++    ++ RQ  F ++E+
Sbjct: 409 YSQYKIFVAEVASTCNEVLLMEYLLKNTTDKKERAYLLNHYLDSFKGTVYRQTMFAEYEM 468

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
             +        +    +N+++ +   +  GP   +SD E    W  +PHF   +FYVY Y
Sbjct: 469 LSNKMVEEGESLTAETLNKLYYDLNCKYFGPDM-VSDSEIAYEWARIPHFY-YNFYVYQY 526

Query: 555 AFG-NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           A G +  V   + I K        E+Y   L  G S    ELL    +NL  P   +  L
Sbjct: 527 ATGFSSAVALAHGILKEGASAV--ERYKKFLSGGCSASPVELLKIAGVNLETPKPIQEAL 584

Query: 614 QTVEKMIDDVEKM 626
               +++D++E +
Sbjct: 585 DVFGEVLDEIEAL 597


>gi|312143646|ref|YP_003995092.1| oligoendopeptidase F [Halanaerobium sp. 'sapolanicus']
 gi|311904297|gb|ADQ14738.1| oligoendopeptidase F [Halanaerobium sp. 'sapolanicus']
          Length = 598

 Score =  190 bits (482), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 155/577 (26%), Positives = 267/577 (46%), Gaps = 23/577 (3%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           +WNL+ +Y   +S EI  +++ +  +  A K  ++ +       ++   L  A+ E  ++
Sbjct: 16  KWNLDHIYADDNSFEI--ELQKVLQKIEAIKN-YKNDFC-----EDGEKLYNALNEIIKV 67

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQS 157
            E   R+ +YA + Y+ N  +   + +         +      F    I  L E  L++ 
Sbjct: 68  EEKTSRLYAYAHMKYDQNTKNEKYQNYKNKAMTAYNNLNNSTSFMLPAIIELGEEKLKEY 127

Query: 158 YAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI- 216
             ++     Y  +  NI + K H LS D E +L+   +V + +   F   N   L F + 
Sbjct: 128 IKENEELSFYEHFFDNIMRQKDHYLSADEEKILALAGEVTQSSENIFSMLNNADLEFPLI 187

Query: 217 ---NDQKIPLTKA-YKSFF-DSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
              N ++I LT   Y     + DREVRK A   +   + K  + F+ + ++  K +    
Sbjct: 188 EDENGEEIRLTHGRYIDLLKNEDREVRKEAFNGMHGEYEKLDNTFAAVLDSSVKGDIFYA 247

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVK-NYYPKTSHRYYELKKKWLKLDTMYFWDR 330
           R RKYE   ++    +N+   V + L+ S+  N  P   H Y ELKK+ L+LD ++ +D 
Sbjct: 248 RARKYESSLEASLDDDNISVDVYDNLINSISDNLAP--LHEYMELKKEMLELDELHIYDT 305

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
             PL         +E ++D++ ++          I +K F   WID  +  GK SGA++ 
Sbjct: 306 YTPLIKEIDLKFEYEESKDIIKKALQPLGEDYVSIVDKAFNSGWIDVYENKGKRSGAYSS 365

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
           G    VHP+IL+NY     ++ TL HE+GH +H   +++ Q  + +   + +AE AS   
Sbjct: 366 GCY-GVHPFILMNYTKDISNLFTLIHEMGHALHSYYTNKNQPYIYSKYKIFVAEVASTLN 424

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E L  D +L  A S+EE+  LL   +E    ++ RQ  F +FE  +H E      + +  
Sbjct: 425 ENLLVDYMLNNAESREEKLYLLNYFLEGFRGTVYRQTMFAEFEKLIHQEVEKGAGLTSQS 484

Query: 511 INEIWLETQKESLGPAFDLS-DLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYK 569
           + + +    K+  G    +   L+Y   W  +PHF   +FYVY YA G     +L +  K
Sbjct: 485 MQQKYNNLNKKYFGDQLAIDKKLDYE--WARIPHFY-YNFYVYKYATGYSAATALAEKIK 541

Query: 570 SNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDP 606
           +   +   E+YL+ LRAG S +   +L    +N+  P
Sbjct: 542 NEGGEA-AERYLDFLRAGGSDYPLNILKNAGVNMEKP 577


>gi|163848151|ref|YP_001636195.1| oligoendopeptidase F [Chloroflexus aurantiacus J-10-fl]
 gi|222526052|ref|YP_002570523.1| oligoendopeptidase F [Chloroflexus sp. Y-400-fl]
 gi|163669440|gb|ABY35806.1| oligoendopeptidase F [Chloroflexus aurantiacus J-10-fl]
 gi|222449931|gb|ACM54197.1| oligoendopeptidase F [Chloroflexus sp. Y-400-fl]
          Length = 602

 Score =  190 bits (482), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 152/595 (25%), Positives = 269/595 (45%), Gaps = 21/595 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  ++P  D      ++  +E  +       +G LA    Q     L  A+   + + 
Sbjct: 20  WDLSQIFP--DVAAWEQELSAVEARAQELAA-LQGTLAQGPAQ-----LLTALTLRDEVG 71

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
             +  I  YA    + + ++P  +      ++  A  +  L F   E+ T+    +E   
Sbjct: 72  RRLYAIYVYATHLKDSDSTNPVGQGLAERASSFAARIQAALAFIEPELLTIPAETIEAWV 131

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI-- 216
              P    Y   ++ + + + H+ S ++E ++++ S + R   + F       L+F    
Sbjct: 132 DATPDLHVYRYELEKLNRQRAHIRSAEVEQVMAEFSDLVRTPYRTFSMLTDSDLQFPTIE 191

Query: 217 --NDQKIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
             N Q + L+ A Y    +S DR VR+ A K     F    +  +       +   I+ R
Sbjct: 192 DENGQPVQLSHARYGRLLESQDRRVRRDAFKGYYSAFLPFRNTIATTLGAAIRSHVIEAR 251

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWD-RL 331
            R Y    ++    N +   V   L+ +V+   P+  HRY  ++++ L LD ++F+D  +
Sbjct: 252 LRNYSSALEAALAPNEIPVEVYHNLIATVEANLPRF-HRYLSVRRRLLGLDELHFYDLYV 310

Query: 332 APLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHG 391
            P+P   +  IP+  A DL+  ++     + S   E+ F+  WID  +  GK SGA++ G
Sbjct: 311 QPVPDV-ELTIPYHEACDLMRSAFRPLGEEYSAALEQMFSRRWIDVYENVGKRSGAYSGG 369

Query: 392 TIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE 451
           +     PYILLNY  + +DV TLAHELGH +H   +   Q  +  N ++ +AE AS   E
Sbjct: 370 SY-GTPPYILLNYQDRLRDVFTLAHELGHSLHSYFTRTHQPFVYGNYTIFVAEVASTLNE 428

Query: 452 TLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRI 511
            L    +L   + +  R+ LLA +IE++  +I RQ  F  FEL +H        +    +
Sbjct: 429 ALLTHYMLTNGADEALRRRLLAQQIEEIRGTIFRQTMFAAFELWMHERAERGQPLTADAL 488

Query: 512 NEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSN 571
           ++ + +      GP   + D E    WM +PHF   +FYVY YA G     +L      N
Sbjct: 489 SQYYRDLVIRYHGPELQVDD-ELAYEWMRIPHFY-YNFYVYQYATGISAALAL-SRQIIN 545

Query: 572 TVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
                 E+YL  LR+G+S+   +LL    ++++ P   +  + T   ++D +E++
Sbjct: 546 EGQPAIERYLRFLRSGSSRSSIDLLRDAGVDMTSPEPIQAAMDTFAGLVDQLEQL 600


>gi|328911179|gb|AEB62775.1| Oligopeptidase F [Bacillus amyloliquefaciens LL3]
          Length = 670

 Score =  189 bits (481), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 165/641 (25%), Positives = 297/641 (46%), Gaps = 47/641 (7%)

Query: 11  SNAFFR-KALRSSDMTTMDSQENLGNLP---------RWNLEDLYPSHDS--QEISNDME 58
           +N FF    ++ +   TM  +     LP          W LED++PS ++  +E     E
Sbjct: 45  NNHFFNWLEIKKTRGITMTEENKAAQLPDRSEVKAEHTWRLEDIFPSDEAWNKEFQAVKE 104

Query: 59  CIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSS 118
            I + S +FK    G LAH+ +     +L AA+   + +   +G++ +YA +  + +   
Sbjct: 105 LIPNLS-SFK----GTLAHSAD-----NLYAALTAQDEVTSRLGKLYAYAHMRSDQD--- 151

Query: 119 PTIRKFYTDINAKLADF----EKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNI 174
            T   FY  +N K A           +   EI  + E  L Q   +      YS  I+ I
Sbjct: 152 -TGNSFYQGLNDKAASLYSQAASATAYIEPEILAIQEDKLHQFILEKEELKVYSHAIEEI 210

Query: 175 RKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF-KINDQKIPLTKAYKSFF-- 231
            K + H+LS   E LL++ S+        F   N   + F  I D+    T+     F  
Sbjct: 211 TKQRPHVLSEKEEALLAEASEALSSPSNTFSVLNNADITFPSIKDENGKETQITHGNFIN 270

Query: 232 ---DSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNN 288
               SDREVRK+A KA+  T+ +  +  +   +   K +    R +KY+   ++   +NN
Sbjct: 271 FLESSDREVRKNAFKAVYKTYGQYKNTMATTLSGTVKKDNFYARVKKYKSAREAALSNNN 330

Query: 289 VEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVAR 348
           +   V + L++++  + P   HRY +L+KK L LD ++ +D   PL   S   + +E A+
Sbjct: 331 IPEEVYDNLIKTINKHLP-LLHRYIDLRKKVLGLDEVHNYDLYTPLVKDSGMKVTYEEAK 389

Query: 349 DLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKP 408
           D +L+  A    + + I ++   + W+D  +  GK SGA++ GT    +PYIL+N+    
Sbjct: 390 DYMLKGLAPLGDEYASILKEGLENRWVDVYENKGKRSGAYSSGTY-GTNPYILMNWHDTV 448

Query: 409 QDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEER 468
            ++ TL HE GH +H   + + Q     N S+ +AE AS   E L  + +L +   +++R
Sbjct: 449 NNLFTLVHEFGHSVHSYYTRKYQPYPYGNYSIFVAEVASTTNEALLGEYMLNSLKDEKQR 508

Query: 469 KILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFD 528
             LL + +E    ++ RQ  F +FE  +HT+ +    +    +N+++ +  K+  G    
Sbjct: 509 LYLLNHMLEGFRGTVFRQTMFAEFEHLIHTKAQEGEPLTPELLNKLYYDLNKKYFGDNMV 568

Query: 529 LSDLEYGSFWMMVPHF---IESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILR 585
           + D E    W  +PHF        Y   Y+    L + +    K        E+Y N L+
Sbjct: 569 I-DEEISLEWSRIPHFYYNYYVYQYATGYSAAQALSSQILKEGKPAV-----ERYTNFLK 622

Query: 586 AGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           AG+S++  ++L    ++++ P   E   +  E+ ++++E++
Sbjct: 623 AGSSEYPIDILKKAGVDMTSPEPIEAACKMFEEKLNEMEEL 663


>gi|256848406|ref|ZP_05553848.1| oligoendopeptidase F [Lactobacillus coleohominis 101-4-CHN]
 gi|256714673|gb|EEU29652.1| oligoendopeptidase F [Lactobacillus coleohominis 101-4-CHN]
          Length = 605

 Score =  189 bits (481), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 165/612 (26%), Positives = 276/612 (45%), Gaps = 19/612 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           S+   + S+E +    +W+L  LYP+ D+ +        +   L    +  G LA    Q
Sbjct: 2   SEKQQLPSREEVPTALKWDLTLLYPNDDAMQEQLQATVKKANEL---HQLAGKLAADDGQ 58

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
               +L AA    + I E + R   YA L  + + +     + Y        + E VL F
Sbjct: 59  TLLQALQAA----KVINEELEREYVYAFLRRDSDTTDAAATELYGKAATAATEIETVLSF 114

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI +LD+ LL+    +     ++   ++ +R  K H+L+   E LLS  S+    A 
Sbjct: 115 MDPEIVSLDQHLLDHWLVEVAGLDEFKYALEQVRLQKGHVLTVSEEQLLSQLSRSLDSAE 174

Query: 202 KRFFCENIESLRFKI--NDQ--KIPLTKAYKSFFDS--DREVRKSAAKALSHTFNKSSHI 255
             +   N   L F    N+Q  ++ LT   +S F    DR VRK+A  A    +++  + 
Sbjct: 175 TIYNTLNDADLHFGTIKNEQGNEVELTHGNRSQFTESLDRNVRKAAVLAYQKPYHELRNT 234

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   N+           R Y+    +    N ++  V + L+++V N +   +HR+Y +
Sbjct: 235 FAATLNSFIDSRNSIAELRHYKSARQAALSVNQIDERVYDTLVKTV-NQHLDLAHRWYGI 293

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           KK+ L LD  Y +D   PL G  +    FE  + LVL +     P      ++ F H WI
Sbjct: 294 KKRALHLDPFYQYDIGVPLAGKDRLRTTFEQGKQLVLDAMKVMGPDYRKGLQEEFDHRWI 353

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           DA +  GK SG +  G +   +P+ILLN+  K      LAHE GH +H   S   Q    
Sbjct: 354 DAAENRGKRSGGYQVG-VYQANPFILLNWTDKLYSTFVLAHESGHAMHSWFSQHAQPSEY 412

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKI-LLANKIEDMLNSIVRQISFYDFEL 494
            ++ + LAE AS F E +  + LLQ      + +I +L   I   + SI RQ  F +FE 
Sbjct: 413 ADAPIFLAEVASTFNENILTEYLLQKYQDDRQLQIFILEQSINGFIGSIYRQTQFAEFEN 472

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
             + E++S   +    ++ +  +  ++  GP   L   +  S W  VPHF   ++YVY Y
Sbjct: 473 TAYREQQSGRTLTADYLDRMNRKLVEKYYGPTVKLVGTDTQS-WAYVPHFY-MNYYVYQY 530

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A    +  +L +   +   D   ++YL  L+AG S     +L    +N+++  + E  L 
Sbjct: 531 ATSWAIATALSERVWTKQ-DGALDRYLAFLKAGGSADPVTILRRAGVNVTNGQYLEDALH 589

Query: 615 TVEKMIDDVEKM 626
            ++K +D +E++
Sbjct: 590 VLKKRLDQIEQL 601


>gi|300914146|ref|ZP_07131462.1| oligoendopeptidase F [Thermoanaerobacter sp. X561]
 gi|300889081|gb|EFK84227.1| oligoendopeptidase F [Thermoanaerobacter sp. X561]
          Length = 596

 Score =  189 bits (481), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 168/613 (27%), Positives = 289/613 (47%), Gaps = 28/613 (4%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDS-QEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           M  +  +  + +  +W LED+Y + +  +E  N  + I  E + FK    G +  + N  
Sbjct: 1   MEVLKDRSEIEDKYKWRLEDIYENENLWEEDYNKTKEILKEIVKFK----GKINTSRNLL 56

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKL-ADFEKVLIF 141
               L       ++I     +I +YA +  + + ++P  +   TD   +L  +      F
Sbjct: 57  EVLKLN------DQIGMTASKIFAYARMRRDEDNTNPKYQAL-TDKAMRLNVEVMSATSF 109

Query: 142 FALEINTLD-EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
            A EI ++D + L+E     + L + Y  +++++ + K H+LS + E +L++   +    
Sbjct: 110 IAPEILSIDTQKLMEMIEGLEELKI-YKQYLEDLIRFKPHVLSPEEEKILAEAKTLAESV 168

Query: 201 LKRFFCENIESLRFKI----NDQKIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSH 254
              +   N   +RF I      +++ +T   +  F  S DR VRK+A  A+  T+ K  +
Sbjct: 169 SNIYTMLNNADMRFPIIKDEEGKEVEVTHGNFVRFMQSKDRNVRKAAFNAMYDTYKKFIN 228

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
            F+       K +    + RKY    ++    +NV   V   L+++V +      HRY  
Sbjct: 229 TFASTMAGNVKKDIFYVKTRKYNSSLEASLFEDNVSLEVYNNLIETVHSRLD-VLHRYVR 287

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           LKKK L LD ++ +D   PL         +E A +LVL+       +   + ++ F   W
Sbjct: 288 LKKKLLGLDELHMYDLYVPLIQEYDKKFTYEEAIELVLEGLKPLGDEYINLLKQGFNSRW 347

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D  +  GK SGA++ GT  + HPY+LLNY GK  DV T+AHE+GH +H   S+ TQ  +
Sbjct: 348 VDVYENRGKTSGAYSWGTYGT-HPYVLLNYQGKLNDVFTIAHEMGHSLHTYYSNATQPYV 406

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
                + +AE AS   E L  D LL+ +  ++ER  LL +  E+   ++ RQ+ F +FE 
Sbjct: 407 YAGYKIFVAEVASTCNEALLMDYLLKNSKDEKERLYLLNHFFEEFRGTVYRQVMFAEFEK 466

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSF-WMMVPHFIESSFYVYA 553
            +H        +    +N+ + E  K   G   D+   E  S+ W  +PHF   +FYVY 
Sbjct: 467 LIHEMAERGEPLTAEVLNKKYYELNKLYYGD--DIVVDEGISYEWARIPHFY-RNFYVYK 523

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YA G     ++  +   N  +   E+Y   L++G+S +   LL    ++L+ P      L
Sbjct: 524 YATGFSAAIAISQMI-LNEGEKAVERYKEFLKSGSSDYPLNLLKKAGVDLTTPKPVNDAL 582

Query: 614 QTVEKMIDDVEKM 626
              EK++D+ EKM
Sbjct: 583 DVFEKLLDEFEKM 595


>gi|206896403|ref|YP_002246761.1| oligoendopeptidase F [Coprothermobacter proteolyticus DSM 5265]
 gi|206739020|gb|ACI18098.1| oligoendopeptidase F [Coprothermobacter proteolyticus DSM 5265]
          Length = 590

 Score =  189 bits (480), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 158/602 (26%), Positives = 277/602 (46%), Gaps = 32/602 (5%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L +LYPS DS E   D++ +E+    F    +G L   T         A I     I 
Sbjct: 4   WSLSELYPSFDSPEFQGDLKELENRVKEFNDWSQGALKDYT--APVSKAEAGIKHTMAIA 61

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLAD-------FEKVLIFFALEINTLDE 151
           EL  ++ ++A L+ +    +    K    ++  +AD       F+K L      +  LDE
Sbjct: 62  ELYEKLGAFAQLTISVEAYNEQAAKAADRVHTVVADMALGDTRFKKWLA----GLGNLDE 117

Query: 152 ALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRF----FCE 207
            +      +  L  ++  +IK+  +  + LLS   E L++     G  A  R       +
Sbjct: 118 VI-----GKSELLKEHEYFIKDSVRYARRLLSEQEEELINKLQSTGSLAWSRLQGNLTAK 172

Query: 208 NIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDE 267
            +  ++    ++K+PLT      +  DR VR +A +A    + K     +   N +  + 
Sbjct: 173 LLVDMKKDGKEEKLPLTVVRNMAYHEDRNVRMAAYEAELKAYEKIDEAVASSLNGIKGEF 232

Query: 268 EIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLK-LDTMY 326
               + R Y+   ++   +  ++  + + LM  +    P    RY ++K + L   D + 
Sbjct: 233 LTISKKRGYKDPLEATLETAKMDRAIFDTLMDVMNESLP-VFRRYLKIKAEILGHGDRLP 291

Query: 327 FWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSG 386
           ++D  AP+ G S        ARD ++ ++ KF+P++S +A   F + WIDA   +GK  G
Sbjct: 292 WYDLFAPV-GRSSRKFSINDARDYIVTNFGKFAPELSDLARTAFDNKWIDATPREGKRGG 350

Query: 387 AFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETA 446
           AF +G  P     I+ N+ G    V TL+HELGH  H     + + IL  +S + LAETA
Sbjct: 351 AFCYGLHPIKQSRIMANFDGTFDGVTTLSHELGHAFHNWCQRD-ESILNADSPMPLAETA 409

Query: 447 SIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDI 506
           S F ET+  +  L  A  +E+   +L   +      +V  +S + FE ++   RR+ G +
Sbjct: 410 STFNETMITEIALSEADPQEQL-FILEKSLSGDTQVVVDILSRFLFESEVF-RRRTQGPL 467

Query: 507 PTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESS--FYVYAYAFGNCLVNSL 564
               + EI  + QK++ G A +  D  +   W+  PH+  ++  FY + YAFG     +L
Sbjct: 468 SVSELKEIMADAQKQAYGEALNW-DYLHPYMWVNKPHYYYANLHFYNFPYAFGQLFSKAL 526

Query: 565 YDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVE 624
           Y +YK    D F   Y N+LR        EL   + ++L+  +FWE+ ++ +E+ ++  E
Sbjct: 527 YAMYKEQGKD-FIPAYENLLRNTGKHDIGELGQLIGVDLTQKSFWEKSIELIEQQVEQFE 585

Query: 625 KM 626
           ++
Sbjct: 586 RL 587


>gi|326390050|ref|ZP_08211612.1| oligoendopeptidase, pepF/M3 family [Thermoanaerobacter ethanolicus
           JW 200]
 gi|325993915|gb|EGD52345.1| oligoendopeptidase, pepF/M3 family [Thermoanaerobacter ethanolicus
           JW 200]
          Length = 587

 Score =  189 bits (480), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 160/595 (26%), Positives = 285/595 (47%), Gaps = 26/595 (4%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           RW+LE LY S DS+E   D E I       K   E NL    N K    L   I     +
Sbjct: 2   RWSLEKLYTSFDSEEFKKDNEKILSSIEHIKKWCEENLQTDENAK--EKLEYYIKFKNEL 59

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYT---DINAKLADFEKVLIFFALEINTLDEALL 154
            +L+ ++  +++LS + ++ +    K      ++   LA+ E     + L +  +DE + 
Sbjct: 60  GDLLVKVRGFSLLSLSVDVKNEKALKAVETLENVTTMLAEPETKFKRWLLNLKNVDEIIE 119

Query: 155 EQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF 214
             SY +      +  ++K   K  +HLLS   E +L+     G EA  +       +L  
Sbjct: 120 SSSYLKS-----HEFYVKETIKEAEHLLSEKEEIILAKMKNTGSEAWAKLHEFLTSTLLV 174

Query: 215 KIN----DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
            IN    ++K+PL+      +D D  +RK+A  A  +++ K     +   N +  +    
Sbjct: 175 DININGEEKKLPLSVVRNMAYDKDPYIRKTAYFAELNSYKKIEEASAACLNGIKGEVLTA 234

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLK-LDTMYFWD 329
              RKY    +     + ++   ++A++++++ Y P    +Y + K K L   + + F+D
Sbjct: 235 TELRKYSSPLEMTLQRSRMDFETLDAMLKAIEEYLP-VFRKYLKEKAKLLGHKEGLPFYD 293

Query: 330 RLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFA 389
             AP+ G     + FE AR+ +++++  FS  ++  A+  F +NWIDA   +GK  GAF 
Sbjct: 294 LFAPV-GKLDKKLTFEEAREFIVENFKSFSKDLAEFADNAFRNNWIDAEPREGKRGGAFC 352

Query: 390 HGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIH-FVLSSETQGILTNNSSLTLAETASI 448
               P     IL NY G   +V+TLAHELGHG H  +L+ ET  ++ +   + +AETASI
Sbjct: 353 FNLHPIKESRILANYDGSFSNVLTLAHELGHGYHGHLLADET--LINSRYPMPIAETASI 410

Query: 449 FGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPT 508
           F E +  +S L+ A +KEE+  ++ N ++    +IV   S + FE +L  +RR    +  
Sbjct: 411 FNEHIIVNSALKTA-TKEEKLSIIENSLQRSTQTIVDIYSRFLFEDEL-LKRRKDHSLSV 468

Query: 509 HRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIES--SFYVYAYAFGNCLVNSLYD 566
             + ++ ++ QK++ G   D  +  +   W+  PH+ ++  ++Y + YAFG   V  L  
Sbjct: 469 EELKQMMIDAQKKTYGDGLD-QNYMHPYMWINKPHYYDADLNYYNFPYAFGELFVKGLIC 527

Query: 567 IYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMID 621
            Y     + F E+Y  +L     K+  EL   +  ++   +FW + L  +++ I+
Sbjct: 528 KYNQEG-EKFVEEYKELLSQTGKKNLYELGKIVGFDIHSIDFWRKSLDVIKEEIE 581


>gi|308173118|ref|YP_003919823.1| oligopeptidase F [Bacillus amyloliquefaciens DSM 7]
 gi|307605982|emb|CBI42353.1| oligopeptidase F [Bacillus amyloliquefaciens DSM 7]
 gi|328554040|gb|AEB24532.1| oligoendopeptidase F [Bacillus amyloliquefaciens TA208]
          Length = 609

 Score =  189 bits (480), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 158/603 (26%), Positives = 285/603 (47%), Gaps = 37/603 (6%)

Query: 39  WNLEDLYPSHDS--QEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYER 96
           W LED++PS ++  +E     E I + S +FK    G LAH+ +     +L AA+   + 
Sbjct: 22  WRLEDIFPSDEAWNKEFQAVKELIPNLS-SFK----GTLAHSAD-----NLYAALTAQDE 71

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADF----EKVLIFFALEINTLDEA 152
           +   +G++ +YA +  + +    T   FY  +N K A           +   EI  + E 
Sbjct: 72  VTSRLGKLYAYAHMRSDQD----TGNSFYQGLNDKAASLYSQAASATAYIEPEILAIQED 127

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
            L Q   +      YS  I+ I K + H+LS   E LL++ S+        F   N   +
Sbjct: 128 KLHQFILEKEELKVYSHAIEEITKQRPHVLSEKEEALLAEASEALSSPSNTFSVLNNADI 187

Query: 213 RF-KINDQKIPLTKAYKSFF-----DSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKD 266
            F  I D+    T+     F      SDREVRK+A KA+  T+ +  +  +   +   K 
Sbjct: 188 TFPSIKDENGKETQITHGNFINFLESSDREVRKNAFKAVYKTYGQYKNTMATTLSGTVKK 247

Query: 267 EEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMY 326
           +    R +KY+   ++   +NN+   V + L++++  + P   HRY +L+KK L LD ++
Sbjct: 248 DNFYARVKKYKSAREAALSNNNIPEEVYDNLIKTINKHLP-LLHRYIDLRKKVLGLDEVH 306

Query: 327 FWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSG 386
            +D   PL   S   + +E A+D +L+  A    + + I ++   + W+D  +  GK SG
Sbjct: 307 NYDLYTPLVKDSGMKVTYEEAKDYMLKGLAPLGDEYASILKEGLENRWVDVYENKGKRSG 366

Query: 387 AFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETA 446
           A++ GT    +PYIL+N+     ++ TL HE GH +H   + + Q     N S+ +AE A
Sbjct: 367 AYSSGTY-GTNPYILMNWHDTVNNLFTLVHEFGHSVHSYYTRKYQPYPYGNYSIFVAEVA 425

Query: 447 SIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDI 506
           S   E L  + +L +   +++R  LL + +E    ++ RQ  F +FE  +HT+ +    +
Sbjct: 426 STTNEALLGEYMLNSLKDEKQRLYLLNHMLEGFRGTVFRQTMFAEFEHLIHTKAQEGEPL 485

Query: 507 PTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHF---IESSFYVYAYAFGNCLVNS 563
               +N+++ +  K+  G    + D E    W  +PHF        Y   Y+    L + 
Sbjct: 486 TPELLNKLYYDLNKKYFGDNMVI-DEEISLEWSRIPHFYYNYYVYQYATGYSAAQALSSQ 544

Query: 564 LYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDV 623
           +    K        E+Y N L+AG+S++  ++L    ++++ P   E   +  E+ ++++
Sbjct: 545 ILKEGKPAV-----ERYTNFLKAGSSEYPIDILKKAGVDMTSPEPIEAACKMFEEKLNEM 599

Query: 624 EKM 626
           E++
Sbjct: 600 EEL 602


>gi|291518458|emb|CBK73679.1| oligopeptidase F. Metallo peptidase. MEROPS family M03B
           [Butyrivibrio fibrisolvens 16/4]
          Length = 598

 Score =  189 bits (479), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 137/501 (27%), Positives = 243/501 (48%), Gaps = 11/501 (2%)

Query: 132 LADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLS 191
           +A FE  + F + EI   D A+L+   A  P    Y   IK I+++K H LS +ME +++
Sbjct: 102 IAKFEAAMSFVSPEILACDTAVLDGFIASKPELELYRIEIKEIQRLKDHTLSAEMEKVVA 161

Query: 192 DTSQVGREALKRFFC-ENIESLRFKINDQ---KIPLTKA--YKSFFDSDREVRKSAAKAL 245
            TS++G    + +   +N++     I D+   ++ LT          +DR VR+ A KA 
Sbjct: 162 MTSEMGNTPSEVYSAFKNVDMTFPAIKDENGEEVTLTDGRFVPMLMSADRRVREDAFKAY 221

Query: 246 SHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYY 305
              + K  +  + I N   K      R R Y    ++   +NNV P V + L+++V    
Sbjct: 222 YGVYKKYLNTMAAIYNGEVKQHIFNSRVRNYSSNLEAAVDANNVSPQVYDNLVKTVNANL 281

Query: 306 PKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSII 365
            K  H Y  L+KK L +D ++ +D    +   +   + +E A+  + ++ A        +
Sbjct: 282 DKL-HAYVSLRKKCLGVDELHMYDIYTSMIPDAAKTVKYEEAQKTICEALAVLGDDYVAL 340

Query: 366 AEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFV 425
            ++ F + WID  +  GK  GA++  T   VHPY+LLNY     D+ T AHE+GH +H  
Sbjct: 341 LKEGFANRWIDVYENKGKRGGAYS-ATAYGVHPYMLLNYTDTFDDMFTTAHEMGHSMHSY 399

Query: 426 LSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVR 485
            S++TQ  + +N  + +AE AS   E L  + LL+  + K+E+  LL + ++    ++ R
Sbjct: 400 FSNKTQPYIYSNYKIFVAEVASTCNEILLLEYLLKNCTDKKEKAYLLNHYLDSFKGTVFR 459

Query: 486 QISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFI 545
           Q  F +FE   +    +  ++    + +++ E  ++  GP   +SD E    W  +PHF 
Sbjct: 460 QTQFAEFEKTTNEMVEAGENLNAENLCKLYKEINEKYYGPDM-ISDDEIAYEWARIPHFY 518

Query: 546 ESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSD 605
             +FYVY YA   C   ++ D+          E+Y   L +G +    ELL    ++L+ 
Sbjct: 519 -YNFYVYQYATSFCAAVAIADMILKEGAPAV-ERYKKFLSSGCTDAPVELLKIAGVDLTT 576

Query: 606 PNFWERGLQTVEKMIDDVEKM 626
           P   E  L  + +++++++ +
Sbjct: 577 PAPIEAALAKMGEIVEELKTL 597


>gi|307264950|ref|ZP_07546511.1| oligoendopeptidase, pepF/M3 family [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306919935|gb|EFN50148.1| oligoendopeptidase, pepF/M3 family [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 587

 Score =  189 bits (479), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 159/595 (26%), Positives = 286/595 (48%), Gaps = 26/595 (4%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           RW+LE LY S DS+E   D E I       K   E NL    N K    L   I     +
Sbjct: 2   RWSLEKLYTSFDSEEFKKDNEKILSSIEHIKKWCEENLQTGENAK--EKLEYYIKFKNEL 59

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYT---DINAKLADFEKVLIFFALEINTLDEALL 154
            +L+ ++  +++LS + ++ +    K      ++   LA+ E     + L +  +DE + 
Sbjct: 60  GDLLVKVRGFSLLSLSVDVKNEKALKAVETLENVTTMLAEPETKFKRWLLNLKNVDEIIE 119

Query: 155 EQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF 214
             SY +      +  ++K   K  +HLLS   E +L+     G EA  +       +L  
Sbjct: 120 SSSYLKS-----HEFYVKETIKEAEHLLSEKEEIILAKMKNTGSEAWAKLHEFLTSTLLV 174

Query: 215 KIN----DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
            IN    ++K+PL+      +D D  +RK+A  A  +++ K     +   N +  +    
Sbjct: 175 DININGEEKKLPLSVVRNMAYDKDPYIRKTAYFAELNSYKKIEEASAACLNGIKGEVLTV 234

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLK-LDTMYFWD 329
              RKY    +     + ++   ++A++++++ Y P    +Y + K K L   + + F+D
Sbjct: 235 TELRKYSSPLEMTLQRSRMDFETLDAMLKAIEEYLP-VFRKYLKEKAKLLGHKEGLPFYD 293

Query: 330 RLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFA 389
             AP+ G     + FE AR+ +++++  FS  ++  A+  F +NWIDA   +GK  GAF 
Sbjct: 294 LFAPV-GKLDKKLTFEEAREFIVENFKSFSEDLAEFADNAFRNNWIDAEPREGKRGGAFC 352

Query: 390 HGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIH-FVLSSETQGILTNNSSLTLAETASI 448
               P     IL N+ G   +V+TLAHELGHG H  +L+ ET  ++ +   + +AETASI
Sbjct: 353 FNLHPIKESRILANFDGSFSNVLTLAHELGHGYHGHLLADET--LINSRYPMPIAETASI 410

Query: 449 FGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPT 508
           F E +  +S L+ A +KEE+  ++ N ++    +IV   S + FE +L  +RR    +  
Sbjct: 411 FNEHIIVNSALKTA-TKEEKLSIIENSLQRSTQTIVDIYSRFLFEDEL-LKRRKDHSLSV 468

Query: 509 HRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIES--SFYVYAYAFGNCLVNSLYD 566
             + ++ ++ QK++ G   D + + +   W+  PH+ ++  ++Y + YAFG   V  L  
Sbjct: 469 EELKQMMIDAQKKTYGDGLDQNYI-HPYMWINKPHYYDADLNYYNFPYAFGELFVKGLIC 527

Query: 567 IYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMID 621
            Y     + F E+Y  +L     K+  EL   +  ++   +FW + L  +++ I+
Sbjct: 528 KYNQEG-EKFVEEYKELLSQTGKKNLYELGKIVGFDIHSVDFWRKSLDVIKEEIE 581


>gi|239826296|ref|YP_002948920.1| oligoendopeptidase F [Geobacillus sp. WCH70]
 gi|239806589|gb|ACS23654.1| oligoendopeptidase F [Geobacillus sp. WCH70]
          Length = 604

 Score =  189 bits (479), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 155/599 (25%), Positives = 291/599 (48%), Gaps = 29/599 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W LED++P+ ++ E   + + ++ + +   + ++G L  + +     +L  A+   + I 
Sbjct: 22  WRLEDIFPTDEAWE--QEFQAVK-KMIPKLSDYQGRLGESAD-----TLYEALQYQDEIS 73

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKL----ADFEKVLIFFALEINTLDEALL 154
             +G++ +YA + Y+ +    T   FY  +N +     ++    + F   EI  +DEA L
Sbjct: 74  MRLGKLYTYAHMRYDQD----TTNAFYQGLNDRATSLYSEASSAMAFIVPEILAIDEAKL 129

Query: 155 EQSYAQDPLTLK-YSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLR 213
            +S+ ++   LK Y   +  I + + H+LS + E LL+  ++V + +   F   N   L 
Sbjct: 130 -RSFLEEKKELKLYEHALDEINRQRPHVLSAEEEALLAQAAEVMQASSTTFGMLNNADLT 188

Query: 214 FKI----NDQKIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAKDE 267
           F      N +++ +T   +  F +S DR VR+ A KA+  T+ K  + F+       K +
Sbjct: 189 FPTIIDENGEEVEVTHGRFIRFLESTDRRVRRDAFKAVYDTYEKYKNTFASTLAGAVKKD 248

Query: 268 EIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYF 327
               R R+Y+   ++   SNN+   V + L+++V  + P   HRY  L+KK L LD ++ 
Sbjct: 249 NFFARVRRYKSAREAALSSNNIPESVYDNLIETVHEHLP-LLHRYVRLRKKALGLDELHM 307

Query: 328 WDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGA 387
           +D   PL    +  + +E A++ +L+  A    +   I ++   + W+D  +  GK SGA
Sbjct: 308 YDLYTPLVQDVKMEVTYEEAKEYMLKGLAPLGEEYIGIVKEGLENRWVDVRENKGKRSGA 367

Query: 388 FAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETAS 447
           ++ G+    +PYILLN+     ++ TL HE GH +H   + +TQ     + S+ +AE AS
Sbjct: 368 YSSGSY-GTNPYILLNWQDNVHNLFTLVHEFGHSVHSYYTRKTQPYPYGDYSIFVAEVAS 426

Query: 448 IFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIP 507
              E L  D LL+    +++R  LL + +E    ++ RQ  F +FE  +H + +    + 
Sbjct: 427 TCNEALLSDYLLKTIDDEKKRLYLLNHYLEGFRGTVFRQTMFAEFEHMIHMKAQEGEALT 486

Query: 508 THRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDI 567
              +  ++ E  K+  G    + D E G  W  +PHF  + + VY YA G     +L   
Sbjct: 487 ADSLTSMYYELNKKYFGDDI-VVDKEIGLEWARIPHFYYNYY-VYQYATGFSAATALSRQ 544

Query: 568 YKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
                    K +Y+  L+AG+S +  E+L    ++++      +  Q   + +D++E+M
Sbjct: 545 ILEEGEPAVK-RYIEFLKAGSSDYPIEVLKKAGVDMTSAEPIRQACQVFAEKLDEMEQM 602


>gi|51891875|ref|YP_074566.1| oligoendopeptidase [Symbiobacterium thermophilum IAM 14863]
 gi|51855564|dbj|BAD39722.1| oligoendopeptidase [Symbiobacterium thermophilum IAM 14863]
          Length = 599

 Score =  189 bits (479), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 156/596 (26%), Positives = 279/596 (46%), Gaps = 19/596 (3%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           +W+L+ +Y S ++ E   D   +E E L   T ++G L      ++  +L  A+   + +
Sbjct: 14  KWDLDSVYGSVEAWE--KDYARVE-EMLPQLTAFQGRLG-----ESAATLLQALKMRDEV 65

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQS 157
            +L+ ++  +A +  + + ++ T +       +  A       F   EI  +    +   
Sbjct: 66  SKLLEQVVVWARMKEDEDTANSTYQALSARGRSLYAKATAAAAFLTPEILAIPAETIRAW 125

Query: 158 YAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF-KI 216
             Q+P    Y   ++N  + K H+ S ++E LL+   +VG      F   N   L+F  I
Sbjct: 126 LDQEPGLAAYRHELENTLRQKAHVRSPEVEELLAQMGEVGAAPSDIFGKLNNADLKFGTI 185

Query: 217 NDQK---IPLTKA-YKSFFDSD-REVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
            D++   + LT   Y  F +S  R+VRK A +AL  T+ K  +  +    +  K +    
Sbjct: 186 KDEQGNEVELTLGRYLRFLESPVRDVRKQAFEALFTTYRKFRNTIAATYASSVKADVFYA 245

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRL 331
           R R+Y     +     NV   V + L+ +V    P + HRY +L+++ L LD ++ +D  
Sbjct: 246 RARRYPSARAAALFGTNVPESVYDNLLATVNKNLP-SLHRYVQLRRRMLGLDELHMYDLY 304

Query: 332 APLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFT-HNWIDAPQYDGKGSGAFAH 390
            P+       IP+E A + VL++ A    +   IA +  T   W+D  + +GK SGA++ 
Sbjct: 305 TPMVADVDRKIPYEEAVETVLKALAPLGEEYCEIARRGMTVDRWVDIYENEGKRSGAYSF 364

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
           G+  +  PYIL+NY      + TLAHELGH +H   S   Q     + ++ +AE AS F 
Sbjct: 365 GSY-TTKPYILMNYQDNLDSMFTLAHELGHSMHSYFSRRHQPYHYADYTIFVAEVASTFN 423

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E L  D LL++      +  L+ +++E    ++ RQ  F +FE   H    +   +    
Sbjct: 424 EALLTDYLLKSTDDPRLKMYLINHQLESFRTTLYRQTMFAEFEHIAHQRVENGEALTADV 483

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
           ++EI+ +  K   G    + D      W  +PHF  S+FYVY YA G     +L     +
Sbjct: 484 LDEIYYDLNKRYYGTEGMVVDDLIAVEWARIPHFY-SAFYVYQYATGISAATALSQQVLT 542

Query: 571 NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
                  E+YLN L++G+S + + LL    ++++ P   ++ L    +++D +E++
Sbjct: 543 EGRPAV-ERYLNFLKSGSSDYSTNLLKQAGVDMTSPEPIQQALDVFARLLDQMEQL 597


>gi|167040062|ref|YP_001663047.1| oligoendopeptidase F [Thermoanaerobacter sp. X514]
 gi|307724618|ref|YP_003904369.1| oligoendopeptidase F [Thermoanaerobacter sp. X513]
 gi|166854302|gb|ABY92711.1| oligoendopeptidase F [Thermoanaerobacter sp. X514]
 gi|307581679|gb|ADN55078.1| oligoendopeptidase F [Thermoanaerobacter sp. X513]
          Length = 596

 Score =  188 bits (477), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 167/613 (27%), Positives = 289/613 (47%), Gaps = 28/613 (4%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDS-QEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           M  +  +  + +  +W LED+Y + +  +E  N  + +  E + FK    G +  + N  
Sbjct: 1   MEVLKDRSEIEDKYKWRLEDIYENENLWEEDYNKTKELLKEIVKFK----GKINTSRNLL 56

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKL-ADFEKVLIF 141
               L       ++I     +I +YA +  + + ++P  +   TD   +L  +      F
Sbjct: 57  EVLKLN------DQIGMTASKIFAYARMRRDEDNTNPKYQAL-TDKAMRLNVEVMSATSF 109

Query: 142 FALEINTLD-EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
            A EI ++D + L+E     + L + Y  +++++ + K H+LS + E +L++   +    
Sbjct: 110 IAPEILSIDTQKLMEMIEGLEELKI-YKQYLEDLIRFKPHVLSPEEEKILAEAKTLAESV 168

Query: 201 LKRFFCENIESLRFKI----NDQKIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSH 254
              +   N   +RF I      +++ +T   +  F  S DR VRK+A  A+  T+ K  +
Sbjct: 169 SNIYTMLNNADMRFPIIKDEEGKEVEVTHGNFVRFMQSKDRNVRKAAFNAMYDTYKKFIN 228

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
            F+       K +    + RKY    ++    +NV   V   L+++V +      HRY  
Sbjct: 229 TFASTMAGNVKKDIFYVKTRKYNSSLEASLFEDNVSLEVYNNLIETVHSRLD-VLHRYVR 287

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           LKKK L LD ++ +D   PL         +E A +LVL+       +   + ++ F   W
Sbjct: 288 LKKKLLGLDELHMYDLYVPLIQEYDKKFTYEEAIELVLEGLKPLGDEYINLLKQGFNSRW 347

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D  +  GK SGA++ GT  + HPY+LLNY GK  DV T+AHE+GH +H   S+ TQ  +
Sbjct: 348 VDVYENRGKTSGAYSWGTYGT-HPYVLLNYQGKLNDVFTIAHEMGHSLHTYYSNATQPYV 406

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
                + +AE AS   E L  D LL+ +  ++ER  LL +  E+   ++ RQ+ F +FE 
Sbjct: 407 YAGYKIFVAEVASTCNEALLMDYLLKNSKDEKERLYLLNHFFEEFRGTVYRQVMFAEFEK 466

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSF-WMMVPHFIESSFYVYA 553
            +H        +    +N+ + E  K   G   D+   E  S+ W  +PHF   +FYVY 
Sbjct: 467 LIHEMAERGEPLTAEVLNKKYYELNKLYYGD--DIVVDEGISYEWARIPHFY-RNFYVYK 523

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YA G     ++  +   N  +   E+Y   L++G+S +   LL    ++L+ P      L
Sbjct: 524 YATGFSAAIAISQMI-LNEGEKAVERYKEFLKSGSSDYPLNLLKKAGVDLTTPKPVNDAL 582

Query: 614 QTVEKMIDDVEKM 626
              EK++D+ EKM
Sbjct: 583 DVFEKLLDEFEKM 595


>gi|15615419|ref|NP_243722.1| peptidase [Bacillus halodurans C-125]
 gi|10175477|dbj|BAB06575.1| peptidase [Bacillus halodurans C-125]
          Length = 598

 Score =  187 bits (476), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 158/600 (26%), Positives = 291/600 (48%), Gaps = 31/600 (5%)

Query: 39  WNLEDLYPSHDSQEIS-NDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           W+LE ++ + +  E   N+++ +    + FK    G L+     ++   L AA+ + + I
Sbjct: 17  WDLEAIFSTDEEWEKEFNEVKGLIPSLVQFK----GKLS-----QSAEILYAALQQQDEI 67

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKL----ADFEKVLIFFALEINTLDEAL 153
            E +GR+ +YA + Y+ +    T   FY  +N +     +   +   F   E+ ++++  
Sbjct: 68  TERLGRLYTYAHMRYDQD----TTNSFYQGLNDRAQTLASQVGQAASFVVPELMSIEKEK 123

Query: 154 LEQSYAQ-DPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
           ++    + +PLTL Y   +  + K + H+LS   E +L+  S+V       F   N   +
Sbjct: 124 IDTFLNEHEPLTL-YRHMLDELNKQRPHVLSEAEESILAQASEVTSAPSNTFGMLNNADM 182

Query: 213 RFKI----NDQKIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAKD 266
            F      N +++ +T   Y  F +S DR VRK A +A+  T+ K  + F+   ++  K 
Sbjct: 183 TFPTIVNENGEEVEVTHGRYLQFLESGDRRVRKDAFQAVYSTYEKYKNTFASTLSSQVKR 242

Query: 267 EEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMY 326
           +      RKY K A    LS N  P V+   + S  N      HRY +L+K+ L +D ++
Sbjct: 243 DLFYANVRKY-KSAREAALSRNFIPEVVYDQLVSTVNDNLHLLHRYVKLRKRILGVDELH 301

Query: 327 FWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSG 386
            +D   PL    +  I ++ A++LVL+ +A          ++ +   WID  +  GK SG
Sbjct: 302 MYDLYTPLVKDVEMKISYDEAKELVLKGFAPLGESYIDEIKQGYEKRWIDVVENKGKRSG 361

Query: 387 AFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETA 446
           A++ G   ++ PYIL+N+     +V TLAHELGH +H   S + Q     + ++ +AE A
Sbjct: 362 AYSSGAYGTM-PYILMNWQDNIDNVFTLAHELGHSMHSFYSRKHQPYPYGDYTIFVAEVA 420

Query: 447 SIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDI 506
           S   E L  D L++  ++++E+  LL + +E    ++ RQ  F +FE  +H +      +
Sbjct: 421 STLNEALLNDYLVKNTNNEQEKIYLLNHFLEGFRGTVFRQTMFAEFEQLIHEQSADGIPL 480

Query: 507 PTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYD 566
               +++++ +   +  G    + D E G  W  +PHF   +FYVY YA G     +L  
Sbjct: 481 TPELLSKLYYDLNVKYFGDEI-VIDKEIGLEWARIPHFY-YNFYVYQYATGYSAAAALAK 538

Query: 567 IYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
               +      E+YL+ L+AG+S++  ++L    ++++     +  L   EK +D++E +
Sbjct: 539 QILEDGAPVV-ERYLDFLKAGSSQYPIDILKHAGVDMTSKKPIQEALSLFEKTLDEIEAL 597


>gi|237843255|ref|XP_002370925.1| oligoendopeptidase F, putative [Toxoplasma gondii ME49]
 gi|211968589|gb|EEB03785.1| oligoendopeptidase F, putative [Toxoplasma gondii ME49]
 gi|221481876|gb|EEE20246.1| oligoendopeptidase F, putative [Toxoplasma gondii GT1]
 gi|221502374|gb|EEE28107.1| oligoendopeptidase F, putative [Toxoplasma gondii VEG]
          Length = 566

 Score =  187 bits (476), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 127/416 (30%), Positives = 192/416 (46%), Gaps = 59/416 (14%)

Query: 250 NKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTS 309
           N+     +   N +  +  I+ R R Y      R++ N++   ++ AL+ +VK    + +
Sbjct: 124 NRIDKFAALALNMVVGNWIIETRERGYHSPRSRRNVLNSISDEIVNALIAAVKEEGVQVT 183

Query: 310 HRYYELKKKWLK-----------------------------------------------L 322
            R   LKK+ L                                                +
Sbjct: 184 RRAMLLKKRLLTATGKIKVSQTTGTDFHRRKIHPDCLWQRFSQVCSVILHLPVPFVYFDI 243

Query: 323 DTMYFWDRLAPLPGT------SQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWID 376
            T  F DRLAPL  T      +   +P+  A + V   YA FSP    + EK      ID
Sbjct: 244 QTFSFVDRLAPLTLTKDSSAEATARVPWCQAVETVKNGYASFSPVFVRLFEKLLNEGRID 303

Query: 377 APQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTN 436
           A   DGK +GAF  G  P+  P+IL+ + G   +V TLAHE GH IHF+L+ E QG L  
Sbjct: 304 AAPADGKQTGAFCSGGTPATGPFILMTHTGVKANVQTLAHEAGHAIHFLLAYE-QGNLQY 362

Query: 437 NSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKL 496
           +  L LAETAS+ GET+ F  LL    S  +   +L   ++ ++ +I RQ+SF  FE  +
Sbjct: 363 HPPLPLAETASLMGETVVFFHLLDQTESPHKVLEMLVEHLDSLVGTITRQVSFDRFEELV 422

Query: 497 HTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSF---WMMVPHFIESSFYVYA 553
           H E R +G +     + +WL++ KE  G   D+ D +Y      W  V HF ++ FYVY+
Sbjct: 423 H-ETRLSGIVGDDEFDRLWLQSTKEFFGDEGDVFD-DYAGIEKDWSTVHHFTKAPFYVYS 480

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFW 609
           YA  + LV SL      N    F+EK+++ L+AG++      L P  ++ + P+FW
Sbjct: 481 YALADLLVGSLLAARTQNDGSDFEEKFISFLQAGDTADLETALRPFGLDPTTPSFW 536


>gi|114567434|ref|YP_754588.1| oligoendopeptidase F [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|114338369|gb|ABI69217.1| oligopeptidase F. Metallo peptidase. MEROPS family M03B
           [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
          Length = 600

 Score =  187 bits (476), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 158/603 (26%), Positives = 284/603 (47%), Gaps = 19/603 (3%)

Query: 30  QENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGA 89
           +E +G   +W LED+Y   +S E   D + +E +  A + +++G L  ++ Q     +  
Sbjct: 8   REEIGPEYKWKLEDIYADENSWE--EDYKKLEEQIPALE-KYKGVLGSSSTQ--LLQVLE 62

Query: 90  AIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTL 149
              E ER  E   ++  YA +  + +  +   +  +  +     +      +   EI +L
Sbjct: 63  FSHELERKAE---KLYVYARMRRDEDNGNSHYQALFDRVQRLSIELGSASAYIVPEIISL 119

Query: 150 DEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENI 209
               +     ++     YS  +  + + K+H+LS + E +L+ ++ +   A   F   N 
Sbjct: 120 APEKIRAFLDENQDLQLYSRLLDELMRQKEHILSPEEERILAMSADLSLAAKNIFGMLNN 179

Query: 210 ESLRFKI----NDQKIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTL 263
             ++F +      + + LTK  Y SF +S +R VRK A  AL  ++ K  +  +    + 
Sbjct: 180 ADIKFPVIQDEEGKAVELTKGRYGSFMESNERRVRKEAFTALYGSYGKVKNTLAMSLASN 239

Query: 264 AKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLD 323
            K++    R RKY    ++    +N+ P V E L+++V N   +  +RY  L+KK L LD
Sbjct: 240 VKNDIFYSRVRKYPSALEASLDQDNISPEVYERLVETVHNNM-EPMYRYLRLRKKALGLD 298

Query: 324 TMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGK 383
            ++ +D  APL    +  + +E ++++VL++      +   I        WID  + +GK
Sbjct: 299 ELHMYDIYAPLVKEFKSKVSYEKSQEMVLKALQPLGDEYLAILRGGLKGGWIDVYENEGK 358

Query: 384 GSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLA 443
            SGA++ G   S HPY+L+NY  K  DV TLAHE+GH +H   S++ Q  + +  S+ +A
Sbjct: 359 TSGAYSWGCYDS-HPYVLMNYDDKLDDVFTLAHEMGHALHSYYSNKNQPYVYSQYSIFVA 417

Query: 444 ETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRST 503
           E AS   E L  D LL  +    E+  L+ + +E    ++ RQ  F +FE K+H +    
Sbjct: 418 EVASTVNELLLIDYLLAQSREPREKAYLINHYLEQFRGTVYRQTMFAEFEKKIHEQVEQG 477

Query: 504 GDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNS 563
             +    + + + E  +   G    L D E    W  +PHF  S+FYVY YA G     +
Sbjct: 478 QTLTADGLCQSYRELNRLYYGTDTVL-DEEIDMEWARIPHFY-SAFYVYKYATGFSAAVA 535

Query: 564 LYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDV 623
           L +            +YL  L++G+S +   LL    ++L+ P   E+ L    +++ ++
Sbjct: 536 LKEQILQEGKPAVA-RYLEFLKSGSSDYPLNLLKKAGVDLTTPEPVEKALHLFARLVAEM 594

Query: 624 EKM 626
           E +
Sbjct: 595 EAV 597


>gi|152974721|ref|YP_001374238.1| oligoendopeptidase F [Bacillus cereus subsp. cytotoxis NVH 391-98]
 gi|152023473|gb|ABS21243.1| oligoendopeptidase F [Bacillus cytotoxicus NVH 391-98]
          Length = 608

 Score =  187 bits (476), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 157/606 (25%), Positives = 294/606 (48%), Gaps = 42/606 (6%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W LED++ + ++ E   + + I+ E L     ++G L       +  SL AA+   + I 
Sbjct: 22  WRLEDIFQTDEAWE--KEFQAIK-ELLPKLNEFKGKLG-----DSAESLLAALQYEDEIS 73

Query: 99  ELIGRIASYAMLSYNCNLSSPTIR-------KFYTDINAKLADFEKVLIFFALEINTLDE 151
             +G++ +YA + Y+ + ++ T +         Y+ +++  A       +   EI  + +
Sbjct: 74  MRLGKLYTYAHMRYDQDTTNSTYQALNDRAMNLYSQVSSSTA-------YIVPEILKISQ 126

Query: 152 ALLEQSYAQDPLTLK-YSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIE 210
            LL QS+ Q+   L+ Y   ++ I + + H+LS   E LL++ ++V   +   F   N  
Sbjct: 127 ELL-QSFLQENKELRVYEHALEEITRQRPHVLSEAEESLLAEAAEVMSSSSNTFGMLNNA 185

Query: 211 SLRFKI----NDQKIPLTKA-YKSFFDSD-REVRKSAAKALSHTFNKSSHIFSFITNTLA 264
            L+F      N +++ +T   Y  F +SD R VR  A  A+  T+ K  + F+   +   
Sbjct: 186 DLKFPSIKDENGEEVEVTHGRYIQFLESDDRRVRHDAFHAVYETYGKFKNTFASTLSGAV 245

Query: 265 KDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDT 324
           K      R RKY+    +   +N++   V + L+++V N+     HRY +++K+ LKLD 
Sbjct: 246 KRNNFNARVRKYDSARQAALSNNHIPETVYDQLIETVHNHL-HLLHRYIDIRKRALKLDE 304

Query: 325 MYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKG 384
           ++ +D   PL    +  + +E A++++L+S      +   I ++ + + W+D  +  GK 
Sbjct: 305 LHMYDLYTPLVPEVKMNVKYEEAQEILLKSLHVLGDEYVDILKEAYENRWVDVYENKGKR 364

Query: 385 SGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAE 444
           SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  +  + S+ +AE
Sbjct: 365 SGAYSSGAY-GTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVYGDYSIFVAE 423

Query: 445 TASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTG 504
            AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  +H + +   
Sbjct: 424 VASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHIIHQKVQEGH 483

Query: 505 DIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHF---IESSFYVYAYAFGNCLV 561
            +    + EI+ +  K   G A  + D E G  W  +PHF        Y   ++    L 
Sbjct: 484 AVTPDMLTEIYYDLNKTYFGDAV-VIDKEIGLEWSRIPHFYYNYYVYQYATGFSAATALS 542

Query: 562 NSLYDIYKSNTVDCFKEKYLN-ILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMI 620
             + +  K        E+Y+N  L+AG+S +  E+L    ++++ P   +  LQ  E+ +
Sbjct: 543 KQILEEGKPAV-----ERYINEFLKAGSSDYPIEVLKKAGVDMTSPEPVKEALQVFEEKL 597

Query: 621 DDVEKM 626
           +++E +
Sbjct: 598 NELEAL 603


>gi|256752696|ref|ZP_05493546.1| oligoendopeptidase F [Thermoanaerobacter ethanolicus CCSD1]
 gi|256748415|gb|EEU61469.1| oligoendopeptidase F [Thermoanaerobacter ethanolicus CCSD1]
          Length = 596

 Score =  187 bits (476), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 167/613 (27%), Positives = 289/613 (47%), Gaps = 28/613 (4%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDS-QEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           M  +  +  + +  +W LED+Y + +  +E  N  + +  E + FK    G +  + N  
Sbjct: 1   MEVLKDRSEIEDKYKWRLEDIYENENLWEEDYNKTKELLKEIVKFK----GKINTSKNLL 56

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKL-ADFEKVLIF 141
               L       ++I     +I +YA +  + + ++P  +   TD   +L  +      F
Sbjct: 57  EVLKLN------DQIGMTASKIFAYARMRRDEDNTNPKYQAL-TDKAMRLNIEVMSATSF 109

Query: 142 FALEINTLD-EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
            A EI ++D + L+E     + L + Y  +++++ + K H+LS + E +L++   +    
Sbjct: 110 IAPEILSIDTQKLMEMIEGLEELKI-YKQYLEDLIRFKPHVLSPEEEKILAEAKTLAESV 168

Query: 201 LKRFFCENIESLRFKI----NDQKIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSH 254
              +   N   +RF I      +++ +T   +  F  S DR VRK+A  A+  T+ K  +
Sbjct: 169 SNIYTMLNNADMRFPIIKDEEGKEVEVTHGNFVRFMQSKDRNVRKAAFNAMYDTYKKFIN 228

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
            F+       K +    + RKY    ++    +NV   V   L+++V +      HRY  
Sbjct: 229 TFASTMVGNVKKDIFYVKTRKYNSSLEASLFEDNVSLEVYNNLIETVHSRLD-VLHRYVR 287

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           LKKK L LD ++ +D   PL         +E A +LVL+       +   + ++ F   W
Sbjct: 288 LKKKLLGLDELHMYDLYVPLIQEYDKKFTYEEAIELVLEGLKPLGDEYINLLKQGFNSRW 347

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D  +  GK SGA++ GT  + HPY+LLNY GK  DV T+AHE+GH +H   S+ TQ  +
Sbjct: 348 VDVYENRGKTSGAYSWGTYGT-HPYVLLNYQGKLNDVFTIAHEMGHSLHTYYSNATQPYV 406

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
                + +AE AS   E L  D LL+ +  ++ER  LL +  E+   ++ RQ+ F +FE 
Sbjct: 407 YAGYKIFVAEVASTCNEALLMDYLLKNSKDEKERLYLLNHFFEEFRGTVYRQVMFAEFEK 466

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSF-WMMVPHFIESSFYVYA 553
            +H        +    +N+ + E  K   G   D+   E  S+ W  +PHF   +FYVY 
Sbjct: 467 LIHEMAERGEPLTAEVLNKKYYELNKLYYGD--DIVVDEGISYEWARIPHFY-RNFYVYK 523

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YA G     ++  +   N  +   E+Y   L++G+S +   LL    ++L+ P      L
Sbjct: 524 YATGFSAAIAISQMI-LNEGEKAVERYKEFLKSGSSDYPLNLLKKAGVDLTTPKPVNDAL 582

Query: 614 QTVEKMIDDVEKM 626
              EK++D+ EKM
Sbjct: 583 DVFEKLLDEFEKM 595


>gi|323706078|ref|ZP_08117647.1| oligoendopeptidase F [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323534522|gb|EGB24304.1| oligoendopeptidase F [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 599

 Score =  187 bits (475), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 158/613 (25%), Positives = 296/613 (48%), Gaps = 34/613 (5%)

Query: 27  MDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS 86
           +  ++++ +  +W LED+Y S   +E ++D +  + + +   + ++G +  + +  N   
Sbjct: 5   LKDRKDIDDKYKWKLEDIYES--DKEWNDDFDKAK-KIIRQLSDFKGKIKDSESLLNVLK 61

Query: 87  LGAAIAEYERICELIGRIASYAML-----SYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
           L  A+        +I ++  YA +     + N    + T +    +I A  A       F
Sbjct: 62  LNDALQM------IIEKLFVYARMKRDEDNSNGKYQALTDKAMRINIEASSA-----TSF 110

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
            A EI ++DE +L+    ++   + Y  +++++ + K H LS+  E +L+++  +     
Sbjct: 111 IAPEILSMDEKILKSCIEENADFIDYRHFLEDLLRYKPHTLSDKEEMILAESEVMAHSPE 170

Query: 202 KRFFCENIESLRF-KINDQK---IPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHI 255
             F   +   +RF  I D+    + LT   Y  F  S DR VRK + ++L   +   ++ 
Sbjct: 171 NIFKMLDNADIRFPSIEDEDGDLVELTHGNYIRFISSKDRNVRKKSFESLYSVYKNFANT 230

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTS--HRYY 313
           ++ +T++  K +    + R Y    ++    +NV   V + L++++   + K +  HRY 
Sbjct: 231 YAAMTDSNVKKDVFYSKIRNYSTSLEASLFDDNVPVSVYDNLIEAI---HEKINLLHRYV 287

Query: 314 ELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHN 373
            L+K+ L LD ++ +D   PL         +E A+D+VL++      +   I  + F   
Sbjct: 288 SLRKRMLNLDELHMYDLYVPLVADFDKEYEYEEAKDIVLKALEPLGNEYVSILREGFDSR 347

Query: 374 WIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGI 433
           WID  +  GK SGA++ GT   VHP++LLN+ GK  DV T+AHE+GH +H   S + Q  
Sbjct: 348 WIDVYENRGKTSGAYSWGTY-GVHPFVLLNFQGKLDDVFTIAHEMGHSLHTYYSDKAQKY 406

Query: 434 LTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFE 493
           + ++  + +AE AS   E++  D LL+ A  K E+  LL + +E    +I RQ+ F +FE
Sbjct: 407 INSHYKIFVAEVASTCNESILIDYLLKNARDKSEKLYLLNHYLEQFKGTIFRQVMFAEFE 466

Query: 494 LKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYA 553
              H E      +   ++ + + E  +   G    + D E    W  +PHF  SSFYVY 
Sbjct: 467 KYTHEEAEKGEALTAEKLCKKYHELNQFYYGNDIIVDD-EIDYEWERIPHFY-SSFYVYK 524

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YA G     +L  +   N  D   ++Y+  L++G S +   +L    ++L+        L
Sbjct: 525 YATGFSAAVALSQMI-LNEGDAAVKRYIEFLKSGGSDYPLNILKKAGVDLTTKKPVLDAL 583

Query: 614 QTVEKMIDDVEKM 626
              E ++D++E++
Sbjct: 584 TVFENVLDEMERL 596


>gi|257888162|ref|ZP_05667815.1| peptidase M3B [Enterococcus faecium 1,141,733]
 gi|257824216|gb|EEV51148.1| peptidase M3B [Enterococcus faecium 1,141,733]
          Length = 602

 Score =  187 bits (474), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 134/529 (25%), Positives = 254/529 (48%), Gaps = 11/529 (2%)

Query: 104 IASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPL 163
           I  YA L  + +  +   +  Y   ++  +   + + +F  EI  L +  + Q + ++P 
Sbjct: 75  IYVYAHLKNDQDTGNTEYQALYARASSLFSKVSEAVSWFEPEILQLSDERIWQYFKEEPK 134

Query: 164 TLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI----NDQ 219
              Y  +I+ I   + H+LS D E LL+   ++   +   F   N   L F      N +
Sbjct: 135 LEVYRHYIQQIVDNRAHVLSADQESLLAGAGEIFEASSDTFAVLNNADLVFPTIEGENGE 194

Query: 220 KIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYE 277
           K+ L+   Y    +S DR VR++A K L   + +  + F+   +T  K    + + R Y 
Sbjct: 195 KVQLSHGVYGQLLESTDRSVREAAFKGLYSVYEQFRNTFASTLSTHIKGHNFKAKVRNYS 254

Query: 278 KIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGT 337
              ++   +N++   V + L+  V  + P   HRY EL+K+ L+++ ++ +D   P+ G 
Sbjct: 255 SAREASLSNNHIPESVYDTLVDVVNKHLPLL-HRYMELRKRLLEVEKLHMYDLYTPVLGE 313

Query: 338 SQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVH 397
           +     +E A++  L++      +   I EK F+  WID  +  GK SGA++ G+  + +
Sbjct: 314 APITFTYEEAKEKALEALKPMGEEYMTIVEKAFSERWIDVVENKGKRSGAYSSGSYDT-N 372

Query: 398 PYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDS 457
           PYILLN+      + TL HE+GH +H   +  +Q  +  + S+ LAE AS   E +  + 
Sbjct: 373 PYILLNWHDTLDQLFTLVHEMGHSVHSYFTRSSQPYVYGDYSIFLAEIASTTNENILTEY 432

Query: 458 LLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLE 517
           LL+       R  +L + ++    ++ RQ  F +FE  +HTE      + +  +++ + +
Sbjct: 433 LLETEKDPRVRAYVLNHYLDGFKGTVFRQTQFAEFEHFMHTEDEKGVPLTSEYLSDSYGK 492

Query: 518 TQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFK 577
              +  GPA +  D E    W  +PHF   ++YV+ Y+ G    ++L     S   D   
Sbjct: 493 LNAKYYGPAVE-EDPEIKFEWSRIPHFY-YNYYVFQYSTGFSAASALAKRILSQEPDAL- 549

Query: 578 EKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           E YL  L+AGNS +  E++    ++++   + E  +   E+ ++++E++
Sbjct: 550 ENYLAYLKAGNSDYPVEVMKKAGVDMTQAAYIEDAMSMFEQRLNELEEL 598


>gi|227552609|ref|ZP_03982658.1| oligoendopeptidase F [Enterococcus faecium TX1330]
 gi|257896947|ref|ZP_05676600.1| peptidase M3B [Enterococcus faecium Com12]
 gi|227178235|gb|EEI59207.1| oligoendopeptidase F [Enterococcus faecium TX1330]
 gi|257833512|gb|EEV59933.1| peptidase M3B [Enterococcus faecium Com12]
          Length = 602

 Score =  187 bits (474), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 134/529 (25%), Positives = 254/529 (48%), Gaps = 11/529 (2%)

Query: 104 IASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPL 163
           I  YA L  + +  +   +  Y   ++  +   + + +F  EI  L +  + Q + ++P 
Sbjct: 75  IYVYAHLKNDQDTGNTEYQALYARASSLFSKVSEAVSWFEPEILQLSDERIWQYFKEEPK 134

Query: 164 TLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI----NDQ 219
              Y  +I+ I   + H+LS D E LL+   ++   +   F   N   L F      N +
Sbjct: 135 LEVYRHYIQQIVDNRAHVLSADQESLLAGAGEIFEASSDTFAVLNNADLVFPTIEGENGE 194

Query: 220 KIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYE 277
           K+ L+   Y    +S DR VR++A K L   + +  + F+   +T  K    + + R Y 
Sbjct: 195 KVQLSHGVYGQLLESTDRSVREAAFKGLYSVYEQFRNTFASTLSTHIKGHNFKAKVRNYS 254

Query: 278 KIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGT 337
              ++   +N++   V + L+  V  + P   HRY EL+K+ L+++ ++ +D   P+ G 
Sbjct: 255 SAREASLSNNHIPESVYDTLVDVVNKHLPLL-HRYMELRKRLLEVEKLHMYDLYTPVLGE 313

Query: 338 SQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVH 397
           +     +E A++  L++      +   I EK F+  WID  +  GK SGA++ G+  + +
Sbjct: 314 APITFTYEEAKEKALEALKPMGEEYMTIVEKAFSERWIDVVENKGKRSGAYSSGSYDT-N 372

Query: 398 PYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDS 457
           PYILLN+      + TL HE+GH +H   +  +Q  +  + S+ LAE AS   E +  + 
Sbjct: 373 PYILLNWHDTLDQLFTLVHEMGHSVHSYFTRSSQPYVYGDYSIFLAEIASTTNENILTEY 432

Query: 458 LLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLE 517
           LL+       R  +L + ++    ++ RQ  F +FE  +HTE      + +  +++ + +
Sbjct: 433 LLETEKDPRVRAYVLNHYLDGFKGTVFRQTQFAEFEHFMHTEDEKGVPLTSEYLSDSYGK 492

Query: 518 TQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFK 577
              +  GPA +  D E    W  +PHF   ++YV+ Y+ G    ++L     S   D   
Sbjct: 493 LNAKYYGPAVE-EDPEIKFEWSRIPHFY-YNYYVFQYSTGFSAASALAKRILSQEPDAL- 549

Query: 578 EKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           E YL  L+AGNS +  E++    ++++   + E  +   E+ ++++E++
Sbjct: 550 ENYLAYLKAGNSDYPVEVMKKAGVDMTQAAYIEDAMSMFEQRLNELEEL 598


>gi|293379110|ref|ZP_06625261.1| oligoendopeptidase F [Enterococcus faecium PC4.1]
 gi|292642251|gb|EFF60410.1| oligoendopeptidase F [Enterococcus faecium PC4.1]
          Length = 602

 Score =  187 bits (474), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 134/529 (25%), Positives = 254/529 (48%), Gaps = 11/529 (2%)

Query: 104 IASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPL 163
           I  YA L  + +  +   +  Y   ++  +   + + +F  EI  L +  + Q + ++P 
Sbjct: 75  IYVYAHLKNDQDTGNTEYQALYARASSLFSKVSEAVSWFEPEILQLSDERIWQYFKEEPK 134

Query: 164 TLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI----NDQ 219
              Y  +I+ I   + H+LS D E LL+   ++   +   F   N   L F      N +
Sbjct: 135 LEVYRHYIQQIVDNRAHVLSADQESLLAGAGEIFEASSDTFAVLNNADLVFPTIEGENGE 194

Query: 220 KIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYE 277
           K+ L+   Y    +S DR VR++A K L   + +  + F+   +T  K    + + R Y 
Sbjct: 195 KVQLSHGVYGQLLESTDRSVREAAFKGLYSVYEQFRNTFASTLSTHIKGHNFKAKVRNYS 254

Query: 278 KIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGT 337
              ++   +N++   V + L+  V  + P   HRY EL+K+ L+++ ++ +D   P+ G 
Sbjct: 255 SAREASLSNNHIPESVYDTLVDVVNKHLPLL-HRYMELRKRLLEVEKLHMYDLYTPVLGE 313

Query: 338 SQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVH 397
           +     +E A++  L++      +   I EK F+  WID  +  GK SGA++ G+  + +
Sbjct: 314 APITFTYEEAKEKALEALKPMGEEYMTIVEKAFSERWIDVVENKGKRSGAYSSGSYDT-N 372

Query: 398 PYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDS 457
           PYILLN+      + TL HE+GH +H   +  +Q  +  + S+ LAE AS   E +  + 
Sbjct: 373 PYILLNWHDTLDQLFTLVHEMGHSVHSYFTRSSQPYVYGDYSIFLAEIASTTNENILTEY 432

Query: 458 LLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLE 517
           LL+       R  +L + ++    ++ RQ  F +FE  +HTE      + +  +++ + +
Sbjct: 433 LLETEKDPRVRAYVLNHYLDGFKGTVFRQTQFAEFEHFMHTEDEEGVPLTSEYLSDSYGK 492

Query: 518 TQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFK 577
              +  GPA +  D E    W  +PHF   ++YV+ Y+ G    ++L     S   D   
Sbjct: 493 LNAKYYGPAVE-EDPEIKFEWSRIPHFY-YNYYVFQYSTGFSAASALAKRILSQEPDAL- 549

Query: 578 EKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           E YL  L+AGNS +  E++    ++++   + E  +   E+ ++++E++
Sbjct: 550 ENYLAYLKAGNSDYPVEVMKKAGVDMTQAAYIEDAMSMFEQRLNELEEL 598


>gi|219848221|ref|YP_002462654.1| oligoendopeptidase F [Chloroflexus aggregans DSM 9485]
 gi|219542480|gb|ACL24218.1| oligoendopeptidase F [Chloroflexus aggregans DSM 9485]
          Length = 602

 Score =  186 bits (473), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 154/592 (26%), Positives = 270/592 (45%), Gaps = 26/592 (4%)

Query: 49  DSQEISNDMECIEHESLAFKTR------WEGNLAHATNQKNCHSLGAAIAEYERICELIG 102
           D  +I  D+   E E  A + R       +G LA    Q     L AA+   + + + + 
Sbjct: 21  DLSQIFADVPAWEQERSAVEARAQELAALQGTLAQGPAQ-----LLAALTLRDEVAQRLH 75

Query: 103 RIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDP 162
            +  YA+   + + + P  +       +  A  + VL F   EI T+    L++  A  P
Sbjct: 76  ALYVYALHRKDSDGTDPVGQGLAERAGSFAARIQAVLAFIEPEILTIPAETLDEWLAATP 135

Query: 163 LTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFK-IND--- 218
               Y   ++ + + + H+ S ++E +++  S + R     F       L+F  I D   
Sbjct: 136 GLQVYRYALEKLNRQRAHIRSAEVEQVMAALSDIVRAPYATFSMLTDADLQFPTIEDEQG 195

Query: 219 QKIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKY 276
           Q + L+ A Y    +S DR VR+ A K     F    +  +       +   I+ R R Y
Sbjct: 196 QPVKLSHARYGRLLESHDRRVRRDAFKGYYSAFLPFRNTLATTLGAAIRSHVIEARLRNY 255

Query: 277 EKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR-LAPLP 335
               ++    N +   V   L+ +V+   P+  HRY  ++++ + LD ++F+D  + P+P
Sbjct: 256 GSALEAALAPNEIPVEVYHNLIATVEANLPRF-HRYLTVRRRLMGLDDLHFYDLYVQPVP 314

Query: 336 GTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPS 395
                 IP+  A DL+ +++    P+     ++ FT  WID  +  GK SGA++ G+   
Sbjct: 315 DVEM-TIPYREACDLMREAFRPLGPEYGAALDQMFTRRWIDVYENVGKRSGAYSGGSY-G 372

Query: 396 VHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTF 455
             PYILLNY  + +DV TLAHELGH +H   +  TQ  +    ++ +AE AS   E L  
Sbjct: 373 TPPYILLNYQDRLRDVFTLAHELGHSLHSYFTRATQPFVYGEYTIFVAEVASTLNEALLT 432

Query: 456 DSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIW 515
             +LQ+ + +  R+ LLA +IE++  +I RQ  F  FEL +H +      +    +++ +
Sbjct: 433 HYMLQSGADEALRRRLLAQQIEEIRGTIFRQTMFAAFELWMHEQAERGQPLTADALSQHY 492

Query: 516 LETQKESLGPAFDLSDLEYGSFWMMVPH-FIESSFYVYAYAFGNCLVNSLYDIYKSNTVD 574
            E      GP   + D E    W+ +PH + +   Y YA      L  S   I   N   
Sbjct: 493 RELVVRYHGPELVIDD-ELAYEWLRIPHFYYQFYVYQYATGLSAALALSRQII---NEGQ 548

Query: 575 CFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              E+YL  LR+G+S+   +LL    ++++ P   +  + T  +++  +E++
Sbjct: 549 PAVERYLRFLRSGSSRSSIDLLRDAGVDMTSPAPIQAAMDTFAELVSQLEQL 600


>gi|257899592|ref|ZP_05679245.1| peptidase M3B [Enterococcus faecium Com15]
 gi|293571569|ref|ZP_06682591.1| oligoendopeptidase F [Enterococcus faecium E980]
 gi|257837504|gb|EEV62578.1| peptidase M3B [Enterococcus faecium Com15]
 gi|291608375|gb|EFF37675.1| oligoendopeptidase F [Enterococcus faecium E980]
          Length = 602

 Score =  186 bits (473), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 137/529 (25%), Positives = 252/529 (47%), Gaps = 11/529 (2%)

Query: 104 IASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPL 163
           I  YA L  + +  +   +  Y   ++  +   + + +F  EI  L +  + Q + ++P 
Sbjct: 75  IYVYAHLKNDQDTGNTEYQALYARASSLFSKVSEAVSWFEPEILQLSDERIWQYFKEEPK 134

Query: 164 TLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI----NDQ 219
              Y  +I+ I   + H+LS D E LL+   ++   +   F   N   L F      N +
Sbjct: 135 LEVYRHYIQQIVDNRAHVLSADQESLLAGAGEIFEASSDTFAVLNNADLVFPTIEGENGE 194

Query: 220 KIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYE 277
           K+ L+   Y    +S DR VR++A K L   + +  + F+   +T  K    + + R Y 
Sbjct: 195 KVQLSHGVYGQLLESTDRSVREAAFKGLYSVYEQFRNTFASTLSTHIKGHNFKAKVRNYS 254

Query: 278 KIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGT 337
             A    LSNN  P  +   + +V N +    HRY EL+K+ L+++ ++ +D   P+ G 
Sbjct: 255 S-AREASLSNNHIPESVYDTLVAVVNKHLPLLHRYMELRKRLLEVEKLHMYDLYTPVLGE 313

Query: 338 SQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVH 397
           +     +E A++  L++      +   I EK F+  WID  +  GK SGA++ G+  + +
Sbjct: 314 APITFTYEEAKEKALEALKPMGEEYMTIVEKAFSERWIDVVENKGKRSGAYSSGSYDT-N 372

Query: 398 PYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDS 457
           PYILLN+      + TL HE+GH +H   +   Q  +  + S+ LAE AS   E +  + 
Sbjct: 373 PYILLNWHDTLDQLFTLVHEMGHSVHSYFTRSNQPYVYGDYSIFLAEIASTTNENILTEY 432

Query: 458 LLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLE 517
           LL+       R  +L + ++    ++ RQ  F +FE  +HTE      + +  +++ + +
Sbjct: 433 LLETEKDPRVRAYVLNHYLDGFKGTVFRQTQFAEFEHFMHTEDEKGVPLTSEYLSDSYGK 492

Query: 518 TQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFK 577
              +  GPA +  D E    W  +PHF   ++YV+ Y+ G    ++L     S   D   
Sbjct: 493 LNAKYYGPAVE-EDPEIKFEWSRIPHFY-YNYYVFQYSTGFSAASALAKRILSQEPDAL- 549

Query: 578 EKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           E YL  L+AGNS +  E++    ++++   + E  +   E+ ++++E++
Sbjct: 550 ENYLAYLKAGNSDYPVEVMKKAGVDMTQAAYIEDAMSMFEQRLNELEEL 598


>gi|291538896|emb|CBL12007.1| oligopeptidase F. Metallo peptidase. MEROPS family M03B [Roseburia
           intestinalis XB6B4]
          Length = 600

 Score =  186 bits (473), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 137/493 (27%), Positives = 232/493 (47%), Gaps = 13/493 (2%)

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           F   EI  +DEA+LE  Y + P    Y   I+ I + K H LS +ME L++ T  +   +
Sbjct: 111 FIVPEILAMDEAVLEGYYKELPELELYRKQIEEIERTKAHTLSAEMEKLVAMTGDMAETS 170

Query: 201 LKRFFCENIESLRF-KINDQKIPLTKAYKSFF-----DSDREVRKSAAKALSHTFNKSSH 254
            + +   N     F +I D++    +     F      +DR VRK A +     + + ++
Sbjct: 171 GQVYSIINNADFVFPEIKDEEGDTVRLSHGNFVPFEESADRRVRKDAFEGFYGVYKQYAN 230

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
             + + N   K +      R Y    ++   +NNV P V   L+ ++     K  HRY  
Sbjct: 231 TLAALYNGQVKQQVFYANARHYHSTLEAAVDANNVSPTVYHNLIDTINKNMDKM-HRYVR 289

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+KK L +D ++ +D   P+   +   I FE A++ VL++ A    +     ++ F   W
Sbjct: 290 LRKKCLGVDELHMYDVYTPMIADAAKKISFEEAKETVLKALAPLGEEYVAKVKEGFESRW 349

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           ID  + +GK SGA++ G   S HPY+LLN+     ++ TLAHE+GH +H   S+ +Q  +
Sbjct: 350 IDVYENEGKRSGAYSAGAYGS-HPYVLLNHNDTLDNMFTLAHEMGHAMHSYYSNSSQPYI 408

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
            +   + +AE AS   E L  + LL+  + K+ER  LL + ++    ++ RQ  F ++E+
Sbjct: 409 YSQYKIFVAEVASTCNEVLLMEYLLKNTTDKKERAYLLNHYLDSFKGTVYRQTMFAEYEM 468

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
             +        +    +N+++ +   +  G    +SD E    W  +PHF   +FYVY Y
Sbjct: 469 LSNKMVEEGESLTAETLNKLYYDLNCKYFGLDM-VSDSEIAYEWARIPHFY-YNFYVYQY 526

Query: 555 AFG-NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           A G +  V   + I K        E+Y   L  G S    ELL    +NL  P   +  L
Sbjct: 527 ATGFSSAVALAHGILKEGAPAV--ERYKKFLSGGCSASPVELLKIAGVNLETPKPIQEAL 584

Query: 614 QTVEKMIDDVEKM 626
               +++D++E +
Sbjct: 585 DVFGEVLDEIEAL 597


>gi|299535945|ref|ZP_07049264.1| oligoendopeptidase F [Lysinibacillus fusiformis ZC1]
 gi|298728550|gb|EFI69106.1| oligoendopeptidase F [Lysinibacillus fusiformis ZC1]
          Length = 605

 Score =  186 bits (473), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 157/580 (27%), Positives = 269/580 (46%), Gaps = 32/580 (5%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W LED++ + ++ E     E  EH   A    + G L          +L AA+  ++ I 
Sbjct: 20  WRLEDIFATDEAWE-EELKEVAEHAKQA--PSYAGTL-----NNGAEALLAALQYHDHIY 71

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKL----ADFEKVLIFFALEINTLDEALL 154
           E   ++ +YA + Y+ +    T   FY D+N+++          L +   EI TL E  +
Sbjct: 72  ERAMKLYTYAHMRYDQD----TTNGFYQDMNSRIQTLATSISAGLSYLTPEILTLSEETI 127

Query: 155 EQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF 214
           E+   ++     Y   +K I   + H+L  + E LL+  S+V   A   F   N   + F
Sbjct: 128 ERYLTENQDLQLYKQSLKEITMARPHVLPAEQEALLAQMSEVTGTASNTFSMLNNADMVF 187

Query: 215 ----KINDQKIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEE 268
                   +++ LT   Y  F +S DR VR+ A KA+  T+ K  + FS       K   
Sbjct: 188 PHVKNEEGEEVQLTHGNYIKFLESKDRSVREGAFKAMYETYGKFKNTFSATLTGNVKKHN 247

Query: 269 IQDRWRKYEKIADSRH--LSNNVEPY-VIEALMQSVKNYYPKTSHRYYELKKKWLKLDTM 325
           +  R R YE    +RH  +SNN  P  V + L++++  + P    RY  L+KK L +D +
Sbjct: 248 VSARIRHYES---ARHAAMSNNFIPENVYDQLVETIHKHLPAM-QRYISLRKKLLGVDEL 303

Query: 326 YFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGS 385
           + WD  APL    +  + ++ A+D+++++ A    +   I +    + W+D  +  GK S
Sbjct: 304 HMWDLFAPLVKEVEMKVSYDEAKDILVKALAPLGEEYQSIVQNGLDNRWVDVLENKGKRS 363

Query: 386 GAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAET 445
           GA++ G     +PYIL+N+     ++ TLAHE GH +H   S   Q  +  + S+ +AE 
Sbjct: 364 GAYSSGAY-GTNPYILMNWQDNVNNLFTLAHEFGHSVHSYYSRNNQPFVYGDYSIFVAEV 422

Query: 446 ASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGD 505
           AS   E L  D LL+     +++  LL + ++   +++ RQ  F +FE  +H   ++   
Sbjct: 423 ASTCNEELLNDYLLKTIDDPQQKIYLLNHWLDGFRSTVFRQTMFAEFEHLIHQMDKNGES 482

Query: 506 IPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLY 565
           +   R+ E++ E  K+  G    + D E G  W  +PHF  + + VY YA G     +L 
Sbjct: 483 LTADRLTEVYYELNKKYFGDDM-VVDEEIGLEWARIPHFYYNYY-VYQYATGKSAATALS 540

Query: 566 DIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSD 605
                      +    N L+AG S    E+L    +++++
Sbjct: 541 KQILEEGAPAVERYINNFLKAGCSDFPIEVLKAAGVDMNE 580


>gi|309389249|gb|ADO77129.1| oligopeptidase F [Halanaerobium praevalens DSM 2228]
          Length = 598

 Score =  186 bits (473), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 162/609 (26%), Positives = 279/609 (45%), Gaps = 25/609 (4%)

Query: 27  MDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS 86
           + ++E +    +WNL D+Y + DSQ   ++++ +  E    K   E   + A  +   +S
Sbjct: 5   LKTREEIDAKYKWNLTDIYET-DSQ-FESELKAVLTEIKEIKALKENFTSSA--EYLINS 60

Query: 87  LGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKV---LIFFA 143
           L   I    +I E   R+ +YA L Y+ N  +    K+    N  L  + K+     F  
Sbjct: 61  LNKII----KIEEKTARLYAYAHLKYDQNTKN---NKYQNYKNKALTAYNKLSNSTSFMV 113

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
             I  L    LE    ++     ++ +  NI + K+H LS   E +L+   +V + +   
Sbjct: 114 PAIIKLGTTKLEDYKKENEKLEFFNHFFDNILREKEHYLSAAEEKVLALAGEVTQSSENI 173

Query: 204 FFCENIESLRFKI--NDQKIPLTKAYKSFFD----SDREVRKSAAKALSHTFNKSSHIFS 257
           F   N   L F +  ++ K  L   +  + D     DR VRK A KA+   +  S + F+
Sbjct: 174 FSMLNNADLEFPLIEDENKEELRLTHGRYIDLLKNEDRRVRKDAFKAMHGEYKNSENTFA 233

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
            + ++  K +    R RKY+    S   S+N+   V   L+++V N      H+Y ELKK
Sbjct: 234 AVLDSSVKGDVFYARSRKYKSSLASALASDNISTDVYNNLIETVSNNLEPL-HQYMELKK 292

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           + L LD ++ +D   PL    +    ++  ++++ ++ A          E  F   WID 
Sbjct: 293 EILNLDELHIYDTYTPLIKEIELKFEYDKTKEIIKKAVAPLGEDYVETVESGFNSGWIDV 352

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK SGA++ G    VHPYIL+NY     ++ TL+HE+GH +H   +++ Q  L  +
Sbjct: 353 YENKGKRSGAYSSGCY-GVHPYILMNYTQDISNLFTLSHEMGHAMHSYYANQNQPYLYAD 411

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
             + +AE AS   E L  D +L+ A +KEE+  LL   +E    ++ RQ  F +FE  +H
Sbjct: 412 YKIFVAEVASTLNENLLLDYMLENAQTKEEKLYLLNYFLEGFRGTVYRQTMFAEFEKMIH 471

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
               +   + +  +  ++ +  K+  G A  + D E    W  +PHF   +FYVY YA G
Sbjct: 472 QNVENGESLTSQSLKTMYRKLNKKYFGKAL-VIDQELDYEWARIPHFY-YNFYVYKYATG 529

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                +L +  K+   +     YL  L+AG S +   +L    +N+  P   E      +
Sbjct: 530 YSAAAALAEKIKNQGPEA-AANYLEFLKAGGSDYPLNILKKAGVNMEKPAVIENSTAKFK 588

Query: 618 KMIDDVEKM 626
           K +  ++ +
Sbjct: 589 KYLKQLQDL 597


>gi|67009983|dbj|BAD99434.1| oligopeptidase [Geobacillus sp. MO-1]
          Length = 604

 Score =  186 bits (472), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 156/600 (26%), Positives = 286/600 (47%), Gaps = 31/600 (5%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFK-TRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           W LED++P+ ++ E     E  E + +  K   ++G L  + +      L  A+   + +
Sbjct: 22  WRLEDIFPTDEAWE----QEFQEVKKMIPKLAEYQGRLGESAD-----VLYEALQYQDEV 72

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKL----ADFEKVLIFFALEINTLDEAL 153
              +G++ +YA + Y+ +    T   FY  +N +     ++    + F   EI  +DE  
Sbjct: 73  SMRLGKLYTYAHMRYDQD----TTNAFYQGLNDRATSLYSEASSAMAFIVPEILAIDEVK 128

Query: 154 LEQSYAQDPLTLK-YSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
           L +S+ ++   LK Y   +  I + + H+LS + E LL+  ++V + +   F   N   L
Sbjct: 129 L-RSFLEEKQELKLYEHALDEINRQRPHVLSAEEEALLAQAAEVMQSSSSTFSMLNNADL 187

Query: 213 RFKI----NDQKIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAKD 266
            F      N +++ +T   +  F +S DR VR+ A KA+  T+ K  + F+       K 
Sbjct: 188 TFPTIIDENGEEVEVTHGRFIRFLESTDRRVRRDAFKAVYDTYEKYKNTFASTLAGTVKK 247

Query: 267 EEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMY 326
           +    R R+Y+   ++   SNN+   V + L+++V  + P   HRY  L+KK L LD ++
Sbjct: 248 DNFFARVRRYKSAREAALSSNNIPESVYDNLIETVHEHLP-LLHRYVRLRKKVLGLDELH 306

Query: 327 FWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSG 386
            +D   PL    +  + +E A++ +L++ A    +   I ++   + W+D  +  GK SG
Sbjct: 307 MYDLYTPLVQDVKMEVTYEEAKEYMLKALAPLGEEYISIVKEGLENRWVDVRENKGKRSG 366

Query: 387 AFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETA 446
           A++ G     HPYILLN+     ++ TL HE GH +H   + +TQ     N S+ +AE A
Sbjct: 367 AYSSGAY-GTHPYILLNWQDNVNNLFTLVHEFGHSVHSYYTRKTQPYPYANYSIFVAEVA 425

Query: 447 SIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDI 506
           S   E L  D LL+    +++R  LL + +E    ++ RQ  F +FE  +H + +    +
Sbjct: 426 STCNEALLNDYLLKTMDEEKKRLYLLNHYLEGFRGTVFRQTMFAEFEHMIHIKAQEGEAL 485

Query: 507 PTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYD 566
               +  ++ E  K+  G    + D E G  W  +PHF  + + VY YA G     +L  
Sbjct: 486 TADSLTSLYYELNKKYFGDDI-VVDQEIGLEWARIPHFYYNYY-VYQYATGFSAATALSK 543

Query: 567 IYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
                     K +Y+  L+AG+S +  E+L    ++++      +  Q   + ++++E +
Sbjct: 544 QILEEGEPAVK-RYIEFLKAGSSDYPIEVLKKAGVDMTSAEPIRQACQVFAEKLEEMENL 602


>gi|302023994|ref|ZP_07249205.1| oligoendopeptidase F [Streptococcus suis 05HAS68]
 gi|330833041|ref|YP_004401866.1| oligopeptidase [Streptococcus suis ST3]
 gi|329307264|gb|AEB81680.1| oligopeptidase [Streptococcus suis ST3]
          Length = 600

 Score =  186 bits (472), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 154/608 (25%), Positives = 286/608 (47%), Gaps = 46/608 (7%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLA--HATNQKNCHSLGAAIAEYE 95
           +W+L  ++P+ D+                    WE  LA   A  +K     G  +   +
Sbjct: 13  QWDLTTIFPTDDA--------------------WEAELADLQAETEKTKEFAGHLLDSAK 52

Query: 96  RICEL----------IGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALE 145
            + E+          I ++  YA +  + +      ++F        A F +   F+  E
Sbjct: 53  SLLEISETQLSLMRRIEKLYVYASMKNDQDTREGKYQEFQAKAMGLYAAFSQAFAFYEPE 112

Query: 146 INTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFF 205
              + E  LE   A++P  ++YS   + +   K H+LS ++E +L+ TS++     + F 
Sbjct: 113 FMAITEEQLEAFKAEEPTLVQYSHQFEKLLAAKDHVLSQEVEEVLAATSEIFESPAETFS 172

Query: 206 CENIESLRF-KINDQK---IPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFI 259
             +  SLRF +I D+    +PL+   Y  F +S +R+VR+ A +A+  T+ +  H ++  
Sbjct: 173 VLDNASLRFPEIADEDGHLVPLSHGNYIHFMESKNRDVRQEAYEAMYGTYEQFQHTYAKT 232

Query: 260 TNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKW 319
             +  K   ++ R RKY+    +   +N +   V + L+ +V  + P   HRY  L+KK 
Sbjct: 233 LQSNVKVNNLKARLRKYDSARHASLAANFIPESVYDTLVAAVNKHLP-LLHRYINLRKKL 291

Query: 320 LKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQ 379
           L +D +  +D   PL   S  I  +E A     ++   F    S I ++ F + WID   
Sbjct: 292 LGIDDLKMYDMYTPLSDFSTKI-SYEDALKKCQETLEIFGEDYSAIVKEAFENRWIDVHV 350

Query: 380 YDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSS 439
            +GK SGA++ G   + + ++LLN+     ++ TL HE GH +H +L+ +TQ  +  + S
Sbjct: 351 NEGKRSGAYSGGAYDT-NAFMLLNWQDNLDNMYTLIHETGHSLHSMLTRKTQPYVYGHYS 409

Query: 440 LTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTE 499
           L LAE AS   E L  + LL      +ER  +L + ++    ++ RQ  F +FE  ++  
Sbjct: 410 LFLAEIASTTNENLLTEKLLAEVEDDKERFAILNHYLDGFRGTVFRQTQFAEFEQAIYKA 469

Query: 500 RRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNC 559
            +    +    +NE++ +T ++  G + +  + E    W  +PHF   +FYVY YA G  
Sbjct: 470 DQEGQVLTADFLNELYGQTNEKYYGLSAE-ENPEIQFEWARIPHFY-YNFYVYQYATGFA 527

Query: 560 LVNSLYD-IYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
             ++L + I   +  D  KE YLN L+AG+S +   ++    ++++  ++     +  E 
Sbjct: 528 AASALANKIVNGSPED--KENYLNYLKAGSSDYSLNVIAKAGVDMTKEDYLNDAFKVFEA 585

Query: 619 MIDDVEKM 626
            ++++E +
Sbjct: 586 RLEELEAL 593


>gi|302670144|ref|YP_003830104.1| oligoendopeptidase PepF1 [Butyrivibrio proteoclasticus B316]
 gi|302394617|gb|ADL33522.1| oligoendopeptidase PepF1 [Butyrivibrio proteoclasticus B316]
          Length = 599

 Score =  186 bits (472), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 154/595 (25%), Positives = 279/595 (46%), Gaps = 21/595 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W LED+Y   D ++   ++  I  E       +EG LA      N   L AA+   E + 
Sbjct: 17  WRLEDIYD--DEKKWEEELARIT-EYADKVAAYEGKLA-----DNSKDLLAALKLDEELG 68

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
             I R+  YA +  + + ++   +       +      +   F + EI  + +  LE  Y
Sbjct: 69  LYIDRVHGYAHMREDQDTANSKYQGMKQRAMSAYMYASEKEAFISPEILAISDDKLESFY 128

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF-KIN 217
            + P   +Y   I  IR++K H+LS +ME LL+   ++   + K +   +   L+F  + 
Sbjct: 129 KETPELDRYKREIAEIRRLKDHMLSAEMEQLLASAGEMQGASQKAYGMLSNADLKFPSVK 188

Query: 218 DQKIPLTKAYKSFF-----DSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           D K    +     F       DR +RK++ +A    + +  + ++ + +   K    + +
Sbjct: 189 DSKGEEVQLSNGRFVPTQMSKDRNLRKASFEAFYGKYEEFKNTWAAMYDGEVKGRIFEAK 248

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
            RKY    ++   SN+V P V ++L +S+ +   K  HRY  L+KK L +D ++ +D   
Sbjct: 249 ARKYNSAFEAAVNSNDVSPKVCDSLFESIHDNMDKM-HRYVTLRKKLLGVDELHMYDVYV 307

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           P+       + ++ A++L L++ A        + ++ + + WID  + +GK  GA++ G 
Sbjct: 308 PMLADYDMKVTYDEAKELSLKALAPLGEDYLDVVKEAYENRWIDVVENEGKRGGAYSSG- 366

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           + +VHPY+LLNY     DV TL HE+GH +H   S++ Q I+  N  + +AE AS   E 
Sbjct: 367 VYNVHPYMLLNYNDTLDDVFTLVHEMGHSMHTWYSNKAQTIIDANYKIFVAEVASTTNEV 426

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           L +  +   ASSKEE+  ++ + ++    ++ RQ  F +FE K      +   +    + 
Sbjct: 427 LLYHYMKDHASSKEEKAFIINHFLDSFKGTMFRQTMFEEFERKTCEMAEAGTPLTAESLY 486

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYD-IYKSN 571
           E++L+  K+  G    +SD + G  W  +PHF   +FYVY YA       ++ D I K  
Sbjct: 487 EVYLDLNKQYFGADM-ISDPQIGWEWCRIPHFY-YNFYVYQYATSFAAAVAIADRILKEG 544

Query: 572 TVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
                 E+Y   L +G ++    LL    ++L+     +  L    + I ++E++
Sbjct: 545 ASAV--EQYKKFLSSGCTQDPVSLLKIAGVDLTTKAPIDAALNVFGEAITEMEEI 597


>gi|304403832|ref|ZP_07385494.1| oligoendopeptidase F [Paenibacillus curdlanolyticus YK9]
 gi|304346810|gb|EFM12642.1| oligoendopeptidase F [Paenibacillus curdlanolyticus YK9]
          Length = 596

 Score =  186 bits (471), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 159/621 (25%), Positives = 279/621 (44%), Gaps = 45/621 (7%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDME-CIEHESLAFKTRWEGNLAHATNQK 82
           MT++  +        W LEDL+      + S D E  +  E +     +EG LA     K
Sbjct: 1   MTSVPKRSETAAEHHWKLEDLF----GDQASWDREYALAKEQIKQAAAYEGKLADPAQLK 56

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA-DFEKVLIF 141
            C  L   ++ +      + R+  YA + ++ + + PT +   +D   KL+ +  + L +
Sbjct: 57  ACFELEDELSLH------VERLYVYANMRHHEDTAEPTYQAL-SDKTKKLSVETGEALSY 109

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              E+ +L +  L+       L L Y   ++ +R+ K H+LS   E LL+    V +   
Sbjct: 110 VTPEVLSLSDEQLDALINNSDLAL-YKKTLEEMRRQKAHVLSKAEEALLAQVGSVTQAPN 168

Query: 202 KRFFCENIESLRF-KINDQK---IPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHI 255
             +   +   L+F K+ +++   I LT+  Y  F +S +R+VR +A KA+  T+ K  + 
Sbjct: 169 TIYSMLSNADLKFPKVKNEQGEEIELTQGRYIQFLESKNRDVRANAFKAMYDTYGKLRNT 228

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
            +   N          R RKY    +     +N+   V   L+ ++  + P   +RY EL
Sbjct: 229 MAATLNANVTKNVFYSRARKYPSALEMSLFGDNIPKEVYTNLIDTIHKHLP-LMYRYMEL 287

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +KK L +D ++ +D  APL    +  I ++ A+  V +S          + ++ F   WI
Sbjct: 288 RKKLLGVDELHMYDLFAPLVDEFKMDITYDQAKTTVKESLKPLGDAYLNVLQEGFDQGWI 347

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  + +GK SGA++ G     HPY+LLN+      + TL HE+GH +H   S  +Q    
Sbjct: 348 DVYENEGKRSGAYSWGAY-GTHPYVLLNHKDNLNSMFTLTHEMGHALHSYYSDSSQNYRD 406

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
              ++ LAE AS   E L  D +L  ++  +E+  LL    +    ++ RQ  F +FE  
Sbjct: 407 AQYTIFLAEVASTLNEALLMDHMLNKSTDPKEKMYLLTYYADQFRTTVFRQTMFAEFEKI 466

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSF----------WMMVPHFI 545
           +H    +   +    +++I+           +DL+ L YG            W  +PHF 
Sbjct: 467 VHERTEAGESLTPQDLSKIY-----------YDLNVLYYGKGMVVDKDIEVEWARIPHFY 515

Query: 546 ESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSD 605
            +SFYVY YA G     S              E+YL  L++G S +   +L    +++S 
Sbjct: 516 -TSFYVYKYATGFSAATSFAKQILDEGAPAV-ERYLGFLKSGGSDYSINILKRAGVDMSS 573

Query: 606 PNFWERGLQTVEKMIDDVEKM 626
           P   E+ +   E++I+ +E++
Sbjct: 574 PEPIEQAMAVFEQLIEQMEQL 594


>gi|293376462|ref|ZP_06622691.1| oligoendopeptidase F [Turicibacter sanguinis PC909]
 gi|292644884|gb|EFF62965.1| oligoendopeptidase F [Turicibacter sanguinis PC909]
          Length = 599

 Score =  186 bits (471), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 159/615 (25%), Positives = 283/615 (46%), Gaps = 28/615 (4%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           S    + S+  +    +W ++ +Y S ++ E   D + ++ ++   K  ++G L + T+ 
Sbjct: 2   SQTMGLKSRNEIEEESKWKIDKVYASTEAWE--KDFQAVKEKAPKLK-EFQGRLGNITDL 58

Query: 82  KNCHSLGAAIAEYERICELIGRIAS----YAMLSYNCNLSSPTIRKFYTDINAKLADFEK 137
           K          EY ++ E + R+      +A +  + + S+   +     I+  +A F  
Sbjct: 59  K----------EYLKVEEELSRVLEKLYVFAHMKSHEDTSNSEFQTLVNKIDPFMAQFSS 108

Query: 138 VLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVG 197
              FF  EI +L++  +E+    D     Y  + K + K K H+LS +ME LL+  S   
Sbjct: 109 YNAFFTPEILSLEDGTIEKMLESDDELKVYDTFFKVLLKEKPHILSKEMEELLASASDCL 168

Query: 198 REALKRFFCENIESLRFKI----NDQKIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNK 251
             +   +       + F      N Q I LT+  Y S   S DR VR+ A K L  T+ K
Sbjct: 169 GASESIYTMLTNADMTFGTIKGENGQDIELTEGNYSSLIKSKDRRVREEAFKLLFSTYKK 228

Query: 252 SSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHR 311
             +  +    +  K      + RKY    ++    N++   V +  +Q++ N   K+ HR
Sbjct: 229 YENTIATSLTSSLKTFIFYAKTRKYASSLEASLKPNDIPVEVYKNAIQTINNNL-KSLHR 287

Query: 312 YYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFT 371
           Y  LKKK L LD ++ +D    +    +  I +  A ++V +       +   I ++   
Sbjct: 288 YVGLKKKLLGLDEIHMYDLYVSVIDIPKQHIEYSDAIEMVKEGLKPLGQEYLDIFDEGIK 347

Query: 372 HNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQ 431
             W+D  +  GK SGA++ G+  ++ PY+LLNY  +  DV TLAHE+GH IH   + + Q
Sbjct: 348 DGWVDVYENKGKKSGAYSWGSYDTM-PYVLLNYNYELNDVSTLAHEMGHSIHSYYTRKEQ 406

Query: 432 GILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYD 491
             +  N +L  AE AS   E L  + L+     K ++  L+  ++E +  ++ RQ+ F +
Sbjct: 407 PYVYGNYTLFCAEVASTTNEILLINDLIHKEQDKNKKLYLINQELEQIRATVYRQLMFAE 466

Query: 492 FELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYV 551
           FEL  H    + G + +  ++ IW +  K+  GP   + D E    W  +PHF  S FYV
Sbjct: 467 FELITHETLENGGSLTSDDLDNIWYDLNKKYFGPEMVVDD-EIKIEWARIPHFY-SDFYV 524

Query: 552 YAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWER 611
           Y YA G    ++       N  +   EKY   L+AG S +  + L    ++++     E 
Sbjct: 525 YQYATGYAAASAFAKSILENG-EVAVEKYKGFLKAGGSLYPIDTLKNAGVDMTTSMPLEA 583

Query: 612 GLQTVEKMIDDVEKM 626
            ++   +++D +E++
Sbjct: 584 TIERFNELLDMLEEL 598


>gi|126654177|ref|ZP_01725984.1| oligoendopeptidase F [Bacillus sp. B14905]
 gi|126589348|gb|EAZ83501.1| oligoendopeptidase F [Bacillus sp. B14905]
          Length = 605

 Score =  185 bits (470), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 160/599 (26%), Positives = 277/599 (46%), Gaps = 28/599 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFK-TRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           W LED++ S    E     E  E   LA K + + G L +        +L AA+  ++ I
Sbjct: 20  WRLEDIFASDALWED----EFKEVAELAKKASSFAGTLNNG-----AQALLAALHYHDHI 70

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKL----ADFEKVLIFFALEINTLDEAL 153
            E   ++ +YA + Y+ +    T   FY D+N+++          L F   EI  L+E  
Sbjct: 71  YERAMKLYTYAHMRYDQD----TTNSFYQDMNSRIQTLATSISAGLSFLTPEILALNEET 126

Query: 154 LEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLR 213
           +E   A++     Y   +K I   + H+L  + E LL+  S+V   A   F   N   L 
Sbjct: 127 IESYLAENQDLQLYKQSLKEITMARPHVLPAEQEALLAQMSEVTGTASNTFSMLNNADLE 186

Query: 214 FKI----NDQKIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAKDE 267
           F      + +++ LT   Y  F +S DR VR+ A KA+  T+ K  + FS       K  
Sbjct: 187 FPYVKNEDGEEVQLTHGNYIKFLESKDRSVREGAFKAMYATYGKFKNTFSSTLTGNVKKH 246

Query: 268 EIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYF 327
            +  R R Y+   ++   +N +   V + L++++  + P    RY  L+KK L +D ++ 
Sbjct: 247 NVSARIRHYDSAREAAMSNNFIPENVYDQLVETIHKHLPAM-QRYISLRKKLLGVDELHM 305

Query: 328 WDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGA 387
           WD  APL    +  + ++ A+D+++++ A    +   I +    + W+D  +  GK SGA
Sbjct: 306 WDLFAPLVKEVEMKVTYDEAKDILVKALAPLGEEYQNIVQNGLDNRWVDVLENKGKRSGA 365

Query: 388 FAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETAS 447
           ++ G     +PYIL+N+     ++ TLAHE GH +H   S   Q  +  + S+ +AE AS
Sbjct: 366 YSSGAY-GTNPYILMNWQDNVNNLFTLAHEFGHSVHSYYSRNNQPFVYGDYSIFVAEVAS 424

Query: 448 IFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIP 507
              E L  D LL+     +++  LL + ++   +++ RQ  F +FE  +H   ++   + 
Sbjct: 425 TCNEELLNDYLLKTIDDPQQKIYLLNHWLDGFRSTVFRQTMFAEFEHLIHQMDKNGESLT 484

Query: 508 THRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDI 567
             R+ E++ E  K+  G    + D E G  W  +PHF  +  YVY YA G     +L   
Sbjct: 485 ADRLTEVYYELNKKYFGDDM-VVDEEIGLEWARIPHFYYNY-YVYQYATGKSAATALSKQ 542

Query: 568 YKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
                    +    N L+AG S    E+L    ++++     E   +  E+ + ++EK+
Sbjct: 543 ILEEGEPAVERYINNFLKAGCSDFPIEVLKAAGVDMNVAKPIEDACKVFEERLIELEKL 601


>gi|323488787|ref|ZP_08094027.1| oligoendopeptidase F [Planococcus donghaensis MPA1U2]
 gi|323397485|gb|EGA90291.1| oligoendopeptidase F [Planococcus donghaensis MPA1U2]
          Length = 602

 Score =  185 bits (470), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 148/588 (25%), Positives = 278/588 (47%), Gaps = 22/588 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTR-WEGNLAHATNQKNCHSLGAAIAEYERI 97
           W LED++ S +  E     E  E  +L+ K   ++G L      ++  +L   +   + +
Sbjct: 17  WKLEDIFESDELWE----KEFAEVSALSNKAESFQGTL-----HESAEALYKGMVYRDEL 67

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQS 157
            E + R+ +Y+ + Y+ + ++   +   + I +  A     L F   EI  ++E++L   
Sbjct: 68  TERLRRLYTYSHMRYDQDTTNSKYQALDSRIKSLFAKVSAGLSFMTPEILAIEESVLNDY 127

Query: 158 YAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF-KI 216
             +      Y   ++ +  ++ H+L  + E LL+  S+V R + + F   N   L F +I
Sbjct: 128 VEKHEGLSLYKQALEELNSMRPHVLPAEQESLLAQMSEVSRASSETFGMLNNADLEFPEI 187

Query: 217 NDQ---KIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
            D+   K+ +T   Y  F +  DR VR+ A KA+  T+ K  + F+   +   K + +  
Sbjct: 188 EDESGEKVQITHGNYIRFLEGKDRRVREDAFKAIYATYGKFRNTFASTLSGNIKKDNVSA 247

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRL 331
           R RK+E    +    +++   V + L+++V N      HRY  L+K+ L LD ++ WD  
Sbjct: 248 RIRKFESARQAALAEDHIPEAVYDNLVETVNNNL-HLLHRYSALRKEVLGLDKVHMWDLH 306

Query: 332 APLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHG 391
            PL    +  +P+E A  ++L        +   I ++   + W+D  +  GK SGA++ G
Sbjct: 307 TPLVKEVKMEMPYEKATGVMLNGLEALGEEYVGIVKEGIDNRWVDVKENKGKRSGAYSSG 366

Query: 392 TIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE 451
                +PYIL+N+     ++ TLAHE GH +H   + + Q  +  + S+ +AE AS   E
Sbjct: 367 AY-GTNPYILMNWQDNVDNLYTLAHEFGHSVHSYYTRKNQPYVYGDYSIFVAEVASTTNE 425

Query: 452 TLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRI 511
            L  + ++++    +ER  LL + ++    ++ RQ  F +FE  +H   +    +   R+
Sbjct: 426 ALLNEYMVKSTDDDQERIYLLNHWLDGFRGTVFRQTMFAEFEHLIHKMDQDGEALTADRL 485

Query: 512 NEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSN 571
            E++ E  ++  GP   +SD E G  W  +PHF   ++YV+ YA G     +L       
Sbjct: 486 TEVYYELNQKYYGPDV-VSDEEIGMEWARIPHFY-YNYYVFQYATGFSAATALSKGILEE 543

Query: 572 TVDCFKEKYLN-ILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
                 ++Y+N  L+AG+S +  E+L    ++++     E      E+
Sbjct: 544 GQPAV-DRYINEFLKAGSSDYPIEVLKKAGVDMTQSKAIEEACMVFEQ 590


>gi|322384218|ref|ZP_08057928.1| oligoendopeptidase F-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321151110|gb|EFX44427.1| oligoendopeptidase F-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 596

 Score =  185 bits (470), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 156/613 (25%), Positives = 287/613 (46%), Gaps = 29/613 (4%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTR-WEGNLAHATNQK 82
           M+ + +++++    +W LEDL+    +     D E  E + L  K   + G L +    K
Sbjct: 1   MSQIPARKDVPEQEKWKLEDLFADQKAW----DKEFNEVKQLLKKVDDFHGKLNNDNAIK 56

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
            C  L       ++I     R+  YA + ++ + + PT +           +  + L F 
Sbjct: 57  QCFELE------DKISLHTERLYVYAKMKHDEDAADPTYQALSEKARKLSVEVNQALSFI 110

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
           + EI +L E  L    +   L+L Y   ++ + + K H+LS   E LL+ T  +   A  
Sbjct: 111 SPEILSLSEDQLRSFISHPDLSL-YKRTLEELLREKPHVLSKSEETLLAMTGNMAGSASN 169

Query: 203 RFFCENIESLRF-KINDQK---IPLTK-AYKSFFDS-DREVRKSAAKALSHTFNKSSHIF 256
            F   N   ++F KI ++K   + LT  +Y  F ++ DREVRK A +A+  T+    +  
Sbjct: 170 IFGMINNVDIQFPKIKNEKGEEVQLTHGSYIQFLENPDREVRKRAFQAVYETYRNQRNTI 229

Query: 257 SFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELK 316
           +   +          R RKY  + +    ++N++P V   L+ ++ +  P   HRY++L+
Sbjct: 230 AATLSANVNKNIFYARARKYPSVLEMSLHADNIDPSVYTNLISTIHDSLP-VLHRYFKLR 288

Query: 317 KKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWID 376
           KK LK+D ++ +D  APL    +  I ++ A++ ++++      +   I ++ F + WID
Sbjct: 289 KKLLKVDELHMYDLFAPLVEEFKMDITYKQAQEKIIEALRPLGGKYIDILKEGFENRWID 348

Query: 377 APQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTN 436
             +   K SGA++ G     HPY+LLN+      + TLAHE+GH +H  LS   Q     
Sbjct: 349 VHENKNKRSGAYSWGAY-GTHPYVLLNHKDNLNSMFTLAHEMGHAMHSYLSDANQEYRNA 407

Query: 437 NSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKL 496
             ++ LAE AS   E L  D +L+  +  +E+  LL    +    ++ RQ  F +FE  +
Sbjct: 408 QYTIFLAEVASTLNEALLMDYMLKHTTDPKEKLYLLTYYADQFRTTVFRQTMFAEFEKIV 467

Query: 497 HTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAF 556
           H +      +     ++++ +  K   G    + D +    W  +PHF  +SFYVY YA 
Sbjct: 468 HEKAEKGESLTPQEFSKVYYDLNKLYHGNDM-VVDQDIEMEWARIPHFY-NSFYVYKYAT 525

Query: 557 GNCLVNSLYDIYKSNTVDCFK---EKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           G     S    + S  ++  +   E+YL  L++G S     +L    +++S P   ++ +
Sbjct: 526 GFSAATS----FASQILEKGEPAVERYLGFLKSGGSDFSINILKKAGVDMSSPEPIKQSM 581

Query: 614 QTVEKMIDDVEKM 626
              + +++ +E++
Sbjct: 582 DVFKSVVEQMEQL 594


>gi|311029794|ref|ZP_07707884.1| oligoendopeptidase F [Bacillus sp. m3-13]
          Length = 604

 Score =  185 bits (470), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 157/584 (26%), Positives = 276/584 (47%), Gaps = 37/584 (6%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTR-WEGNLAHATNQKNCHSLGAAIAEYERI 97
           W LED++ S ++ E     E  + + +  K + +EG L+ + +     SL  A+   + I
Sbjct: 22  WRLEDIFSSDEAWE----KEFQDVKGMIGKIKDYEGKLSESAD-----SLFEALQYQDSI 72

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADF----EKVLIFFALEINTLDEAL 153
              +G++ +YA + Y+ +    T   FY  +N +  +        L F   EI T+ E  
Sbjct: 73  SSRLGKLYTYAHMRYDQD----TTNSFYQGLNDRATNLYTQVASALSFVVPEILTMKEED 128

Query: 154 LEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLR 213
           + +   ++     Y   +  I + + H+LS   E LL++ S+V   +   F   N   + 
Sbjct: 129 ITKFLQENKELALYEHSLDEINRQRPHVLSAKEEALLAEASEVLSASSNTFGMLNNADIT 188

Query: 214 FKI----NDQKIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAKDE 267
           F      N ++I +T   Y  F +S D+EVRK+A KA+  T+    + FS       K +
Sbjct: 189 FPSVKDENGEEIEITHGRYIRFLESEDQEVRKNAFKAVYETYGGYRNTFSSTLGGAVKKD 248

Query: 268 EIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSV-KNYYPKTSHRYYELKKKWLKLDTMY 326
             Q + R Y+    +   +NN+   V + L+ ++ KN +    HRY +L+KK L ++ ++
Sbjct: 249 NFQAKVRNYDSARQAALSNNNIPETVYDNLVNTINKNLH--LLHRYVDLRKKVLGVEELH 306

Query: 327 FWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSG 386
            +D   PL   +   + +E A+D +L+  A    +   I ++ F + W+D  +  GK SG
Sbjct: 307 MYDLYTPLIKEANMKVSYEEAKDYLLKGLAPLGQEYLDIVKEGFDNRWVDVQENKGKRSG 366

Query: 387 AFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETA 446
           A++ GT    +PYIL+N+     ++ TLAHE GH +H   + +TQ     N S+ +AE A
Sbjct: 367 AYSSGTY-GTNPYILMNWQDNVNNLFTLAHEFGHSVHSYYTRKTQPYPYGNYSIFVAEVA 425

Query: 447 SIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDI 506
           S   E L  D LL+     ++R  LL + +E    ++ RQ  F +FE K+H   ++   +
Sbjct: 426 STCNEALLNDYLLKTVDDDKKRLYLLNHYLEGFRGTVFRQTMFAEFEHKIHELAQNGEAL 485

Query: 507 PTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHF---IESSFYVYAYAFGNCLVNS 563
               + E + E  K+  G    + D E G  W  +PHF        Y   Y+    L   
Sbjct: 486 TADLLTETYYELNKKYFGENITI-DEEIGLEWARIPHFYYNYYVYQYATGYSAATALSKQ 544

Query: 564 LYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPN 607
           + +  +   VD    +YL  L+AG+S +  E+L    ++++  N
Sbjct: 545 ILEEGQP-AVD----RYLEFLKAGSSDYPIEVLKKAGVDMTQSN 583


>gi|317129600|ref|YP_004095882.1| oligoendopeptidase F [Bacillus cellulosilyticus DSM 2522]
 gi|315474548|gb|ADU31151.1| oligoendopeptidase F [Bacillus cellulosilyticus DSM 2522]
          Length = 604

 Score =  185 bits (470), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 160/594 (26%), Positives = 278/594 (46%), Gaps = 28/594 (4%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           ++ T++  ++ +     W+LED+Y ++D  E   D   ++ E L     ++G L  + + 
Sbjct: 2   ANTTSLPKRDEIPKELTWDLEDIYATNDDWE--KDFSQVK-EMLPKLKEFKGKLGESAD- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAK----LADFEK 137
               SL   +   + +  L+G++ +YA + Y+ +    T   FY  +N +    L+    
Sbjct: 58  ----SLYDLLKYQDEVSILLGKLYTYAHMRYDQD----TTNSFYQGLNDRASQLLSQVSN 109

Query: 138 VLIFFALEINTLDEALLEQSY-AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQV 196
              F   E+ ++ E  + Q    +D L L Y   ++ I + + H+LS   E +L+  S+V
Sbjct: 110 AASFVTPELLSIPEEKINQFLDEKDELKL-YKHALEKINRQRPHVLSEKEESILAQVSEV 168

Query: 197 GREALKRFFCENIESLRF-KINDQK---IPLTKA-YKSFFDSD-REVRKSAAKALSHTFN 250
              +   F   N   ++F  + D++   I +T   Y  F +SD + VR  A KA+  T+ 
Sbjct: 169 TDSSSNTFGMLNNADMKFPSVKDEEGNEIEITHGRYIRFLESDDQRVRSDAFKAVYDTYG 228

Query: 251 KSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSH 310
           K  + F+   +   K        R YE  A    LS N  P V+   + S  N +    H
Sbjct: 229 KFKNTFASTISGNVKRNIFNANVRNYES-ARQAALSKNDIPEVVYDQLVSTVNDHLHLLH 287

Query: 311 RYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFF 370
           RY +L+KK L +D ++ +D   PL       IP+E A+DLV +  A    +   I E+ F
Sbjct: 288 RYVKLRKKVLGVDELHMYDLYTPLVKEVDMKIPYEEAKDLVTKGVAPLGEEYVSIVEEGF 347

Query: 371 THNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSET 430
            + W+D  +  GK SGA++ G   ++ PYIL+N+     ++ TLAHE GH +H   + + 
Sbjct: 348 NNRWVDVEENVGKRSGAYSSGAYGTM-PYILMNWQDNVNNLFTLAHEFGHSVHSYYTRKH 406

Query: 431 QGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFY 490
           Q     N S+ +AE AS   E L  D LL+    K++R  LL + +E    ++ RQ  F 
Sbjct: 407 QPYPYANYSIFVAEVASTCNEALLNDYLLKVTDDKQKRLYLLNHFLEGFRGTVFRQTMFA 466

Query: 491 DFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFY 550
           +FE  +H +  +   +    ++ ++ +  K+  G    + D E    W  +PHF   +FY
Sbjct: 467 EFEKLMHEKAANGEPLTPDLLSSMYYDLNKKYFGDDIVIDD-EIALEWARIPHFY-YNFY 524

Query: 551 VYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLS 604
           VY YA G     +L            +    + L+AGNS +  E+L    ++++
Sbjct: 525 VYQYATGYSAATALAKQILDEGEPAVQRYIDHFLKAGNSDYPIEVLKKAGVDMT 578


>gi|223982798|ref|ZP_03633024.1| hypothetical protein HOLDEFILI_00298 [Holdemania filiformis DSM
           12042]
 gi|223965245|gb|EEF69531.1| hypothetical protein HOLDEFILI_00298 [Holdemania filiformis DSM
           12042]
          Length = 584

 Score =  185 bits (469), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 152/591 (25%), Positives = 260/591 (43%), Gaps = 18/591 (3%)

Query: 36  LPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS-LGAAIAEY 94
           +  WNL DLY  +DS+    D   ++    A        LA +  Q++ HS L A I + 
Sbjct: 1   MKEWNLNDLYTGYDSEAFQQDFAALDTHINAMNA-----LAESLGQRDPHSTLKAIIEQL 55

Query: 95  ERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALL 154
                L  R+ +Y  L  + N +        +    K +        F   I   D   L
Sbjct: 56  SAYQTLTRRLGAYLSLRQSANTADQQTVSMNSRFQIKTSQSALASTRFQKWIAAQD---L 112

Query: 155 EQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF 214
           +     DPL  +++ W++ IR    H LS+++E  +      G  A  +       ++  
Sbjct: 113 DALIPGDPLFQQHAFWLQEIRSHAAHTLSDEVEDAIGKMELNGSNAWAQLQEYMTSTVAV 172

Query: 215 KINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWR 274
            ++ Q   L+      + +D  VRK A +A    ++K      F  N++  +       R
Sbjct: 173 TMDGQDYTLSSIRNLAYSTDPTVRKKAYEAELKAYDKIKDAVCFALNSIKGEANTVSELR 232

Query: 275 KYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLK-LDTMYFWDRLAP 333
            ++ + D    ++ +    ++A+  ++    P+  H Y   K + L   D + F++  A 
Sbjct: 233 HFDSVLDMTLFNSRMRKETLDAMFTAIDEALPRF-HAYLRHKAELLGYTDGLPFYELFA- 290

Query: 334 LPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTI 393
           L G S      + A+  ++Q++  FS  ++ I E+ F   WID     GK  GAF     
Sbjct: 291 LMGKSTRTFTTDEAKAYLIQNFTPFSKDVAGIIERAFDEEWIDFFPRKGKVGGAFCCNLP 350

Query: 394 PSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETL 453
                 +L N+ G   DV+TLAHELGH  H     E    L    S+ +AETAS F ET+
Sbjct: 351 MLKQSRVLTNFDGSLSDVVTLAHELGHAYH-GHRIENHSPLNTRYSMPVAETASTFNETV 409

Query: 454 TFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINE 513
             ++ ++ A+S EE+ +L+ + ++D+   I    S Y FE ++  E+R  G + +  + +
Sbjct: 410 IMNAAIRDAASDEEKMMLIESTLQDVTQVICDIYSRYLFETEV-VEKRKDGFLFSDDLED 468

Query: 514 IWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESS--FYVYAYAFGNCLVNSLYDIYKSN 571
           I L  QK++ G   D + L +   W+   H+ ++   FY + YAFG      LY  Y+  
Sbjct: 469 IMLRAQKKAYGTGLDHNQL-HPYMWICKSHYYDAGLNFYNFPYAFGCLFAKGLYAQYQKE 527

Query: 572 TVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
               F +KY  +L A       ++     I+++ P+FW   L  VE MID+
Sbjct: 528 G-PAFVDKYNRLLEATTVSSVEDVAAMAGIDITQPDFWRDSLAIVETMIDE 577


>gi|226312111|ref|YP_002772005.1| oligopeptidase F [Brevibacillus brevis NBRC 100599]
 gi|226095059|dbj|BAH43501.1| oligopeptidase F [Brevibacillus brevis NBRC 100599]
          Length = 605

 Score =  185 bits (469), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 154/582 (26%), Positives = 274/582 (47%), Gaps = 31/582 (5%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEH--ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYE 95
           +W LED+YP+ +  E   D++ ++   E +A     +G+LA +  Q     L A +   +
Sbjct: 21  KWRLEDMYPTDNDWEA--DVQKVKQLTEKIA---AMKGSLATSGKQ-----LLAVLTLQD 70

Query: 96  RICELIGRIASYAMLSY---NCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
            + + + ++  YA +     N N     +    T ++ ++      +    L I+T D  
Sbjct: 71  ELLKTLDQVYVYARMRRDEDNANSQYQGLTDRATSLSTQVYGSISYIQPEILAISTEDL- 129

Query: 153 LLEQSYAQDPLTLK-YSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIES 211
              Q++ ++   L+ Y   +  I + K H LS + E LL++ S++     K F   N   
Sbjct: 130 ---QTWIKEVEGLEHYRILLDEITRFKPHTLSAEEEALLANMSELASSPSKIFGMLNNAD 186

Query: 212 LRFKI----NDQKIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAK 265
           ++F +    + +++ LTK  Y  F +S DR VRK A +AL  T+ K  +  +    +  K
Sbjct: 187 MKFPMITDESGEEVELTKGRYTQFMESKDRRVRKKAFEALYSTYGKFRNTIAASLTSAIK 246

Query: 266 DEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTM 325
            +    R RKY     +   ++NVE  V + L+ ++  + P   HRY  L+KK L LD +
Sbjct: 247 GDVFYARTRKYPSALYAALFADNVELPVYDNLIATIHEHLP-LMHRYIALRKKLLGLDEL 305

Query: 326 YFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGS 385
           + +D   P+   +   IP++ A   + ++      +   I ++ F++ WID  + +GK S
Sbjct: 306 HMYDLYVPIVPETDMKIPYDQAVSTIKEALHPLGEEYGRILDEGFSNGWIDVHENEGKTS 365

Query: 386 GAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAET 445
           GA++ G   S HP++L+NY     ++ TLAHE+GH +H   S+  Q     +  + +AE 
Sbjct: 366 GAYSWGAYTS-HPFVLMNYQDNVNNMFTLAHEMGHALHSYYSNHAQPYTYADYKIFVAEV 424

Query: 446 ASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGD 505
           AS   E L  + LL+  + K++R  L+ + +E    ++ RQ  F +FE  +H +      
Sbjct: 425 ASTLNEALLMNHLLETTTDKKQRMYLINHYLEQFRGTVFRQTMFAEFEKIVHAKEEQGEP 484

Query: 506 IPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLY 565
           +    ++ I+ E      GP   + D E    W  +PHF    FYVY YA G     SL 
Sbjct: 485 LTAESLSTIYRELNVAYHGPDM-VVDSEVDLEWARIPHFYR-GFYVYKYATGFSAATSLS 542

Query: 566 DIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPN 607
                       ++YL  L+ G+S +   LL    ++++ P 
Sbjct: 543 KQILEEGQPAV-DRYLQFLKGGSSDYPLNLLKGAGVDMTSPT 583


>gi|312127387|ref|YP_003992261.1| oligoendopeptidase f [Caldicellulosiruptor hydrothermalis 108]
 gi|311777406|gb|ADQ06892.1| oligoendopeptidase F [Caldicellulosiruptor hydrothermalis 108]
          Length = 626

 Score =  184 bits (468), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 159/597 (26%), Positives = 278/597 (46%), Gaps = 27/597 (4%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           +WNLED+Y S   ++ + D+  + +  +     ++G L+       C  L       + +
Sbjct: 42  KWNLEDIYSS--PEKWNADLNKVLNYYIPKFKNYKGKLSDKNKLLECLKLR------DEM 93

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQS 157
             +  ++  YA +  + N +   + +  +      A     + F   E+  L E  L +S
Sbjct: 94  MRIADKVYVYAHMKADENQADNKVSEMRSKSETMYAQVSAAVSFIQPELLRLPEKTL-KS 152

Query: 158 YAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF-KI 216
           Y QD     Y  ++  + K K H LS + E LL+            F       L F KI
Sbjct: 153 YMQDKSFADYKMYLDAVLKQKPHTLSPEGEELLALAQDFAGSPYNIFTQLKYADLTFPKI 212

Query: 217 NDQK---IPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
            D K   I LT+A Y  + ++ DR+ RK A + +  +F+K  +  +       K      
Sbjct: 213 KDDKGNEIQLTEASYGKYLENKDRDFRKRAFEGIYSSFDKVKNTLAATLTAEVKKNVFFA 272

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRL 331
           + RKY    ++      +   V + L+++V N   K  H+Y EL+KK L LD ++ +D  
Sbjct: 273 KARKYNSALEASLAQEFIPRSVYDNLIKAVNNNI-KYLHKYVELRKKVLNLDKVHIYDMY 331

Query: 332 APLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHG 391
            PL    +  I +E A+ L+L+           +    F + WID  + + K +G +  G
Sbjct: 332 VPLVANYEMNIDYEQAKKLILEGLKPLGNDYLKVLNIAFNNRWIDVFETENKYTGGYQWG 391

Query: 392 TIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE 451
              + HPYIL+NY      V+TLAHELGH I+   +++TQ  + +N  +  AE AS   E
Sbjct: 392 AYDT-HPYILMNYNNTMDSVLTLAHELGHAINSYYTNKTQKYINSNVPIFTAEVASTTNE 450

Query: 452 TLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGD-IPTHR 510
            L  + LL+ A S +ER  LL   +E++  ++  Q+ + +FE ++H ER   G+ +    
Sbjct: 451 LLMINYLLKKAKSDDERLYLLNTLVENIRGTVYTQVMYAEFEKEIH-ERVEKGEALSAET 509

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLY-DIYK 569
           ++ IW    K+  G +F++  L    +W  +PHF   +FYVY YA      N +  +I K
Sbjct: 510 LSNIWGNLMKKYYGDSFEVDKLA-TLWWARIPHFY-MNFYVYKYATSMAAANEVVKNIEK 567

Query: 570 SNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            +T      KY+  L+AG+S +   +L    ++++     +  L    +++D++EK+
Sbjct: 568 GDTA-----KYIEFLKAGSSDYPINVLKKAGVDMTSTKPVDNLLTYFGQLVDEMEKI 619


>gi|110802842|ref|YP_698758.1| oligoendopeptidase F [Clostridium perfringens SM101]
 gi|110683343|gb|ABG86713.1| oligoendopeptidase F [Clostridium perfringens SM101]
          Length = 599

 Score =  184 bits (468), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 156/613 (25%), Positives = 292/613 (47%), Gaps = 24/613 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLY--PSHDSQEISNDMECIEHESLAFKTRWEGNLAHAT 79
           S++  +  ++ +    +W ++ +Y  P+  ++E+S     ++ E+   K  +EG L    
Sbjct: 2   SEVKKLRRRDEIPESDKWRIDKIYETPAKWNEELSK----LKEEAPKLKD-FEGKLG--- 53

Query: 80  NQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVL 139
              N   L A +   E++   +G++  YA +  + + S+P ++     I+   A+F    
Sbjct: 54  ---NKEDLKAFLLLNEKLSRKLGKLYVYAHMRSHEDTSNPEMQSLVNKIDPYSAEFSSYT 110

Query: 140 IFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQV--G 197
            +F  EI +L E  +E    +D    +Y  + + I   K H+LS ++E +L+  S     
Sbjct: 111 AYFVPEILSLKEGTIENFINEDKDLEQYKIYFEMILNEKPHILSKEVESVLASVSDCLGA 170

Query: 198 REALKRFFCENIESLRFKIND--QKIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSS 253
            E++   F  +  +    +++  +K+ LT+  Y SF  S DR+VR++A K L  T+ K  
Sbjct: 171 PESIYSMFTNSDMTFGEIVDESGRKVELTEGNYSSFIKSKDRKVREAAFKLLFGTYKKYE 230

Query: 254 HIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY 313
           +  +    +  K+   + + RKY    ++    NN+   V    +++V        HRY 
Sbjct: 231 NTLATSLTSSIKNFVFESKTRKYNSSLEASLKPNNIPVEVYYNALKTVDENMDAL-HRYV 289

Query: 314 ELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHN 373
            +KKK L LD ++ +D   P+    ++ + ++ A  LV +       +   I  +     
Sbjct: 290 RIKKKLLNLDEIHMYDLYVPVIECKKEHLEYKDAISLVEEGLKPLGKEYLDIFNEGINEG 349

Query: 374 WIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGI 433
           WID  +  GK SGA++ G+  ++ PY+LLNY  +  D  TLAHE+GH IH   + +TQ  
Sbjct: 350 WIDVYENKGKRSGAYSWGSYDTM-PYVLLNYNYELNDASTLAHEMGHSIHSYYTRKTQPY 408

Query: 434 LTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFE 493
           +  + SL  AE AS   E L    L++  + K ++  L+  ++E +  ++ RQ+ F +FE
Sbjct: 409 IYGDYSLFCAEVASTTNEILLIHHLIEKETDKNKKLYLINQELEQIRTTVFRQLMFAEFE 468

Query: 494 LKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYA 553
           LK H    +   + +  + ++W +   +  G    + D E    W  +PHF  S FYVY 
Sbjct: 469 LKTHEAIENGESLTSEVLCKMWKDINIKYFGEDMKV-DEEISIEWARIPHFY-SDFYVYQ 526

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YA G    +S  +   S   +   EKY   L+AG S +  + L    ++++     +  L
Sbjct: 527 YATGYAAASSFANSILSKGEEAV-EKYKGFLKAGGSMYPIDTLKMAGVDMTTSKPLKDTL 585

Query: 614 QTVEKMIDDVEKM 626
               +++D +E++
Sbjct: 586 DRFNELLDMLEEI 598


>gi|60545050|gb|AAQ08885.2| oligopeptidase F [Bacillus amyloliquefaciens]
          Length = 684

 Score =  184 bits (468), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 168/642 (26%), Positives = 296/642 (46%), Gaps = 49/642 (7%)

Query: 11  SNAFFR-KALRSSDMTTMDSQENLGNLP---------RWNLEDLYPSHDS--QEISNDME 58
           +N FF    ++ +   TM  +     LP          W LED++PS ++  +E     E
Sbjct: 59  NNRFFNWLEVKKTRGITMTEENKAAQLPDRSEVKAEHTWRLEDIFPSDEAWNKEFQAVKE 118

Query: 59  CIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSS 118
            I + S +FK    G LAH+ +     +L AA+   + +   +G++ +YA +  + +   
Sbjct: 119 LIPNLS-SFK----GTLAHSAD-----NLYAALTAQDEVTNRLGKLYAYAHMRSDQD--- 165

Query: 119 PTIRKFYTDINAKLADF----EKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNI 174
            T   FY  +N K A           +   EI  + E  L Q   +      YS  I+ I
Sbjct: 166 -TGNSFYQGLNDKAASLYSQAASATAYIEPEILAIQEDKLHQFILEKEELKLYSHAIEEI 224

Query: 175 RKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF-KINDQKIPLTKAYKSFF-- 231
            K + H+LS   E LL++ S+        F   N   + F  I D+    T+     F  
Sbjct: 225 TKQRPHVLSEQEEALLAEASEALSSPSNTFSVLNNADITFPSIKDENGKETQITHGNFIN 284

Query: 232 ---DSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNN 288
               S+REVRK+A +A+  T+ +  +  +   +   K +    R +KY K A    LSNN
Sbjct: 285 FLESSNREVRKNAFEAVYKTYGQYKNTMATTLSGTVKKDNFYARVKKY-KSAREAALSNN 343

Query: 289 VEPY-VIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVA 347
             P  V + L++++  + P   HRY +L+KK L LD ++ +D   PL   S   + +E A
Sbjct: 344 SIPEEVYDNLIKTINKHLP-LLHRYIDLRKKVLGLDEVHIYDLYTPLVKDSGMKVTYEEA 402

Query: 348 RDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGK 407
           +D +L+  A    + + I ++   + W+D  +  GK SGA++ GT    +PYIL+N+   
Sbjct: 403 KDYMLKGLAPLGEEYASILKEGLENRWVDIYENKGKRSGAYSSGTY-GTNPYILMNWHDN 461

Query: 408 PQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEE 467
             ++ TL HE GH +H   + + Q     N S+ +AE AS   E L  + +L +   +++
Sbjct: 462 VNNLFTLVHEFGHSVHSYYTRKYQPYPYGNYSIFVAEVASTTNEALLGEYMLNSLKDEKQ 521

Query: 468 RKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAF 527
           R  LL + +E    ++ RQ  F +FE  +HT+ +    +    +NE++ +  K+  G   
Sbjct: 522 RLYLLNHMLEGFRGTVFRQTMFAEFEHLIHTKAQEGEPLTPELLNELYYDLNKKYFGDNM 581

Query: 528 DLSDLEYGSFWMMVPHF---IESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNIL 584
            + D E    W  +PHF        Y   Y+    L + +    K        E+Y   L
Sbjct: 582 VI-DKEISLEWSRIPHFYYNYYVYQYATGYSAAQALSSQILKEGKPAV-----ERYTEFL 635

Query: 585 RAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           +AG+S++  ++L    ++++ P   E   +  E+ ++++E++
Sbjct: 636 KAGSSEYPIDILKKAGVDMTSPEPIEAACKMFEEKLNEMEEL 677


>gi|331701044|ref|YP_004398003.1| oligoendopeptidase F [Lactobacillus buchneri NRRL B-30929]
 gi|329128387|gb|AEB72940.1| oligoendopeptidase F [Lactobacillus buchneri NRRL B-30929]
          Length = 603

 Score =  184 bits (467), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 149/596 (25%), Positives = 268/596 (44%), Gaps = 22/596 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L  +YP+   QE   D E ++  +  F       LA  T +K+  +L  A      + 
Sbjct: 19  WDLTTIYPT--DQEFETDYEAVQTGAKQF-----AELA-GTIEKSAAALLTATERLMTLS 70

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
             + ++  YA L  + + S    +  Y+   +  A F     +F  E+  + +  ++Q Y
Sbjct: 71  RKLEKVYVYAQLKNDQDTSEDKYQAMYSRAESLGAQFGAATAWFEPELLKVSDDQIKQFY 130

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI-- 216
              P    Y  +     K + H+LSND+E +L+    +     K F   +   L F    
Sbjct: 131 QDQPKLADYRRFFDQTFKRRNHILSNDVEAVLAGAGDIFSSGEKTFGILDNTDLSFPAVT 190

Query: 217 --NDQKIPLTKA-YKSFFDSDRE-VRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
             N  ++ L++  Y    +S ++ VRK A + L   + +  H  +    T  K+   +  
Sbjct: 191 DENGNQVKLSQGVYGILLESTKQSVRKEAFEKLYQVYRQFQHTLAATLTTNVKNHNFKAN 250

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
            R Y    ++    N V   V   L++ V N +    HRY  L+KK L LD ++ +D   
Sbjct: 251 IRHYNNALEAALADNEVPTDVYNNLIKVV-NEHLDLLHRYVALRKKILGLDELHMYDMYT 309

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
            L G       FE ++ + L++     P      ++ F + WID  +   K SG ++ GT
Sbjct: 310 SLVGKKSPKYTFEQSKQIALEALQVMGPDYVSHVKEEFNNRWIDVVENQFKRSGGYSSGT 369

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
             + +PYILLN+     ++ TL HE GH +H   S   Q     + S+ +AE AS   E 
Sbjct: 370 YDT-NPYILLNWKDNLDNLYTLIHETGHSMHSYYSHHNQPYQYGDYSIFVAEIASTTNEN 428

Query: 453 LTFDSLLQAASSKEE-RKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRI 511
           +  D LL      +E +K +L   ++    ++ RQ  F +FE  +H +      +  + +
Sbjct: 429 ILTDYLLNKFKDDDEMKKFILNYYLDGFKGTVFRQTQFAEFEQYIHEQDAKGQPLTANFM 488

Query: 512 NEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYD-IYKS 570
           ++ +    ++  G A  +SD + G  W  +PHF   +FYVY Y+ G    ++L D I   
Sbjct: 489 DDYYRNLNQKYYGDAV-ISDPQIGLEWSRIPHFY-YNFYVYQYSTGFAAASTLADGIVNG 546

Query: 571 NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              +   +KYLN L++G+S   + ++    ++++ P + E+  Q  E+ +D+ E++
Sbjct: 547 GQANV--DKYLNYLKSGSSDTPTNVMKKAGVDMTQPEYLEKAFQIFEQRLDEFERL 600


>gi|169826800|ref|YP_001696958.1| oligoendopeptidase F [Lysinibacillus sphaericus C3-41]
 gi|168991288|gb|ACA38828.1| oligoendopeptidase F [Lysinibacillus sphaericus C3-41]
          Length = 605

 Score =  184 bits (467), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 142/517 (27%), Positives = 242/517 (46%), Gaps = 27/517 (5%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFK-TRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           W LED++ S    E     E  E   LA K + + G L +        +L AA+  ++ I
Sbjct: 20  WRLEDIFASDALWE----EEFKEVAELAKKASSFAGTLNNG-----AQALLAALQYHDHI 70

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKL----ADFEKVLIFFALEINTLDEAL 153
            E   ++ +YA + Y+ +    T   FY D+N+++          L F   EI  L+E  
Sbjct: 71  YERAMKLYTYAHMRYDQD----TTNSFYQDMNSRIQTLATSISAGLSFLTPEILALNEET 126

Query: 154 LEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLR 213
           +E   A+      Y   +K I   + H+L  + E LL+  S+V   A   F   N   L 
Sbjct: 127 IESYLAESQDLQLYKQSLKEITMARPHVLPAEQEALLAQMSEVTGTASNTFSMLNNADLE 186

Query: 214 FKI----NDQKIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAKDE 267
           F        +++ LT   Y  F +S DR VR+ A KA+  T+ K  + FS       K  
Sbjct: 187 FPFVKNEEGEEVQLTHGNYIKFLESKDRSVREGAFKAMYETYGKFKNTFSSTLTGNVKKH 246

Query: 268 EIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYF 327
            +  R R Y+   ++   +N +   V + L++++  + P    RY  L+KK L +D ++ 
Sbjct: 247 NVSARIRHYDSAREAAMSNNFIPENVYDQLVETIHKHLPAM-QRYISLRKKLLGVDELHM 305

Query: 328 WDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGA 387
           WD  APL    +  + ++ A+D+++++ A    +   I +    + W+D  +  GK SGA
Sbjct: 306 WDLFAPLVKEVEMKVTYDEAKDILVKALAPLGEEYQNIVQNGLDNRWVDVLENKGKRSGA 365

Query: 388 FAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETAS 447
           ++ G     +PYIL+N+     ++ TLAHE GH +H   S   Q  +  + S+ +AE AS
Sbjct: 366 YSSGAY-GTNPYILMNWQDNVNNLFTLAHEFGHSVHSYYSRNNQPFVYGDYSIFVAEVAS 424

Query: 448 IFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIP 507
              E L  D LL+     +++  LL + ++   +++ RQ  F +FE  +H   ++   + 
Sbjct: 425 TCNEELLNDYLLKTIDDPQQKIYLLNHWLDGFRSTVFRQTMFAEFEHLIHQMDKNGESLT 484

Query: 508 THRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHF 544
             R+ E++ E  K+  G    + D E G  W  +PHF
Sbjct: 485 ADRLTEVYYELNKKYFGDDMAV-DEEIGLEWARIPHF 520


>gi|288553402|ref|YP_003425337.1| peptidase [Bacillus pseudofirmus OF4]
 gi|288544562|gb|ADC48445.1| peptidase [Bacillus pseudofirmus OF4]
          Length = 600

 Score =  184 bits (467), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 142/565 (25%), Positives = 277/565 (49%), Gaps = 18/565 (3%)

Query: 69  TRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDI 128
           T ++G L  + +     SL  A+ + + I E + R+ +YA +  + + ++   +  +   
Sbjct: 44  TAYKGKLGESAD-----SLYEALQKQDEISERLNRLYTYAHMRNDEDTTNSLYQGLHDRA 98

Query: 129 NAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMEC 188
            +  A   + + +   E+  LDE +++Q   +     +Y   ++ + K K H+LS   E 
Sbjct: 99  MSLSAQVAQSVAYLTPELLELDEKIIKQFINEHEGLNRYEHMLEELYKEKPHVLSEAEEA 158

Query: 189 LLSDTSQVGREALKRFFCENIESLRFKI----NDQKIPLTKA-YKSFFDS-DREVRKSAA 242
           +L+  S+  +   + F   N   L F      + + + +T   + S  +S DR+VR++A 
Sbjct: 159 ILAQASEALQSPGQTFGMLNNADLTFPTIKDEDGEDVEITHGRFISLLESKDRKVRENAF 218

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSV- 301
           KA+ +T+ +  + F+   +   K +      RKY    ++    N++   V + L++++ 
Sbjct: 219 KAVYNTYGQFKNTFAQTLSGQVKKDLFFANVRKYRSAREAALSQNHIPEVVYDQLVETIN 278

Query: 302 KNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQ 361
           KN +    HRY +L+KK L ++ ++ +D   PL   S+  + +E A+DLV+Q       +
Sbjct: 279 KNIH--LLHRYVKLRKKVLGVEELHMYDLYTPLVEGSKVKVSYEEAKDLVIQGVEPLGEE 336

Query: 362 MSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHG 421
              + ++ FT  W+D  +  GK SGA++ G   ++ PYIL+N+     ++ TLAHE GH 
Sbjct: 337 YVNVLKEGFTKRWVDVEETVGKRSGAYSSGAYGTM-PYILMNWQDNIDNLFTLAHEFGHS 395

Query: 422 IHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLN 481
           +H   + + Q  +  + ++ +AE AS   E+L  D L++  + K+++  LL + +E    
Sbjct: 396 MHSYYTRKHQPYVYGDYTIFVAEVASTLNESLLNDYLVKTTTDKQQKLYLLNHFLEGFRG 455

Query: 482 SIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMV 541
           ++ RQ  F +FE K+H        +    +   + E  K+  G    + D E G  W  +
Sbjct: 456 TVFRQTMFAEFEQKIHELSADGEALTPELLTTTYYELNKKYFGEEM-VVDEEIGLEWARI 514

Query: 542 PHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNI 601
           PHF   +FYVY YA G     +L             ++YL+ L+AG+S    E+L    +
Sbjct: 515 PHFY-YNFYVYQYATGYSAAAALSKQILEEGEPAV-DRYLSFLKAGSSNFPIEVLKEAGV 572

Query: 602 NLSDPNFWERGLQTVEKMIDDVEKM 626
           +++     E  L+  E+ +D++E++
Sbjct: 573 DMTSKEPIEEALRLFEETLDEMERL 597


>gi|160881423|ref|YP_001560391.1| pepF/M3 family oligoendopeptidase [Clostridium phytofermentans
           ISDg]
 gi|160430089|gb|ABX43652.1| oligoendopeptidase, pepF/M3 family [Clostridium phytofermentans
           ISDg]
          Length = 582

 Score =  184 bits (467), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 155/594 (26%), Positives = 273/594 (45%), Gaps = 23/594 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L+ LY  +D +    DM+  +  S+         L +   ++  + +   + E  R+ 
Sbjct: 5   WSLDALYTGYDDENFKEDMKQFDLMSVKMDN-LSKELDNLPEKQALNQIFDCLEEAFRLE 63

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
            L    A+Y  L  + N        +   IN K ++  K    F   I  +D+  ++   
Sbjct: 64  HL----AAYCSLRQSTNTQETEATSYLGQINQKSSNLAKANTIFMKYIAKIDD--IDALI 117

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA---LKRFFCENIESLRFK 215
            +D    +Y+ +I+ I++  KHLLS++ E +++  S  G  A   L+ +    +++L   
Sbjct: 118 KEDERLSEYAYFIRKIKENNKHLLSDETEEIIAKMSISGANAWSELQSYLTSTVKAL--- 174

Query: 216 INDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRK 275
            + +++ L++     + +D+  RK A +A    +NK     ++  N++        + R 
Sbjct: 175 YDGEEVTLSEIRNMAYSTDKSTRKRAYEAELECYNKIKDSVAYSLNSIKLQVLTLSKLRG 234

Query: 276 YEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFW-DRLAPL 334
           Y  + D     ++++   + A++ ++K Y PK  H Y   K K L  +    W D  AP+
Sbjct: 235 YSSVLDMTLDQSHMQKETLNAMITAMKEYMPKF-HEYLRAKGKALGHENGLPWYDLFAPM 293

Query: 335 PGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIP 394
            G S+     E A++ +L  +  F+P ++ + E+ F  +WID     GK  GAF     P
Sbjct: 294 -GASEKKYSIEEAKEYLLTHFRTFAPDLAQMVERAFDESWIDFYPKAGKVGGAFCANLQP 352

Query: 395 SVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLT 454
                IL NY G   D++TLAHELGH  H   +     +L ++ S+ +AETAS F E + 
Sbjct: 353 IKQSRILSNYDGTISDIVTLAHELGHAYH-NHNIHDHRLLNSDYSMPVAETASTFNENVI 411

Query: 455 FDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEI 514
            ++ ++ A   EER  L+  +++D    I    S Y FE  +  E+R+   +    + E+
Sbjct: 412 LNAAIKDAKG-EERLALIEGQLQDATQIICDIYSRYLFETAV-IEKRNDNFMFADELCEM 469

Query: 515 WLETQKESLGPAFDLSDLEYGSFWMMVPHFIES--SFYVYAYAFGNCLVNSLYDIYKSNT 572
            L  QKE+ G   D   L +   W+   H+     SFY + YAFG      LY  Y    
Sbjct: 470 MLAAQKEAYGDGLDSESL-HPYMWVCKGHYYSGSNSFYNFPYAFGGLFARGLYAKYMEEG 528

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + F  KY  +L A       +      I+L+DP+F+ + LQT    ID+ +K+
Sbjct: 529 -EAFLPKYRALLHATTVSDVEDAAKIAGIDLTDPDFFRKALQTFSDQIDEFKKL 581


>gi|167465746|ref|ZP_02330835.1| hypothetical protein Plarl_24818 [Paenibacillus larvae subsp.
           larvae BRL-230010]
          Length = 589

 Score =  184 bits (467), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 155/599 (25%), Positives = 279/599 (46%), Gaps = 29/599 (4%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTR-WEGNLAHATNQKNCHSLGAAIAEYER 96
           +W LEDL+    +     D E  E + L  K   + G L +    K C  L       ++
Sbjct: 8   KWKLEDLFADQKAW----DKEFNEVKQLLKKVDDFHGKLNNDNAIKQCFELE------DK 57

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQ 156
           I     R+  YA + ++ + + PT +           +  + L F + EI +L E  L  
Sbjct: 58  ISLHTERLYVYAKMKHDEDAADPTYQALSEKARKLSVEVNQALSFISPEILSLSEDQLRS 117

Query: 157 SYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF-K 215
             +   L+L Y   ++ + + K H+LS   E LL+ T  +   A   F   N   ++F K
Sbjct: 118 FISHPDLSL-YKRTLEELLREKPHVLSKSEETLLAMTGNMAGSASNIFGMINNADIQFPK 176

Query: 216 INDQK---IPLTK-AYKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
           I ++K   + LT  +Y  F ++ DREVRK A +A+  T+    +  +   +         
Sbjct: 177 IKNEKGEEVQLTHGSYIQFLENPDREVRKRAFQAVYETYRNQRNTIAATLSANVNKNIFY 236

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
            R RKY  + +    ++N++P V   L+ ++ +  P   HRY++L+KK LK+D ++ +D 
Sbjct: 237 ARARKYPSVLEMSLHADNIDPSVYTNLISTIHDSLP-VLHRYFKLRKKLLKVDELHMYDL 295

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
            APL    +  I ++ A++ ++++      +   I ++ F + WID  +   K SGA++ 
Sbjct: 296 FAPLVEEFKMDITYKQAQEKIIEALRPLGGKYIDILKEGFENRWIDVHENKNKRSGAYSW 355

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
           G     HPY+LLN+      + TLAHE+GH +H  LS   Q       ++ LAE AS   
Sbjct: 356 GAY-GTHPYVLLNHKDNLNSMFTLAHEMGHAMHSYLSDANQEYRNAQYTIFLAEVASTLN 414

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E L  D +L+  +  +E+  LL    +    ++ RQ  F +FE  +H +      +    
Sbjct: 415 EALLMDYMLKHTTDPKEKLYLLTYYADQFRTTVFRQTMFAEFEKIVHEKAEKGESLTPQE 474

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
            ++++ +  K   G    + D +    W  +PHF  +SFYVY YA G     S    + S
Sbjct: 475 FSKVYYDLNKLYHGNDM-VVDQDIEMEWARIPHFY-NSFYVYKYATGFSAATS----FAS 528

Query: 571 NTVDCFK---EKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
             ++  +   E+YL  L++G S     +L    +++S P   ++ +   + +++ +E++
Sbjct: 529 QILEKGEPAVERYLGFLKSGGSDFSINILKKAGVDMSSPEPIKQSMDVFKSVVEQMEQL 587


>gi|325842029|ref|ZP_08167566.1| oligoendopeptidase F [Turicibacter sp. HGF1]
 gi|325489751|gb|EGC92107.1| oligoendopeptidase F [Turicibacter sp. HGF1]
          Length = 599

 Score =  184 bits (467), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 161/615 (26%), Positives = 285/615 (46%), Gaps = 28/615 (4%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           S    + S+  +    +W ++ +Y S ++ E   D + ++ ++   K  ++G L + T+ 
Sbjct: 2   SQTMGLKSRNEIEEESKWKIDKVYASTEAWE--KDFQAVKEKAPKLK-EFQGRLGNITDL 58

Query: 82  KNCHSLGAAIAEYERICELIGRIAS----YAMLSYNCNLSSPTIRKFYTDINAKLADFEK 137
           K          EY ++ E + R+      +A +  + + S+   +     I+  +A F  
Sbjct: 59  K----------EYLKVEEELSRVLEKLYVFAHMKSHEDTSNSEFQTLVNKIDPFMAQFSS 108

Query: 138 VLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQ-V 196
              FF  EI +L++  +E+    D     Y  + K + K K H+LS +ME LL+  S  +
Sbjct: 109 YNAFFTPEILSLEDGTIEKMLESDDELKVYDTFFKVLLKEKPHILSKEMEELLASASDCL 168

Query: 197 GREALKRFFCENIESLRFKINDQK---IPLTKA-YKSFFDS-DREVRKSAAKALSHTFNK 251
           G          N +     I  +K   I LT+  Y S   S DR VR+ A K L +T+ K
Sbjct: 169 GASESIYTMLTNADMTFGTIKGEKGQDIELTEGNYSSLIKSKDRRVREDAFKLLFNTYKK 228

Query: 252 SSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHR 311
             +  +    +  K      + RKY    ++    N++   V +  +Q++ N   K+ HR
Sbjct: 229 YENTIATSLTSSLKTFIFYAKTRKYASSLEASLKPNDIPVEVYKNAIQTINNNL-KSLHR 287

Query: 312 YYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFT 371
           Y  LKKK L LD ++ +D    +    +  I +  A ++V +       +   I ++   
Sbjct: 288 YVGLKKKLLGLDEIHMYDLYVSVIDIPKQHIEYSDAIEMVKEGLKPLGQEYLDIFDEGIK 347

Query: 372 HNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQ 431
             W+D  +  GK SGA++ G+  ++ PY+LLNY  +  DV TLAHE+GH IH   + + Q
Sbjct: 348 DGWVDVYENKGKKSGAYSWGSYDTM-PYVLLNYNYELNDVSTLAHEMGHSIHSYYTRKEQ 406

Query: 432 GILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYD 491
             +  N +L  AE AS   E L  + L+     K ++  L+  ++E +  ++ RQ+ F +
Sbjct: 407 PYVYGNYTLFCAEVASTTNEILLINDLINKEQDKNKKLYLINQELEQIRATVYRQLMFAE 466

Query: 492 FELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYV 551
           FEL  H    + G + +   + IW +  K+  GP   + D E  S W  +PHF  S FYV
Sbjct: 467 FELITHETLENGGALTSDDFDNIWYDLNKKYFGPEM-IVDEEIKSEWERIPHFY-SDFYV 524

Query: 552 YAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWER 611
           Y YA G    ++       N  +   EKY   L+AG S +  + L    ++++     E 
Sbjct: 525 YQYATGYAAASAFAKSILENG-EAAVEKYKGFLKAGGSLYPIDTLKNAGVDMTTSMPLEA 583

Query: 612 GLQTVEKMIDDVEKM 626
            ++   +++D +E++
Sbjct: 584 TIERFNELLDMLEEL 598


>gi|154685588|ref|YP_001420749.1| YjbG [Bacillus amyloliquefaciens FZB42]
 gi|154351439|gb|ABS73518.1| YjbG [Bacillus amyloliquefaciens FZB42]
          Length = 609

 Score =  184 bits (466), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 161/604 (26%), Positives = 284/604 (47%), Gaps = 39/604 (6%)

Query: 39  WNLEDLYPSHDS--QEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYER 96
           W LED++PS ++  +E     E I + S +FK    G LAH+ +     +L AA+   + 
Sbjct: 22  WRLEDIFPSDEAWNKEFQAVKELIPNLS-SFK----GTLAHSAD-----NLYAALTAQDE 71

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADF----EKVLIFFALEINTLDEA 152
           +   +G++ +YA +  + +    T   FY  +N K A           +   EI  + E 
Sbjct: 72  VTNRLGKLYAYAHMRSDQD----TGNSFYQGLNDKAASLYSQAASATAYIEPEILAIQED 127

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
            L Q   +      YS  I+ I K + H+LS   E LL++ S+        F   N   +
Sbjct: 128 KLHQFILEKEELKLYSHAIEEITKQRPHVLSEQEEALLAEASEALSSPSNTFSVLNNADI 187

Query: 213 RF-KINDQKIPLTKAYKSFF-----DSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKD 266
            F  I D+    T+     F      S+REVRK+A +A+  T+ +  +  +   +   K 
Sbjct: 188 TFPSIKDENGKETQITHGNFINFLESSNREVRKNAFEAVYKTYGQYKNTMATTLSGTVKK 247

Query: 267 EEIQDRWRKYEKIADSRHLSNNVEPY-VIEALMQSVKNYYPKTSHRYYELKKKWLKLDTM 325
           +    R +KY K A    LSNN  P  V + L++++  + P   HRY +L+KK L LD +
Sbjct: 248 DNFYARVKKY-KSAREAALSNNSIPEEVYDNLIKTINKHLP-LLHRYIDLRKKVLGLDEV 305

Query: 326 YFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGS 385
           + +D   PL   S   + +E A+D +L+  A    + + I ++   + W+D  +  GK S
Sbjct: 306 HIYDLYTPLVKDSGMKVTYEEAKDYMLKGLAPLGEEYASILKEGLENRWVDIYENKGKRS 365

Query: 386 GAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAET 445
           GA++ GT    +PYIL+N+     ++ TL HE GH +H   + + Q     N S+ +AE 
Sbjct: 366 GAYSSGTY-GTNPYILMNWHDNVNNLFTLVHEFGHSVHSYYTRKYQPYPYGNYSIFVAEV 424

Query: 446 ASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGD 505
           AS   E L  + +L +   +++R  LL + +E    ++ RQ  F +FE  +HT+ +    
Sbjct: 425 ASTTNEALLGEYMLNSLKDEKQRLYLLNHMLEGFRGTVFRQTMFAEFEHLIHTKAQEGEP 484

Query: 506 IPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHF---IESSFYVYAYAFGNCLVN 562
           +    +NE++ +  K+  G    + D E    W  +PHF        Y   Y+    L +
Sbjct: 485 LTPELLNELYYDLNKKYFGDNMVI-DKEISLEWSRIPHFYYNYYVYQYATGYSAAQALSS 543

Query: 563 SLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
            +    K        E+Y   L+AG+S++  ++L    ++++ P   E   +  E+ +++
Sbjct: 544 QILKEGKPAV-----ERYTEFLKAGSSEYPIDILKKAGVDMTSPEPIEAACKMFEEKLNE 598

Query: 623 VEKM 626
           +E++
Sbjct: 599 MEEL 602


>gi|259047335|ref|ZP_05737736.1| oligoendopeptidase F [Granulicatella adiacens ATCC 49175]
 gi|259036031|gb|EEW37286.1| oligoendopeptidase F [Granulicatella adiacens ATCC 49175]
          Length = 580

 Score =  184 bits (466), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 157/596 (26%), Positives = 275/596 (46%), Gaps = 43/596 (7%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           W+L+++YPS +S+E   D E   +    F +         T + N  S+  AI   E   
Sbjct: 5   WSLKEIYPSFESEEFKRDFERFSNFREVFNS--------LTLEDNLESIKEAIEALEEFS 56

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKF-------YTDINAKLADFEKVLIFFALEINTLDE 151
            L  R+ +Y  L+   N +  T  K+       Y  +N+      K +     +I T DE
Sbjct: 57  VLSSRLGNYINLTLTANTTDETANKYRTLFGNAYASLNSAYTKVYKFIGSVETDI-TADE 115

Query: 152 ALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIES 211
            L +           Y  +    ++  KHLLS+++E +++  S  G +  ++ F      
Sbjct: 116 DLKD-----------YEFYFAEAKQQYKHLLSDELEDVIAKFSISGGDGWEQLFEAMTSG 164

Query: 212 LRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
           +  +   +K+ L++     +D+D  VRK A +     ++      +F  N + +    + 
Sbjct: 165 VEGEFKGEKVTLSEIRNMAYDADAAVRKEAYETELKMYDTIKEPIAFALNNIKQQVLTEI 224

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKL---DTMYFW 328
             R +E        ++ +    ++AL+++++ Y P+   R Y LK K   L   + + F+
Sbjct: 225 SLRGFESPLAQTLEASRMSRQTLDALLEAIREYLPQ--FRAY-LKHKASLLGHENGLPFY 281

Query: 329 DRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAF 388
           D  AP+ G S      E +++ +L+++  FS  ++ + ++ + +N+ID     GK  GAF
Sbjct: 282 DLFAPI-GESSRRFTIEESKEFLLENFKGFSEDLAQMTKEAYENNYIDFLPRKGKVGGAF 340

Query: 389 AHGTIPSV-HPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETAS 447
               +P +    IL N+ G   DV+T+AHELGH  H  L  E   +L    S+ +AETAS
Sbjct: 341 C-SNLPFIKQSRILTNFSGSLSDVVTIAHELGHAYH-GLHIENHRVLNQEYSMPVAETAS 398

Query: 448 IFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIP 507
            F E +  +++++ AS   E+  LL ++++D    IV   S Y FE  +  E R    + 
Sbjct: 399 TFNENIVMNTVIRQASDA-EKVALLESQLQDTTQIIVDIYSRYLFESAVF-ENREKSFMF 456

Query: 508 THRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIES--SFYVYAYAFGNCLVNSLY 565
           +  + ++ L+ QKE+ G   D  D  +   W   PH+  S  SFY + YAFG      LY
Sbjct: 457 SKDLEQLMLDAQKEAYGDGLD-PDAMHPYMWACKPHYYSSGLSFYNFPYAFGGLFSKGLY 515

Query: 566 DIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMID 621
            IY+    + F EKY  +LRA       +    L +++ D  FW++ L  V   I+
Sbjct: 516 AIYQEQP-EGFVEKYQELLRATTVTSAEDTAKVLGVDVEDSAFWKKALAQVADNIE 570


>gi|310641345|ref|YP_003946103.1| oligoendopeptidase f [Paenibacillus polymyxa SC2]
 gi|309246295|gb|ADO55862.1| Oligoendopeptidase F [Paenibacillus polymyxa SC2]
          Length = 598

 Score =  184 bits (466), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 160/597 (26%), Positives = 271/597 (45%), Gaps = 27/597 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKT-RWEGNLAHATNQKNCHSLGAAIAEYERI 97
           W LEDL+P+  +     D E  E + LA K  +++G L  A    NC  L       + +
Sbjct: 16  WKLEDLFPNRKAW----DQEYEEVKQLAKKAAQFQGKLNSAEAIGNCFKLE------DEL 65

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQS 157
                R+  YA L ++ + + PT +           +  + L F   EI  L ++ L+ +
Sbjct: 66  SLKTERVYVYAHLHHDEDTAEPTYQGLSQKAKKLGVEVSESLSFVTPEILALPDSQLD-A 124

Query: 158 YAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF-KI 216
           + +DP    Y   ++ +++ K H+L    E LL+    + +     F   N   L+F KI
Sbjct: 125 FIEDPKLSDYKFTLQEMKREKAHVLGKTEEALLAQVGNLAQAPQTIFGMLNNADLKFPKI 184

Query: 217 NDQ---KIPLT-KAYKSFFDSD-REVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
            D+   ++ LT  +Y  F +S  REVR+ A KA+  T+ K+ +  +   +          
Sbjct: 185 KDEHGKEVELTHGSYIQFLESPHREVRERAFKAVYDTYAKNKNTIASTLSANVNKNIFYS 244

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRL 331
           R RKY  + +     +N+   V   L+ ++    P   HRY +L+KK L +D ++ +D  
Sbjct: 245 RVRKYPSVLEMSLYGDNIPKEVYTNLIDTIHESLP-LLHRYIKLRKKLLGVDELHMYDLF 303

Query: 332 APLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHG 391
           APL    +  I +E A+    +             +K +   WID  + + K +GA++ G
Sbjct: 304 APLVDEYKMDITYEDAKKQTKEGLKPLGEDYLASLQKGYDERWIDVYENENKRTGAYSWG 363

Query: 392 TIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE 451
                HPY+LLN+      + TLAHE+GH +H   S           ++ LAE AS   E
Sbjct: 364 AY-GTHPYVLLNHKDNLNSMFTLAHEMGHALHSYYSDNALKYRDAQYTIFLAEVASTTNE 422

Query: 452 TLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR- 510
            L  D LL  ++  +E+  LL    +    ++ RQ  F +FE  +H ER   G+  T + 
Sbjct: 423 ALLMDYLLNKSTDPKEKMYLLTYYADQFRTTVFRQTMFAEFEKIVH-ERAEQGESLTPQL 481

Query: 511 INEIWLETQKESLGPAFDL-SDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYK 569
           ++EI+ +   +  GP   +  D+E    W  +PHF  +SFYVY YA G     S      
Sbjct: 482 LSEIYYDLNVKYHGPGMKVDKDIEME--WARIPHFY-NSFYVYKYATGFSAATSFSKQIL 538

Query: 570 SNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
                   ++YL  L++G S +   +L    +++S P      +   E++I ++EK+
Sbjct: 539 EEGQPAV-DRYLGFLKSGGSDYSINILKKAGVDMSSPQPIREAMSVFEEVITEMEKL 594


>gi|226315512|ref|YP_002775408.1| oligopeptidase F [Brevibacillus brevis NBRC 100599]
 gi|226098462|dbj|BAH46904.1| probable oligopeptidase F [Brevibacillus brevis NBRC 100599]
          Length = 621

 Score =  184 bits (466), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 163/601 (27%), Positives = 289/601 (48%), Gaps = 31/601 (5%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           +W L+D+YP+   +E   D+  +E  + AF T+ +G L  ++      ++ AA  +Y  +
Sbjct: 36  KWKLDDIYPT--VKEWEKDVAKVESLANAF-TKHKGKLGTSS-----ATMQAAFDDYVEL 87

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADF--EKVLIFFALEINTLDEALLE 155
             L  +   YA +S + N ++P ++K   D   K++    EK   +   EI  + +  ++
Sbjct: 88  MRLNDKAYVYANMSLDVNSANPDLQKL-GDRAEKMSTLVTEKT-SWVQPEIVAIPDGKIK 145

Query: 156 QSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF- 214
              ++  L   Y  +I+++ + K + LS DME LL+ +S +G  A    +    + +RF 
Sbjct: 146 SLLSKKELE-PYKLFIEDMLRTKPYSLSADMEQLLAKSSPLGG-APTNIYSMLSKDVRFP 203

Query: 215 KINDQ---KIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEI 269
           KI D+   ++ LT+A + S+ +S D+ VR+ A KA           F+       K +  
Sbjct: 204 KIKDETGKEVQLTRANFISYMESKDQNVRREAFKAYYGALIDFQDSFASTLAAKVKGDNF 263

Query: 270 QDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWD 329
               R Y+   ++    NNV   V + L+ +V +  P   HRY  LKKK L +  ++ +D
Sbjct: 264 YAAVRNYDSALEASLTPNNVPTKVYDELIDTVNDNLP-LLHRYISLKKKMLGVKELHMYD 322

Query: 330 RLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFA 389
              P+  +    I F+  + +V+                     W+D    D K +GA+ 
Sbjct: 323 IYVPIVPSDDKYISFDEGKKIVVNGLGVMGDDYVKAMSDGLDGGWVDVYSTDDKRTGAYQ 382

Query: 390 HGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIF 449
            G     HPY+LLN+ G   DV T+AHE+GH +    +++ Q  +++N     AE AS  
Sbjct: 383 WGAY-DTHPYVLLNHQGTLDDVYTIAHEMGHAMQSYYTNKNQPYISSNYPTFTAEVASTM 441

Query: 450 GETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTH 509
            ETL F S+   A +KEE+  LL + +E+  +++ RQ  F +FE  +H + ++   +   
Sbjct: 442 NETLLFKSMYAKAKTKEEKMYLLNHYLENFRSTLFRQTQFAEFERAIHEKEQAGESLNAE 501

Query: 510 RINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVY----AYAFGNCLVNSLY 565
            I +I+L+  K+  G    +SD E G  W  V HF    +YVY    ++A    L   + 
Sbjct: 502 AIKKIYLDINKKYYGKDM-VSDEEIGMEWARVSHFYNYKYYVYQYSTSFAAAQALAKQIM 560

Query: 566 DIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEK 625
           D  +   VD  ++   N L AGNS    E+L    +++S     E+ ++  E+ ++++EK
Sbjct: 561 DEGQP-AVDRVRK---NFLEAGNSAPPIEVLKAAGVDMSTSQPIEQAMEIFEETLNELEK 616

Query: 626 M 626
           +
Sbjct: 617 L 617


>gi|261408405|ref|YP_003244646.1| oligoendopeptidase F [Paenibacillus sp. Y412MC10]
 gi|261284868|gb|ACX66839.1| oligoendopeptidase F [Paenibacillus sp. Y412MC10]
          Length = 596

 Score =  184 bits (466), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 154/596 (25%), Positives = 268/596 (44%), Gaps = 23/596 (3%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTR-WEGNLAHATNQKNCHSLGAAIAEYER 96
           +W LEDL+    + + S      E ++L  +T  ++G L +A + K C  L   I+ +  
Sbjct: 15  QWKLEDLFADQKAWDAS----FAELKNLLKRTADYQGKLNNAASIKECFELEDEISYHAE 70

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQ 156
                 R+  YA + ++ + ++PT +           +  + L F   EI +L EA L++
Sbjct: 71  ------RLYVYAHMHHDEDTANPTYQALTAKAKKLNVEAGEALSFITPEILSLSEAELDK 124

Query: 157 SYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF-K 215
              +DP   ++   +  +++ K H+LS   E LL+    +       F   N   ++F K
Sbjct: 125 -LIEDPTLKEFKFTLTEMKREKAHVLSKTEEALLAQVGNLSSAPQTIFGMLNNADMKFPK 183

Query: 216 INDQK---IPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
           I ++    + LT   Y  F +S +REVR+ A KA+  T+ K  +  +   N         
Sbjct: 184 IKNEDGKDVELTHGNYIQFLESPNREVRERAFKAVYETYGKQKNTIAATLNANVNKNMFY 243

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
            R RKY  + +     +N+   V   L+ ++    P   HRY EL+KK L +D ++ +D 
Sbjct: 244 SRVRKYPSVLEMALYGDNIPKEVYTNLIDTIHESLP-LLHRYMELRKKLLGVDELHMYDL 302

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
            APL    +  I +E A+ +  +             ++ + + WID  + + K +GA++ 
Sbjct: 303 FAPLVEEYKWDITYEEAKQMTKEGLTPLGDDYLSSLQEGYDNGWIDVYENENKRTGAYSW 362

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
           G     HPY+LLN+      + TLAHE+GH +H   S           ++ LAE AS   
Sbjct: 363 GAY-GTHPYVLLNHKDNLNSMFTLAHEMGHALHSYYSDNALKYRDAQYTIFLAEVASTTN 421

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E L  D LL+ A   +++  LL    +    ++ RQ  F +FE  +H    S   +    
Sbjct: 422 EALLMDYLLKNAKDPKQKMYLLTYYADQFRTTVFRQTMFAEFEKIVHERVESGESLTPQD 481

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
           +++I+ E   +  G    + D E G  W  +PHF  +SFYVY YA G     S       
Sbjct: 482 LSDIYYELNVKYHGKGMQV-DKEIGMEWARIPHFY-NSFYVYKYATGFSAATSFSKQILE 539

Query: 571 NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
                  ++YL  L++G S +   +L    +++S P      +   E +I+ +E++
Sbjct: 540 EGQPAV-DRYLGFLKSGGSDYSINILKKAGVDMSSPEPIREAMSVFEDVINQMEQL 594


>gi|326389801|ref|ZP_08211365.1| oligoendopeptidase F [Thermoanaerobacter ethanolicus JW 200]
 gi|325994069|gb|EGD52497.1| oligoendopeptidase F [Thermoanaerobacter ethanolicus JW 200]
          Length = 596

 Score =  183 bits (465), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 164/612 (26%), Positives = 286/612 (46%), Gaps = 26/612 (4%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDS-QEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           M  +  +  + +  +W LED+Y + +  +E  N  + +  E + FK    G +  + N  
Sbjct: 1   MEVLKDRSEIEDKYKWRLEDIYENENLWEEDYNKTKELLKEIVKFK----GKINTSRNLL 56

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKL-ADFEKVLIF 141
               L       ++I     +I +YA +  + + ++P  +   TD   +L  +      F
Sbjct: 57  EVLKLN------DQIGMTASKIFAYARMRRDEDNTNPKYQAL-TDKAMRLNVEVMSATSF 109

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
            A EI ++D   L +   +      Y  +++++ + K H+LS++ E +L++   +     
Sbjct: 110 IAPEILSIDTQKLMEMIEELEELKIYKQYLEDLIRFKPHVLSSEEEKILAEAETLAESVS 169

Query: 202 KRFFCENIESLRF-KINDQK---IPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHI 255
             +   N   +RF  I D++   + +T   +  F  S DR VRK+A  A+  T+ K  + 
Sbjct: 170 NVYTMLNNADMRFPTIKDEEGKEVEVTHGNFVRFMQSKDRNVRKAAFNAMYDTYKKFINT 229

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+       K +    + RKY    ++    +NV   V   L+++V +      HRY  L
Sbjct: 230 FASTMAGNVKKDIFYAKTRKYNSSLEASLFEDNVSVEVYNNLIETVHSRLD-VLHRYVRL 288

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           KKK L LD ++ +D   PL         +E A +LVL+       +   +  K F   W+
Sbjct: 289 KKKLLGLDELHMYDLYVPLIQEYDKKFTYEEAINLVLEGLQPLGDEYINLLRKGFNSRWV 348

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ GT  + HPY+LLNY GK  DV T+AHE+GH +H   S+ TQ  + 
Sbjct: 349 DVYENRGKTSGAYSWGTYGT-HPYVLLNYQGKLNDVFTIAHEMGHSLHTYYSNATQPYVY 407

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
               + +AE AS   E +  + LL+ +  ++E+  LL +  E+   ++ RQ+ F +FE  
Sbjct: 408 AGYKIFVAEVASTCNEAILMNYLLKNSKDEKEKLYLLNHFFEEFRGTVYRQVMFAEFEKL 467

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSF-WMMVPHFIESSFYVYAY 554
           +H        +    +N+ + E  K   G   D+   E  S+ W  +PHF   +FYVY Y
Sbjct: 468 IHEMAERGEPLTAEVLNKKYYELNKLYYGD--DIVVDEGISYEWARIPHFYR-NFYVYKY 524

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     ++  +   N  +   E+Y   L++G+S +   LL    ++L+ P      L 
Sbjct: 525 ATGFSAAIAISQMI-LNEGEKAVERYKEFLKSGSSDYPLNLLKKAGVDLTTPKPVNEALD 583

Query: 615 TVEKMIDDVEKM 626
             EK++D+ EKM
Sbjct: 584 VFEKLLDEFEKM 595


>gi|187933650|ref|YP_001884977.1| oligoendopeptidase F [Clostridium botulinum B str. Eklund 17B]
 gi|187721803|gb|ACD23024.1| oligoendopeptidase F [Clostridium botulinum B str. Eklund 17B]
          Length = 594

 Score =  183 bits (465), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 166/616 (26%), Positives = 280/616 (45%), Gaps = 38/616 (6%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEIS-NDMECIEHESLAFKTRWEGNLAHATNQK 82
           M  +  +E + +  +W +E +Y + D  E   ND++   H           +L   + + 
Sbjct: 1   MEELKKREEIESKFKWKVEKIYKNIDEWEKEFNDLKNEAH-----------SLKDFSGKL 49

Query: 83  NCHSLGAAIAEYERICELIGRIAS----YAMLSYNCNLSSPTIRKFYTDINAKLADFEKV 138
           NC   G +I EY ++ E I R A     YA L  + + S+ T +   + I+  +A+F   
Sbjct: 50  NC---GESILEYLKLSEEISRKAEKLYIYAHLKSDEDTSNSTYQSLMSKIDIYMAEFASY 106

Query: 139 LIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQV-- 196
             +F  EI +L++  +E+   +      Y    ++I K K H+LS +ME LL+  S    
Sbjct: 107 TAYFVPEILSLEDGFIEKEIERLNELKPYKFLFEDILKEKPHVLSKEMEELLAQASDCLD 166

Query: 197 GREALKRFFCENIESLRFKINDQK---IPLTKA-YKSFFDS-DREVRKSAAKALSHTFNK 251
              A+      N + +  KI ++    + LT+  Y SF  S +RE+RK A + L   + K
Sbjct: 167 APSAIHNILT-NADMIFGKIKNEDGKDVELTEGNYSSFIRSKNRELRKRAFEQLFGEYEK 225

Query: 252 SSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHR 311
             +  +       K+     + RKY    ++    NN+ P  +     +V N    + HR
Sbjct: 226 LQNTLATSLTCSIKNFNFSSKIRKYNCALEASLKPNNI-PLEVYKNAVTVINDNLDSLHR 284

Query: 312 YYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFT 371
           Y ++KKK L LD ++ +D   P+  T ++ I F    D+VL +      +   I +    
Sbjct: 285 YVKVKKKLLGLDEIHMYDLYVPVIETPKEKIEFNDGVDIVLDALKPLGDEYLSIFKSGIE 344

Query: 372 HNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQ 431
             WID  +  GK  GA++ G   ++ PY+LLNY  +  DV TLAHE+GH IH   S + Q
Sbjct: 345 DGWIDIYENKGKKGGAYSWGGYDTM-PYVLLNYNNELGDVSTLAHEMGHSIHSYYSRKEQ 403

Query: 432 GILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYD 491
                  +L  AE AS   E++    L+     K ++  L+  ++E +  ++ RQ+ F +
Sbjct: 404 PYYYAGYTLFCAEVASTTNESILIHYLIDKEKDKNKKLYLINQELEQIRTTVFRQLMFAE 463

Query: 492 FELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYV 551
           FEL  H        +     N  W E   +  GP   + D E    W  +PHF  S FYV
Sbjct: 464 FELYTHESLEDGIPLTAEDYNTKWHELNVKYFGPEM-IVDKEIDIEWSRIPHFY-SDFYV 521

Query: 552 YAYAFGNCLVNSLYDIY---KSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNF 608
           Y YA G    ++ Y      K N V    EKY   L++G S +  ++L    ++++    
Sbjct: 522 YQYATGYAAASAFYKSILDKKENAV----EKYKGFLKSGGSDYPIDILKNAGVDMTTDEP 577

Query: 609 WERGLQTVEKMIDDVE 624
            E  ++   +++D ++
Sbjct: 578 LEATIKRFNELLDMID 593


>gi|56419357|ref|YP_146675.1| thimet oligoendopeptidase [Geobacillus kaustophilus HTA426]
 gi|56379199|dbj|BAD75107.1| thimet oligoendopeptidase [Geobacillus kaustophilus HTA426]
          Length = 605

 Score =  183 bits (465), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 152/600 (25%), Positives = 287/600 (47%), Gaps = 31/600 (5%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFK-TRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           W LED++P+ D+ E     E  + +++  K   ++G L      ++   L  A+   + +
Sbjct: 22  WRLEDIFPTDDAWE----EEFKQVKAMIPKLGEYKGRLG-----ESPEVLYEALQCQDDV 72

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKL----ADFEKVLIFFALEINTLDEAL 153
              +G++ +YA + Y+ +    T   FY  ++A+     ++    + F   EI  +DEA+
Sbjct: 73  SMRLGKLYTYAHMRYDQD----TTNSFYQGLDARAKSLYSEASSAMAFIVPEILAIDEAV 128

Query: 154 LEQSYAQ-DPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
           L     Q +PL L Y+  +  I + + H+LS + E +L+  ++V +     F   N   L
Sbjct: 129 LRSFLEQYEPLRL-YAHALDEITRQRPHVLSAEEEAILAQAAEVMQATSDTFSALNNADL 187

Query: 213 RFKI----NDQKIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAKD 266
            F      N +++ +T   +  F +S DR VR+ A  A+ HT+ K  + F+ +     K 
Sbjct: 188 TFPTIIDENGEEVEVTHGRFIRFLESTDRRVRRDAFYAVYHTYEKFQNTFANMLAGTVKK 247

Query: 267 EEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMY 326
           +    R R+Y    ++   +NN+   V + L+ ++  + P   HRY  L+K+ L LD ++
Sbjct: 248 DNFFARIRRYRSAREAALDANNIPESVYDNLIAAIHEHLP-LLHRYVRLRKRVLGLDELH 306

Query: 327 FWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSG 386
            +D   PL    +  + +E A+  +L+  A    +   I ++   + W+D  +  GK SG
Sbjct: 307 MYDLYTPLVQEVKMEVTYEEAKQYMLEGLAPLGEEYVAIVKEGLDNRWVDVRENKGKRSG 366

Query: 387 AFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETA 446
           A++ G     HPYILLN+     ++ TL HE GH +H   + +TQ     + S+ +AE A
Sbjct: 367 AYSSGAY-GTHPYILLNWQDNVNNLFTLVHEFGHSVHSYYTRKTQPYPYAHYSIFVAEVA 425

Query: 447 SIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDI 506
           S   E L  D LL+    +++R  LL + +E    ++ RQ  F +FE  +H + +    +
Sbjct: 426 STCNEALLNDYLLRTIDDEKKRLYLLNHYLEGFRGTVFRQTMFAEFEHLIHLKAQQGEAL 485

Query: 507 PTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYD 566
               ++ ++ +  K   G    + D E G  W  +PHF  + + VY YA G     +L  
Sbjct: 486 TAETLSALYYDLNKTYFGDDI-VVDKEIGLEWARIPHFYYNYY-VYQYATGFSAATALSK 543

Query: 567 IYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
                     + +Y++ L+AG+S +  E+L    ++++      +  Q   + +D++E++
Sbjct: 544 QILEEGEPAVR-RYIDFLKAGSSDYPIEVLKKAGVDMTSAEPIRQACQVFAEKLDEMERL 602


>gi|328951454|ref|YP_004368789.1| oligoendopeptidase, pepF/M3 family [Marinithermus hydrothermalis
           DSM 14884]
 gi|328451778|gb|AEB12679.1| oligoendopeptidase, pepF/M3 family [Marinithermus hydrothermalis
           DSM 14884]
          Length = 583

 Score =  183 bits (465), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 150/595 (25%), Positives = 259/595 (43%), Gaps = 22/595 (3%)

Query: 35  NLPRWNLEDLYPSHDS---QEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAI 91
           +LPRW+L  L+PS +S   QE  N +E           R+E   A     ++  +  A +
Sbjct: 4   SLPRWDLTPLFPSLESEKFQEAWNALEAGIQRLEQLFARYEVG-ARPARPEDREAFWAVV 62

Query: 92  AEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDE 151
            E  R  E +  + +Y       +      +   +++   + DF K+       +  LD 
Sbjct: 63  EELNRFLEGLTPVRAYLYGRVATDAEDRAAQAKLSELERLVLDFRKLRPRLVAWLAALDA 122

Query: 152 ALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIES 211
             +E           Y   ++  R   +HL+S   E L ++ S  GR A  +        
Sbjct: 123 EAVEAG--------PYRLLLEEARLEAQHLMSEPEETLAAELSLTGRTAWAKLHGNASSL 174

Query: 212 LRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
           +  ++  +++P+T      +  D   R++A +A    +   +   +   N +  +  + +
Sbjct: 175 ITVRLEGKELPITAVRNLAYHPDEATRRAAYEAELAAWKAHAVPLAAALNGVKGEASVLN 234

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRL 331
           R R +    +     N +    +EA+  +V   +P    RY+  K K L    + +WD  
Sbjct: 235 RRRGWRDDLEPTLFRNRISRKALEAMQAAVVASFP-VWRRYFRAKAKALGKARLDWWDLF 293

Query: 332 APLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHG 391
           AP+ G  Q    ++ A   +++   +FSP+ + +A + F   WIDA    GK  GAF   
Sbjct: 294 APV-GRQQRRWTWQEAERFIVEQLGRFSPRDADLARRAFRERWIDAEPRKGKRGGAFCM- 351

Query: 392 TIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE 451
           ++      IL N+      V TLAHELGH  H  L+      L  ++ +TLAETASI  E
Sbjct: 352 SVGKGESRILANFEESFDSVSTLAHELGHAYH-NLNLAQHPPLLRDTPMTLAETASIMNE 410

Query: 452 TLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRI 511
           T+   + LQA   +E+  I L   ++     +V   + + FE  +  ERR+T ++     
Sbjct: 411 TVIVQAALQALPPEEQLPI-LETDLQGAAQVVVDIHARFLFESWVF-ERRATRELSPEEF 468

Query: 512 NEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSN 571
           NE+ LE Q+E+ G A       +   W + PH+  + FY Y Y FG      LY  Y+  
Sbjct: 469 NELMLEAQRETYGDALATY---HPYMWAVKPHYYGTDFYNYPYTFGLLFGLGLYRHYQ-E 524

Query: 572 TVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
             + F E+Y  +L +       EL     I++ D  FWE GL+ + + +  +E++
Sbjct: 525 APEGFLERYDALLASTGMHTAQELAARFGIDIEDRRFWEEGLEVLAERVARLEQL 579


>gi|223933650|ref|ZP_03625628.1| oligoendopeptidase F [Streptococcus suis 89/1591]
 gi|223897680|gb|EEF64063.1| oligoendopeptidase F [Streptococcus suis 89/1591]
          Length = 600

 Score =  183 bits (464), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 153/608 (25%), Positives = 285/608 (46%), Gaps = 46/608 (7%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLA--HATNQKNCHSLGAAIAEYE 95
           +W+L  ++P+ D+                    WE  LA   A  +K     G  +   +
Sbjct: 13  QWDLTTIFPTDDA--------------------WEAELADLQAETEKTKEFAGHLLDSAK 52

Query: 96  RICEL----------IGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALE 145
            + E+          I ++  YA +  + +      ++F        A F +   F+  E
Sbjct: 53  SLLEISETQLSLMRRIEKLYVYASMKNDQDTREGKYQEFQAKAMGLYAAFSQAFAFYEPE 112

Query: 146 INTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFF 205
              + E  LE   A++P  ++YS   + +   K H+LS ++E +L+ TS++     + F 
Sbjct: 113 FMAITEEQLEAFKAEEPTLVQYSHQFEKLLAAKDHVLSQEVEEVLAATSEIFESPAETFS 172

Query: 206 CENIESLRF-KINDQK---IPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFI 259
             +  SLRF +I D+    +PL+   Y  F +S + +VR+ A +A+  T+ +  H ++  
Sbjct: 173 VLDNASLRFPEIADEDGHLVPLSHGNYIHFMESKNSDVRQEAYEAMYGTYEQFQHTYAKT 232

Query: 260 TNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKW 319
             +  K   ++ R RKY+    +   +N +   V + L+ +V  + P   HRY  L+KK 
Sbjct: 233 LQSNVKVNNLKARLRKYDSARHASLAANFIPESVYDTLVAAVNKHLP-LLHRYINLRKKL 291

Query: 320 LKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQ 379
           L +D +  +D   PL   S  I  +E A     ++   F    S I ++ F + WID   
Sbjct: 292 LGIDDLKMYDMYTPLSDFSTKI-SYEDALKKCQETLEIFGEDYSAIVKEAFENRWIDVHV 350

Query: 380 YDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSS 439
            +GK SGA++ G   + + ++LLN+     ++ TL HE GH +H +L+ +TQ  +  + S
Sbjct: 351 NEGKRSGAYSGGAYDT-NAFMLLNWQDNLDNMYTLIHETGHSLHSMLTRKTQPYVYGHYS 409

Query: 440 LTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTE 499
           L LAE AS   E L  + LL      +ER  +L + ++    ++ RQ  F +FE  ++  
Sbjct: 410 LFLAEIASTTNENLLTEKLLAEVEDDKERFAILNHYLDGFRGTVFRQTQFAEFEQAIYKA 469

Query: 500 RRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNC 559
            +    +    +NE++ +T ++  G + +  + E    W  +PHF   +FYVY YA G  
Sbjct: 470 DQEGQVLTADFLNELYGQTNEKYYGLSAE-ENPEIQFEWARIPHFY-YNFYVYQYATGFA 527

Query: 560 LVNSLYD-IYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
             ++L + I   +  D  KE YLN L+AG+S +   ++    ++++  ++     +  E 
Sbjct: 528 AASALANKIVNGSPED--KENYLNYLKAGSSDYSLNVIAKAGVDMTKEDYLNDAFKVFEA 585

Query: 619 MIDDVEKM 626
            ++++E +
Sbjct: 586 RLEELEAL 593


>gi|297530973|ref|YP_003672248.1| oligoendopeptidase F [Geobacillus sp. C56-T3]
 gi|297254225|gb|ADI27671.1| oligoendopeptidase F [Geobacillus sp. C56-T3]
          Length = 607

 Score =  182 bits (463), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 156/603 (25%), Positives = 289/603 (47%), Gaps = 37/603 (6%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFK-TRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           W LED++P+ D+ E     E  + +++  K   ++G L      ++   L  A+   + +
Sbjct: 24  WRLEDIFPTDDAWE----EEFKQVKAMIPKLGEYKGRLG-----ESPEVLYEALQCQDDV 74

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKL----ADFEKVLIFFALEINTLDEAL 153
              +G++ +YA + Y+ +    T   FY  ++A+     ++    + F   EI  +DEA+
Sbjct: 75  SMRLGKLYTYAHMRYDQD----TTNSFYQGLDARAKSLYSEASSAMAFIVPEILAIDEAV 130

Query: 154 LEQSYAQ-DPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
           L     Q +PL L Y+  +  I + + H+LS + E +L+  ++V +     F   N   L
Sbjct: 131 LRSFLEQYEPLRL-YAHALDEITRQRPHVLSAEEEAILAQAAEVMQATSNTFSALNNADL 189

Query: 213 RFKI----NDQKIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLA-- 264
            F      N +++ +T   +  F +S DR VR+ A  A+ HT+ K  + F+   NTLA  
Sbjct: 190 TFPTIIDENGEEVEVTHGRFIRFLESTDRRVRRDAFYAVYHTYEKFQNTFA---NTLAGT 246

Query: 265 -KDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLD 323
            K +    R R+Y    ++   +NN+   V + L+ ++  + P   HRY  L+K+ L LD
Sbjct: 247 VKKDNFFARIRRYRSAREAALDANNIPESVYDNLIATIHEHLP-LLHRYVRLRKRVLGLD 305

Query: 324 TMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGK 383
            ++ +D   PL    +  + +E A+  +L+  A    +   I ++   + W+D  +  GK
Sbjct: 306 ELHMYDLYTPLVQEVKMEVTYEEAKQYMLEGLAPLGEEYVAIVKEGLDNRWVDVRENKGK 365

Query: 384 GSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLA 443
            SGA++ G     HPYILLN+     ++ TL HE GH +H   + +TQ     + S+ +A
Sbjct: 366 RSGAYSSGAY-GTHPYILLNWQDNVNNLFTLVHEFGHSVHSYYTRKTQPYPYAHYSIFVA 424

Query: 444 ETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRST 503
           E AS   E L  D LL+    +++R  LL + +E    ++ RQ  F +FE  +H + +  
Sbjct: 425 EVASTCNEALLNDYLLKTIDDEKKRLYLLNHYLEGFRGTVFRQTMFAEFEHLIHLKAQQG 484

Query: 504 GDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNS 563
             +    +  ++ +  K   G    + D E G  W  +PHF  + + VY YA G     +
Sbjct: 485 EALTAETLTSLYYDLNKTYFGDDI-VVDKEIGLEWARIPHFYYNYY-VYQYATGFSAATA 542

Query: 564 LYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDV 623
           L            + +Y++ L+AG+S +  E+L    ++++      +  Q   + +D++
Sbjct: 543 LSKQILEEGEPAVR-RYIDFLKAGSSDYPIEVLKKAGVDMTSAEPIRQACQVFAEKLDEM 601

Query: 624 EKM 626
           E++
Sbjct: 602 ERL 604


>gi|261419056|ref|YP_003252738.1| oligoendopeptidase F [Geobacillus sp. Y412MC61]
 gi|319765873|ref|YP_004131374.1| oligoendopeptidase F [Geobacillus sp. Y412MC52]
 gi|261375513|gb|ACX78256.1| oligoendopeptidase F [Geobacillus sp. Y412MC61]
 gi|317110739|gb|ADU93231.1| oligoendopeptidase F [Geobacillus sp. Y412MC52]
          Length = 607

 Score =  182 bits (463), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 156/603 (25%), Positives = 289/603 (47%), Gaps = 37/603 (6%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFK-TRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           W LED++P+ D+ E     E  + +++  K   ++G L      ++   L  A+   + +
Sbjct: 24  WRLEDIFPTDDAWE----EEFKQVKAMIPKLGEYKGRLG-----ESPEVLYEALQCQDDV 74

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKL----ADFEKVLIFFALEINTLDEAL 153
              +G++ +YA + Y+ +    T   FY  ++A+     ++    + F   EI  +DEA+
Sbjct: 75  SMRLGKLYTYAHMRYDQD----TTNSFYQGLDARAKSLYSEASSAMAFIVPEILAIDEAV 130

Query: 154 LEQSYAQ-DPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
           L     Q +PL L Y+  +  I + + H+LS + E +L+  ++V +     F   N   L
Sbjct: 131 LRSFLEQYEPLRL-YAHALDEITRQRPHVLSAEEEAILAQAAEVMQATSDTFSALNNADL 189

Query: 213 RFKI----NDQKIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLA-- 264
            F      N +++ +T   +  F +S DR VR+ A  A+ HT+ K  + F+   NTLA  
Sbjct: 190 TFPTIIDENGEEVEVTHGRFIRFLESTDRRVRRDAFYAVYHTYEKFQNTFA---NTLAGT 246

Query: 265 -KDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLD 323
            K +    R R+Y    ++   +NN+   V + L+ ++  + P   HRY  L+K+ L LD
Sbjct: 247 VKKDNFFARIRRYRSAREAALDANNIPESVYDNLIATIHEHLP-LLHRYVRLRKRVLGLD 305

Query: 324 TMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGK 383
            ++ +D   PL    +  + +E A+  +L+  A    +   I ++   + W+D  +  GK
Sbjct: 306 ELHMYDLYTPLVQEVKMEVTYEEAKQYMLEGLAPLGEEYVAIVKEGLDNRWVDVRENKGK 365

Query: 384 GSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLA 443
            SGA++ G     HPYILLN+     ++ TL HE GH +H   + +TQ     + S+ +A
Sbjct: 366 RSGAYSSGAY-GTHPYILLNWQDNVNNLFTLVHEFGHSVHSYYTRKTQPYPYAHYSIFVA 424

Query: 444 ETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRST 503
           E AS   E L  D LL+    +++R  LL + +E    ++ RQ  F +FE  +H + +  
Sbjct: 425 EVASTCNEALLNDYLLRTIDDEKKRLYLLNHYLEGFRGTVFRQTMFAEFEHLIHLKAQQG 484

Query: 504 GDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNS 563
             +    +  ++ +  K   G    + D E G  W  +PHF  + + VY YA G     +
Sbjct: 485 EALTAETLTSLYYDLNKTYFGDDI-VVDKEIGLEWARIPHFYYNYY-VYQYATGFSAATA 542

Query: 564 LYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDV 623
           L            + +Y++ L+AG+S +  E+L    ++++      +  Q   + +D++
Sbjct: 543 LSKQILEEGEPAVR-RYIDFLKAGSSDYPIEVLKKAGVDMTSAEPIRQACQVFAEKLDEM 601

Query: 624 EKM 626
           E++
Sbjct: 602 ERL 604


>gi|1651216|dbj|BAA13561.1| Pz-peptidase [Bacillus licheniformis]
          Length = 628

 Score =  182 bits (463), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 155/604 (25%), Positives = 291/604 (48%), Gaps = 39/604 (6%)

Query: 39  WNLEDLYPSHDS--QEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYER 96
           W LED++PS ++  +E     E I + S     +++G LA + +      L  A+   ++
Sbjct: 41  WRLEDIFPSDEAWNKEFQAVKELIPNLS-----KYKGKLADSADH-----LYEALTYQDK 90

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADF----EKVLIFFALEINTLDEA 152
           + E +GR+ +YA +  + +    T   FY  +N K  +          +   EI +++E 
Sbjct: 91  VMERLGRLYTYAHMRSDQD----TGNSFYQGLNDKAGNLYTQAASATAYLVPEILSIEED 146

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCEN---- 208
            L+Q   +      YS  I+ I K + H+LS   E LL++ S+V   +   F   N    
Sbjct: 147 KLQQFILEKEELKLYSHAIEEITKERPHVLSEKEEALLAEASEVLGSSSNTFSVLNNADI 206

Query: 209 -IESLRFKINDQKIPLTKAYKSFFDSD-REVRKSAAKALSHTFNKSSHIFSFITNTLAKD 266
              S++ +  ++K      + +F +S+ REVRK+A  A+  T+ +  +  +   +   K 
Sbjct: 207 TFPSIKDEDGNEKQITHGNFINFLESENREVRKNAFDAVYKTYGQYKNTMATTLSGTVKK 266

Query: 267 EEIQDRWRKYEKIADSRHLSNNVEPY-VIEALMQSVKNYYPKTSHRYYELKKKWLKLDTM 325
           +    R +KY K A    LSNN  P  V + L++++  + P   HRY  L+KK L+LD +
Sbjct: 267 DNFYARVKKY-KSAREAALSNNSIPEEVYDNLVKTINKHLP-LLHRYIALRKKVLELDEV 324

Query: 326 YFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGS 385
           + +D   PL   +   + +E A+D +L+  A    + + I ++   + W+D  +  GK +
Sbjct: 325 HIYDLYTPLVKDAGMKVTYEEAKDYMLKGLAPLGEEYASILKEGLENRWVDVYENKGKRN 384

Query: 386 GAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAET 445
           GA++ G     +PYIL+N+     ++ TL HE GH +H   + + Q     N S+ +AE 
Sbjct: 385 GAYSSGAY-GTNPYILMNWHNNVNNLFTLVHEFGHSVHSYYTRKHQPYPYGNYSIFVAEV 443

Query: 446 ASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGD 505
           AS   E L  + LL     +++R  +L + +E    ++ RQ  F +FE  +HT+ +    
Sbjct: 444 ASTTNEALLGEYLLNNLEDEKQRLYILNHMLEGFRGTVFRQTMFAEFEHLIHTKAQEGEP 503

Query: 506 IPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHF---IESSFYVYAYAFGNCLVN 562
           +    + +++ +  K+  G    + D E G  W  +PHF        Y   Y+    L +
Sbjct: 504 LTPELLTKVYYDLNKKYFGDGM-VIDKEIGLEWSRIPHFYYNYYVYQYATGYSAAQALSS 562

Query: 563 SLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
            +    K   VD    +Y++ L+AG+S++  ++L    ++++ P   E   +  E+ +D+
Sbjct: 563 QILKEGKP-AVD----RYIDFLKAGSSQYPIDVLKKAGVDMTSPEPIEAACKMFEEKLDE 617

Query: 623 VEKM 626
           +E++
Sbjct: 618 MEEL 621


>gi|294101207|ref|YP_003553065.1| oligoendopeptidase F [Aminobacterium colombiense DSM 12261]
 gi|293616187|gb|ADE56341.1| oligoendopeptidase F [Aminobacterium colombiense DSM 12261]
          Length = 608

 Score =  182 bits (463), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 151/598 (25%), Positives = 277/598 (46%), Gaps = 37/598 (6%)

Query: 25  TTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC 84
           T +  +E + +   W LED+YPS D  E   D + +E     F+  ++G L      ++ 
Sbjct: 13  TALPKREEIDSAYIWRLEDIYPSIDEWE--KDFDGLEKLLPRFQA-YQGCLL-----ESA 64

Query: 85  HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL 144
            +L   I   E    ++G++ +YA++  + + S    +     +   L      + F+  
Sbjct: 65  ATLLDGIRLMENAEIIMGKLYAYAVMKSHEDTSKEFYQALADRVGYLLTKLTAAISFYTP 124

Query: 145 EINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRF 204
           EI +  + +++    Q     +Y+ + +NI ++  H L+   E LL+ + +V R      
Sbjct: 125 EILSGGKGVIDGFLGQSEDLKQYAFFFENILRMAPHTLTPSEEELLARSGEVARGP---- 180

Query: 205 FCENIESL----------RFKINDQKIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKS 252
             ENI SL           F  +   I L++  Y     S DR+VR+ A + L  T++K 
Sbjct: 181 --ENIFSLFTNADMVFPEVFDEDGNTIELSEERYTRLIRSQDRQVRREAYEGLFGTYSKY 238

Query: 253 SHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRY 312
            +  + + ++  K +      RKY    ++   S+++   V ++++ +V+ +  K  H Y
Sbjct: 239 RNSLAAMYSSSVKGDLFYAMSRKYGSCLEAALDSDHIPLSVYDSVVDTVR-FNLKPLHEY 297

Query: 313 YELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTH 372
             L+K+ L +  +  +D   PL    +  I +E A  +V++       +   + +  F  
Sbjct: 298 VALRKEILNVPELCMYDLYVPLANEIKKNITYEEALAMVVKGLEPLGEEYISVLKHGFEA 357

Query: 373 NWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQG 432
            WID  +  GK  GA++ G+    HPY+LLNY G  QDV T+AHE+GH IH   S   Q 
Sbjct: 358 GWIDVYENQGKRKGAYSWGSY-GTHPYVLLNYNGTIQDVFTIAHEMGHAIHTWYSHGHQP 416

Query: 433 ILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDF 492
            +  + ++ LAE AS   E L  D LL+++  ++ R  LL   +E +  ++ RQ  F DF
Sbjct: 417 FIYADYTIFLAEVASTTNEALLLDHLLESSLDRQSRLYLLNYSLEQIRTTVYRQAMFADF 476

Query: 493 ELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLS---DLEYGSFWMMVPHFIESSF 549
           E ++H    +   +   R++ +W        GP   +    D+E    W  +PHF  ++F
Sbjct: 477 ERQVHNMAEAGEPLTAERLSALWHGLNVTYYGPEISVDAHIDIE----WARIPHFY-TAF 531

Query: 550 YVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPN 607
           YVY Y  G     SL      + +   ++ YL+ L+ G + +  ++L    ++++ P 
Sbjct: 532 YVYKYVTGYAAATSLSQRIVGDGIAA-RKSYLDFLKQGGAAYSIDILKNAGVDMATPQ 588


>gi|291483633|dbj|BAI84708.1| hypothetical protein BSNT_01930 [Bacillus subtilis subsp. natto
           BEST195]
          Length = 670

 Score =  182 bits (463), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 155/604 (25%), Positives = 291/604 (48%), Gaps = 39/604 (6%)

Query: 39  WNLEDLYPSHDS--QEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYER 96
           W LED++PS ++  +E     E I + S     +++G LA + +      L  A+   ++
Sbjct: 83  WRLEDIFPSDEAWNKEFQAVKELIPNLS-----KYKGKLADSADH-----LYEALTYQDK 132

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADF----EKVLIFFALEINTLDEA 152
           + E +GR+ +YA +  + +    T   FY  +N K  +          +   EI +++E 
Sbjct: 133 VMERLGRLYTYAHMRSDQD----TGNSFYQGLNDKAGNLYTQAASATAYLVPEILSIEED 188

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCEN---- 208
            L+Q   +      YS  I+ I K + H+LS   E LL++ S+V   +   F   N    
Sbjct: 189 KLQQFILEKEELKLYSHAIEEITKERPHVLSEKEEALLAEASEVLGSSSNTFSVLNNADI 248

Query: 209 -IESLRFKINDQKIPLTKAYKSFFDSD-REVRKSAAKALSHTFNKSSHIFSFITNTLAKD 266
              S++ +  ++K      + +F +S+ REVRK+A  A+  T+ +  +  +   +   K 
Sbjct: 249 TFPSIKDEDGNEKQITHGNFINFLESENREVRKNAFDAVYKTYGQYKNTMATTLSGTVKK 308

Query: 267 EEIQDRWRKYEKIADSRHLSNNVEPY-VIEALMQSVKNYYPKTSHRYYELKKKWLKLDTM 325
           +    R +KY K A    LSNN  P  V + L++++  + P   HRY  L+KK L+LD +
Sbjct: 309 DNFYARVKKY-KSAREAALSNNSIPEEVYDNLVKTINKHLP-LLHRYIALRKKVLELDEV 366

Query: 326 YFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGS 385
           + +D   PL   +   + +E A+D +L+  A    + + I ++   + W+D  +  GK +
Sbjct: 367 HIYDLYTPLVKDAGMKVTYEEAKDYMLKGLAPLGEEYASILKEGLENRWVDVYENKGKRN 426

Query: 386 GAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAET 445
           GA++ G     +PYIL+N+     ++ TL HE GH +H   + + Q     N S+ +AE 
Sbjct: 427 GAYSSGAY-GTNPYILMNWHNNVNNLFTLVHEFGHSVHSYYTRKHQPYPYGNYSIFVAEV 485

Query: 446 ASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGD 505
           AS   E L  + LL     +++R  +L + +E    ++ RQ  F +FE  +HT+ +    
Sbjct: 486 ASTTNEALLGEYLLNNLEDEKQRLYILNHMLEGFRGTVFRQTMFAEFEHLIHTKAQEGEP 545

Query: 506 IPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHF---IESSFYVYAYAFGNCLVN 562
           +    + +++ +  K+  G    + D E G  W  +PHF        Y   Y+    L +
Sbjct: 546 LTPELLTKVYYDLNKKYFGDGM-VIDKEIGLEWSRIPHFYYNYYVYQYATGYSAAQALSS 604

Query: 563 SLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
            +    K   VD    +Y++ L+AG+S++  ++L    ++++ P   E   +  E+ +D+
Sbjct: 605 QILKEGKP-AVD----RYIDFLKAGSSQYPIDVLKKAGVDMTSPEPIEAACKMFEEKLDE 659

Query: 623 VEKM 626
           +E++
Sbjct: 660 MEEL 663


>gi|295401665|ref|ZP_06811632.1| oligoendopeptidase F [Geobacillus thermoglucosidasius C56-YS93]
 gi|294976285|gb|EFG51896.1| oligoendopeptidase F [Geobacillus thermoglucosidasius C56-YS93]
          Length = 604

 Score =  182 bits (463), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 157/621 (25%), Positives = 296/621 (47%), Gaps = 40/621 (6%)

Query: 27  MDSQENLGNLP---------RWNLEDLYPSHDSQEISNDMECIEHESLAFK-TRWEGNLA 76
           MD ++   +LP          W LED++P+ ++ E     E  E + +  K + ++G L 
Sbjct: 1   MDEKKTKKSLPLRSEIPVEETWRLEDIFPTDEAWE----QEFQEVKKMIPKLSDYQGRLG 56

Query: 77  HATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKL---- 132
            + +     +L  A+   ++I   +G++ +YA + Y+ +    T   FY  +N +     
Sbjct: 57  ESAD-----TLYEALQYQDKISMRLGKLYTYAHMRYDQD----TTNAFYQGLNDRATSLY 107

Query: 133 ADFEKVLIFFALEINTLDEALLEQSYAQDPLTLK-YSAWIKNIRKIKKHLLSNDMECLLS 191
           ++    + F   EI  +DEA L +++ ++   LK Y   +  I + + H+LS + E +L+
Sbjct: 108 SEASSAMAFIVPEILAIDEAKL-RAFLEEKKELKLYEHALDEINRQRPHVLSAEEEAILA 166

Query: 192 DTSQVGREALKRFFCENIESLRFKI----NDQKIPLTKA-YKSFFDS-DREVRKSAAKAL 245
             ++V + +   F   N   L F      N +++ +T   +  F +S DR VR+ A KA+
Sbjct: 167 QAAEVMQASSTTFGMLNNADLTFPTIIDENGEEVEVTHGRFIRFLESTDRRVRRDAFKAV 226

Query: 246 SHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYY 305
             T+ K  + F+       K +    R R+Y+   ++   +NN+   V + L++++  + 
Sbjct: 227 YETYEKYKNTFASTLAGAVKKDNFFARVRRYKSAREAALSNNNIPESVYDNLIETIHEHL 286

Query: 306 PKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSII 365
           P   HRY  L+KK L LD ++ +D   PL    +  + +E A++ +L+  A    +   I
Sbjct: 287 P-LLHRYVRLRKKVLGLDELHMYDLYTPLVQDVKMEVTYEEAKEYMLKGLAPLGDEYIRI 345

Query: 366 AEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFV 425
            ++   + W+D  +  GK SGA++ G     +PYILLN+     ++ TL HE GH +H  
Sbjct: 346 VKEGLENRWVDVRENKGKRSGAYSSGAY-GTNPYILLNWQDNVNNLFTLVHEFGHSVHSY 404

Query: 426 LSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVR 485
            + +TQ     N S+ +AE AS   E L  D LL+    +++R  LL   +E    ++ R
Sbjct: 405 YTRKTQPYPYGNYSIFVAEVASTCNEALLNDYLLKTIDDEKKRLYLLNYYLEGFRGTVFR 464

Query: 486 QISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFI 545
           Q  F +FE  +H + +    +    +  ++ E  K+  G    + D E G  W  +PHF 
Sbjct: 465 QTMFAEFEHMIHIKAQEGEALTADSLTSMYYELNKKYFGDDI-VVDKEIGLEWARIPHFY 523

Query: 546 ESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSD 605
            + + VY YA G     +L            K +Y+  L+AG+S +  E+L    ++++ 
Sbjct: 524 YNYY-VYQYATGFSAATALSRQILEEGEPAVK-RYIEFLKAGSSDYPIEVLKKAGVDMTS 581

Query: 606 PNFWERGLQTVEKMIDDVEKM 626
                +  Q   + ++++E++
Sbjct: 582 AEPIRQACQVFAEKLEEMEQL 602


>gi|308068464|ref|YP_003870069.1| oligoendopeptidase F [Paenibacillus polymyxa E681]
 gi|305857743|gb|ADM69531.1| Oligoendopeptidase F-like protein [Paenibacillus polymyxa E681]
          Length = 639

 Score =  182 bits (462), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 159/597 (26%), Positives = 271/597 (45%), Gaps = 27/597 (4%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKT-RWEGNLAHATNQKNCHSLGAAIAEYERI 97
           W LEDL+P+  +     D E  E + LA K  +++G L  A +  +C  L       + +
Sbjct: 57  WKLEDLFPNRKAW----DQEYEEVKQLAKKAEQFQGKLNSAESIGSCFKLE------DEL 106

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQS 157
                R+  YA L ++ + + PT +           +  + L F   EI  L +  L+ +
Sbjct: 107 SLKTERVYVYAHLHHDEDTAEPTYQGLSQKAKKLGVEVSESLSFVTPEILALPDHQLD-A 165

Query: 158 YAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF-KI 216
           + +DP    Y   ++ +++ K H+L    E LL+    + +     F   N   L+F KI
Sbjct: 166 FIEDPKLADYRFTLQEMKREKAHILGKTEEALLAQVGNLAQAPQTIFGMLNNADLKFPKI 225

Query: 217 NDQ---KIPLT-KAYKSFFDSD-REVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
            D+   ++ LT  +Y  F +S  REVR+ A KA+  T+ K+ +  +   +          
Sbjct: 226 KDENGKEVELTHGSYIQFLESPHREVRERAFKAVYDTYAKNKNTIASTLSANVNKNIFYS 285

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRL 331
           R RKY  + +     +N+   V   L+ ++    P   HRY +L+KK L +D ++ +D  
Sbjct: 286 RVRKYPSVLEMSLYGDNIPKEVYTNLIDTIHESLP-LLHRYIKLRKKLLGVDELHMYDLF 344

Query: 332 APLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHG 391
           APL    +  I +E A+    +             +K +   WID  + + K +GA++ G
Sbjct: 345 APLVDEYKMDITYEDAKKQTKEGLKPLGEDYLASLQKGYDERWIDVYENENKRTGAYSWG 404

Query: 392 TIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE 451
                HPY+LLN+      + TLAHE+GH +H   S           ++ LAE AS   E
Sbjct: 405 AY-GTHPYVLLNHKDNLNSMFTLAHEMGHALHSYYSDNALKFRDAQYTIFLAEVASTTNE 463

Query: 452 TLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR- 510
            L  D LL  ++  +E+  LL    +    ++ RQ  F +FE  +H ER   G+  T + 
Sbjct: 464 ALLMDYLLNKSTDPKEKMYLLTYYADQFRTTVFRQTMFAEFEKIVH-ERAEQGESLTPQL 522

Query: 511 INEIWLETQKESLGPAFDL-SDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYK 569
           ++EI+ +   +  GP   +  D+E    W  +PHF  +SFYVY YA G     S      
Sbjct: 523 LSEIYYDLNVKYHGPGMKVDKDIEME--WARIPHFY-NSFYVYKYATGFSAATSFSKQIL 579

Query: 570 SNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
                   ++YL  L++G S +   +L    +++S P      +   E++I ++EK+
Sbjct: 580 EEGQPAV-DRYLGFLKSGGSDYSINILKKAGVDMSSPQPIREAMSVFEEVITEMEKL 635


>gi|289578176|ref|YP_003476803.1| oligoendopeptidase F [Thermoanaerobacter italicus Ab9]
 gi|297544456|ref|YP_003676758.1| oligoendopeptidase F [Thermoanaerobacter mathranii subsp. mathranii
           str. A3]
 gi|289527889|gb|ADD02241.1| oligoendopeptidase F [Thermoanaerobacter italicus Ab9]
 gi|296842231|gb|ADH60747.1| oligoendopeptidase F [Thermoanaerobacter mathranii subsp. mathranii
           str. A3]
          Length = 596

 Score =  182 bits (462), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 163/613 (26%), Positives = 284/613 (46%), Gaps = 28/613 (4%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHD--SQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           M  +  +  + +  +W LED+Y + +   ++ S   E +E E L FK +           
Sbjct: 1   MEILKDRSEIEDKYKWRLEDIYENENLWEEDYSKTKELLE-EVLKFKGKI---------- 49

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKL-ADFEKVLI 140
                L   +   ++I     +I +YA +  + + ++P  +   TD   +L  +      
Sbjct: 50  NTSRDLLEVLKLNDQIGMTASKIFAYARMRRDEDNTNPKYQAL-TDKAMRLNIEVMSATS 108

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           F A EI ++D   L +   +      Y  +++++ + K H+LS + E +L++   +    
Sbjct: 109 FIAPEILSIDTQKLMEMIEELEELKIYKQYLEDLIRFKPHVLSPEEEKILAEAKTLAESV 168

Query: 201 LKRFFCENIESLRF-KINDQK---IPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSH 254
              +   N   +RF  I D++   + LT   +  F  S DR VRK+A  A+  T+ K  +
Sbjct: 169 SNIYTMLNNADMRFPTIKDEEGKEVELTHGNFIGFMQSKDRNVRKAAFNAMYDTYKKFIN 228

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
            F+       K +    + RKY    ++    +NV   V   L+++V +      HRY  
Sbjct: 229 TFASTMAGNVKKDIFYAKTRKYNSSLEASLFEDNVGVEVYNNLIETVHSRLD-VLHRYVR 287

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           LKKK L LD ++ +D   PL         +E A +LVL+       +   + ++ F   W
Sbjct: 288 LKKKLLGLDELHMYDLYVPLIQEYDKKFTYEEAIELVLEGLKPLGDEYINLLKQGFNSRW 347

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D  +  GK SGA++ GT  + HPY+LLNY GK  DV T+AHE+GH +H   S+ TQ  +
Sbjct: 348 VDVYENRGKTSGAYSWGTYGT-HPYVLLNYHGKLSDVFTIAHEMGHSLHTYYSNATQPYV 406

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
                + +AE AS   E +  D LL+ +  ++E+  LL +  E+   ++ RQ+ F +FE 
Sbjct: 407 YAGYKIFVAEVASTCNEAILMDYLLKNSKDEKEKLYLLNHFFEEFRGTVYRQVMFAEFEK 466

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSF-WMMVPHFIESSFYVYA 553
            +H        +    +N+ + E  K   G   D+   E  S+ W  +PHF   +FYVY 
Sbjct: 467 LIHEMAERGESLTAEVLNKKYYELNKLYYGD--DIVVDEGISYEWARIPHFYR-NFYVYK 523

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YA G     ++  +  +       E+Y   L++G+S +   LL    ++L+ P      L
Sbjct: 524 YATGFSAAIAISQMILNEGKKAV-ERYKEFLKSGSSDYPLNLLKRAGVDLTTPKPVNEAL 582

Query: 614 QTVEKMIDDVEKM 626
              EK++D+ EK+
Sbjct: 583 DVFEKLLDEFEKL 595


>gi|221308994|ref|ZP_03590841.1| hypothetical protein Bsubs1_06376 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221313319|ref|ZP_03595124.1| hypothetical protein BsubsN3_06302 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221318243|ref|ZP_03599537.1| hypothetical protein BsubsJ_06246 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221322517|ref|ZP_03603811.1| hypothetical protein BsubsS_06357 [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|255767260|ref|NP_389036.2| oligoendopeptidase F [Bacillus subtilis subsp. subtilis str. 168]
 gi|321314884|ref|YP_004207171.1| oligoendopeptidase F [Bacillus subtilis BSn5]
 gi|238054309|sp|O31605|PEPF_BACSU RecName: Full=Oligoendopeptidase F homolog
 gi|225184887|emb|CAB13011.2| oligoendopeptidase F [Bacillus subtilis subsp. subtilis str. 168]
 gi|320021158|gb|ADV96144.1| oligoendopeptidase F [Bacillus subtilis BSn5]
          Length = 670

 Score =  182 bits (462), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 155/604 (25%), Positives = 290/604 (48%), Gaps = 39/604 (6%)

Query: 39  WNLEDLYPSHDS--QEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYER 96
           W LED++PS ++  +E     E I + S     +++G LA + +      L  A+   ++
Sbjct: 83  WRLEDIFPSDEAWNKEFQAVKELIPNLS-----KYKGKLADSADH-----LYEALTYQDK 132

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADF----EKVLIFFALEINTLDEA 152
           + E +GR+ +YA +  + +    T   FY  +N K  +          +   EI +++E 
Sbjct: 133 VMERLGRLYTYAHMRSDQD----TGNSFYQGLNDKAGNLYTQAASATAYLVPEILSIEED 188

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCEN---- 208
            L+Q   +      YS  I+ I K + H+LS   E LL++ S+V   +   F   N    
Sbjct: 189 KLQQFILEKEELKLYSHAIEEITKERPHVLSEKEEALLAEASEVLGSSSNTFSVLNNADI 248

Query: 209 -IESLRFKINDQKIPLTKAYKSFFDSD-REVRKSAAKALSHTFNKSSHIFSFITNTLAKD 266
              S++ +  ++K      + +F +S+ REVRK+A  A+  T+ +  +  +   +   K 
Sbjct: 249 TFPSIKDEDGNEKQITHGNFINFLESENREVRKNAFDAVYKTYGQYKNTMATTLSGTVKK 308

Query: 267 EEIQDRWRKYEKIADSRHLSNNVEPY-VIEALMQSVKNYYPKTSHRYYELKKKWLKLDTM 325
           +    R +KY K A    LSNN  P  V + L++++  + P   HRY  L+KK L+LD +
Sbjct: 309 DNFYARVKKY-KSAREAALSNNSIPEEVYDNLVKTINKHLP-LLHRYIALRKKVLELDEV 366

Query: 326 YFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGS 385
           + +D   PL   +   + +E A+D +L+  A    + + I ++   + W+D  +  GK +
Sbjct: 367 HIYDLYTPLVKDAGMKVTYEEAKDYMLKGLAPLGEEYASILKEGLENRWVDVYENKGKRN 426

Query: 386 GAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAET 445
           GA++ G     +PYIL+N+     ++ TL HE GH +H   + + Q     N S+ +AE 
Sbjct: 427 GAYSSGAY-GTNPYILMNWHNNVNNLFTLVHEFGHSVHSYYTRKHQPYPYGNYSIFVAEV 485

Query: 446 ASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGD 505
           AS   E L  + LL     +++R  +L + +E    ++ RQ  F +FE  +HT+ +    
Sbjct: 486 ASTTNEALLGEYLLNNLEDEKQRLYILNHMLEGFRGTVFRQTMFAEFEHLIHTKAQEGEP 545

Query: 506 IPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHF---IESSFYVYAYAFGNCLVN 562
           +    +  ++ +  K+  G    + D E G  W  +PHF        Y   Y+    L +
Sbjct: 546 LTPELLTNVYYDLNKKYFGDGM-VIDKEIGLEWSRIPHFYYNYYVYQYATGYSAAQALSS 604

Query: 563 SLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
            +    K   VD    +Y++ L+AG+S++  ++L    ++++ P   E   +  E+ +D+
Sbjct: 605 QILKEGKP-AVD----RYIDFLKAGSSQYPIDVLKKAGVDMTSPEPIEAACKMFEEKLDE 659

Query: 623 VEKM 626
           +E++
Sbjct: 660 MEEL 663


>gi|146318897|ref|YP_001198609.1| oligoendopeptidase F [Streptococcus suis 05ZYH33]
 gi|146321106|ref|YP_001200817.1| oligoendopeptidase F [Streptococcus suis 98HAH33]
 gi|253751974|ref|YP_003025115.1| oligopeptidase [Streptococcus suis SC84]
 gi|253753799|ref|YP_003026940.1| oligopeptidase [Streptococcus suis P1/7]
 gi|253755325|ref|YP_003028465.1| oligopeptidase [Streptococcus suis BM407]
 gi|145689703|gb|ABP90209.1| Oligoendopeptidase F [Streptococcus suis 05ZYH33]
 gi|145691912|gb|ABP92417.1| Oligoendopeptidase F [Streptococcus suis 98HAH33]
 gi|251816263|emb|CAZ51891.1| putative oligopeptidase [Streptococcus suis SC84]
 gi|251817789|emb|CAZ55541.1| putative oligopeptidase [Streptococcus suis BM407]
 gi|251820045|emb|CAR46264.1| putative oligopeptidase [Streptococcus suis P1/7]
 gi|292558557|gb|ADE31558.1| oligoendopeptidase F [Streptococcus suis GZ1]
 gi|319758339|gb|ADV70281.1| oligoendopeptidase F [Streptococcus suis JS14]
          Length = 600

 Score =  182 bits (461), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 149/575 (25%), Positives = 275/575 (47%), Gaps = 26/575 (4%)

Query: 71  WEGNLA--HATNQKNCHSLGAAIAEYERICEL----------IGRIASYAMLSYNCNLSS 118
           WE  LA   A  +K     G  +   + + E+          I ++  YA +  + +   
Sbjct: 26  WEAELADLQAETEKTKEFAGHLLDSAKSLLEISETQLSLMRRIEKLYVYASMKNDQDTRE 85

Query: 119 PTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIK 178
              ++F        A F +   F+  E   + E  LE    ++P  ++YS   + +   K
Sbjct: 86  GKYQEFQAKAMGLYAVFSQAFAFYEPEFMGITEEKLEAFKVEEPALVQYSHQFEKLLAAK 145

Query: 179 KHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF-KINDQK---IPLTKA-YKSFFDS 233
            H+LS ++E +L+ TS++     + F   +  SLRF +I D+    +PL+   Y  F +S
Sbjct: 146 DHVLSQEVEEVLAATSEIFESPAETFSVLDNASLRFPEITDEDGHLVPLSHGNYIHFMES 205

Query: 234 -DREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPY 292
            +R+VR+ A +A+  T+ +  H ++    +  K   ++ R RKY+    +   +N +   
Sbjct: 206 KNRDVRQEAYEAMYGTYEQFQHTYAKTLQSNVKVNNLKARLRKYDSARHASLAANFIPES 265

Query: 293 VIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVL 352
           V + L+ +V  + P   HRY  L+KK L +D +  +D   PL   S  I  +E A     
Sbjct: 266 VYDTLVAAVNKHLP-LLHRYINLRKKLLGIDDLKMYDMYTPLSDFSTKI-SYEDALKKCQ 323

Query: 353 QSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVM 412
           ++   F    S I ++ F + WID    +GK SGA++ G   + + ++LLN+     ++ 
Sbjct: 324 ETLEIFGEDYSAIVKEAFENRWIDVHVNEGKRSGAYSGGAYDT-NAFMLLNWQDNLDNMY 382

Query: 413 TLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILL 472
           TL HE GH +H +L+ +TQ  +  + SL LAE AS   E L  + LL      +ER  +L
Sbjct: 383 TLIHETGHSLHSMLTRKTQPYVYGHYSLFLAEIASTTNENLLTEKLLAEVEDDKERFAIL 442

Query: 473 ANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDL 532
            + ++    ++ RQ  F +FE  ++   +    +    +NE++ +T ++  G + +  + 
Sbjct: 443 NHYLDGFRGTVFRQTQFAEFEQAIYKADQEGQVLTADFLNELYGQTNEKYYGLSAE-ENP 501

Query: 533 EYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYD-IYKSNTVDCFKEKYLNILRAGNSKH 591
           E    W  +PHF   +FYVY YA G    ++L + I   +  D  KE YLN L+AG+S +
Sbjct: 502 EIQFEWARIPHFY-YNFYVYQYATGFAAASALANKIVNGSPED--KENYLNYLKAGSSDY 558

Query: 592 YSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              ++    ++++  ++     +  E  ++++E +
Sbjct: 559 SLNVIAKAGVDMTKEDYLNDAFKVFEARLEELEAL 593


>gi|255279844|ref|ZP_05344399.1| oligoendopeptidase F [Bryantella formatexigens DSM 14469]
 gi|255269617|gb|EET62822.1| oligoendopeptidase F [Bryantella formatexigens DSM 14469]
          Length = 615

 Score =  182 bits (461), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 154/594 (25%), Positives = 271/594 (45%), Gaps = 20/594 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           WN++D+Y   + + ++ D+E +      F +R + +LA +  Q     L  A+   E + 
Sbjct: 30  WNMQDMY--ENEELMAQDVEKLRELMKEFASR-QNSLAKSGEQ-----LLRALKLQEEMN 81

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
            L  ++  YA   Y+ + +    +K   ++     +      +   E+  L +  L + +
Sbjct: 82  CLYEKLHVYANQKYHEDTAEAKYQKLSGEMQILGTELSGCTAWLEPELLALPQQKLAEFF 141

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFK--- 215
           A+ P    Y   ++ I + ++H+L    E LL+  S++G+     F   N   +RF    
Sbjct: 142 AETPELADYRWVVEQIVRQREHVLDVQTEELLAKLSELGQAPANIFSMFNNADIRFPDAV 201

Query: 216 -INDQKIPLTKA--YKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
                  PLT+        DSDR +R+SA  AL   + +  +  +      AK  +I  +
Sbjct: 202 DSAGNAHPLTQGNYIPMLKDSDRVLRRSAFTALYGVYAQYCNTLAATYYANAKQADIFAK 261

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
             K+    +    +N +   V E L+++++ + P   HRY  L+KK L LD ++ +D   
Sbjct: 262 QHKFAGAMEQALSANAIPMAVYENLVKTIREHLP-LMHRYTGLRKKMLGLDELHMYDNYV 320

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           P+    Q   PF  A+++V ++ A      + + ++ F + WID  + +GK +GA++ G 
Sbjct: 321 PIVEMPQKKYPFAEAKEIVKKALAPLGEDYTALLQEGFDNRWIDVYENEGKRTGAYSWGA 380

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
               HPY+LLNY G    V TLAHE+GH +H   S   Q        + +AE AS   E 
Sbjct: 381 Y-GTHPYVLLNYQGTLNAVFTLAHEMGHALHSWHSDHRQPYRYAGYRIFVAEVASTCNEA 439

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPT-HRI 511
           L    LL+ +S + ER  L+   ++    ++ RQ  F +FE+  H +    G + T  ++
Sbjct: 440 LLIHYLLENSSDETERNYLINYFLDQFKGTMYRQTMFAEFEMMTHRDIVQEGGVLTAEKL 499

Query: 512 NEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSN 571
             I+ +  K+  G    +SD E    W  +PHF  + FYVY YA G     ++     + 
Sbjct: 500 CGIYHKLNKDYFGEQM-VSDEEIQYEWARIPHFY-TPFYVYQYATGFAAAIAISSKILAG 557

Query: 572 TVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEK 625
                 EKY   L  G+S    +LL    +++S P      L+  E+ +  +EK
Sbjct: 558 EPGIV-EKYKEFLSGGSSMDPIDLLKICGVDMSSPEPVAAALRVFEEYLGMLEK 610


>gi|225574906|ref|ZP_03783516.1| hypothetical protein RUMHYD_02984 [Blautia hydrogenotrophica DSM
           10507]
 gi|225037874|gb|EEG48120.1| hypothetical protein RUMHYD_02984 [Blautia hydrogenotrophica DSM
           10507]
          Length = 602

 Score =  182 bits (461), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 157/599 (26%), Positives = 265/599 (44%), Gaps = 27/599 (4%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIE-HESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYER 96
           +W ++DLY +    E     E  E    L    +++G LA     K+   L  A+ E +R
Sbjct: 18  QWRIQDLYANESEWE----REYKETQRGLDGYQKFQGRLA-----KSAKVLFEALQERDR 68

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQ 156
           I  L+ R+  YA   Y+ +  +   ++        +   +    F   E+  L E L E+
Sbjct: 69  IQMLLERLYVYANQRYHEDTGNSVYQQLSGRAQNLMVKAQGAFSFLEPELMELTEELFER 128

Query: 157 SYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF-K 215
              ++     Y  +++ I + +KH+LS +ME +++  SQ+       F   N   LRF  
Sbjct: 129 FLEENEKLRLYKRYMEEIFRTRKHVLSKEMEEVMAQVSQIANGPENIFSMFNNADLRFGA 188

Query: 216 INDQK---IPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
           + D++   + LT   Y  F +S DR VRK+A + L  T+ +  +  +       K     
Sbjct: 189 VQDEEGNSVELTHGRYAQFLESSDRSVRKAAFERLYGTYGQFQNTLAATFEANVKQAGFF 248

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
            + R Y     +     N+   V + L+ +V    P   HRY EL+++ L +D ++ +D 
Sbjct: 249 AKMRNYPSARAAALDGGNIPVEVYDQLLTAVHQALPAL-HRYVELRRRLLGVDVLHMYDL 307

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
             PL  + +    FE A+ +V +  A        + +K F   WID  +  GK SGA++ 
Sbjct: 308 YTPLVSSEKKRYSFEQAKAMVKEGLAALGEDYQELLQKGFDEGWIDVYENQGKRSGAYSW 367

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
           G     HPY+LLNY G    V TLAHE+GH +H   S   Q        + +AE AS   
Sbjct: 368 GAY-GTHPYVLLNYNGTLNHVFTLAHEMGHALHSWYSDHAQPYPYAGYRIFVAEVASTCN 426

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E+L    L+  A    E+  L+   +E    ++ RQ  F +FE  +H +      +  + 
Sbjct: 427 ESLLIHDLIGKARDDSEKAYLINYFLEQFRTTVYRQTMFAEFEKIVHEKCALGESLTANV 486

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
           + EI+ E  +   G   ++ D +    W  +PHF  + FYVY YA G     ++      
Sbjct: 487 LCEIYRELNRVYFGEGMEI-DEQIALEWARIPHFY-TPFYVYQYATGFSAAIAI----SQ 540

Query: 571 NTVDC---FKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
             +D      EKY   L  G+S    ELL    ++++ P      L+  E+ ++++E +
Sbjct: 541 KIIDGEPEIVEKYKRFLSGGSSMDPVELLKICGVDMTSPQPVTEALRMFERYLEEMESL 599


>gi|323342907|ref|ZP_08083138.1| M3B subfamily peptidase [Erysipelothrix rhusiopathiae ATCC 19414]
 gi|322462971|gb|EFY08166.1| M3B subfamily peptidase [Erysipelothrix rhusiopathiae ATCC 19414]
          Length = 581

 Score =  182 bits (461), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 149/586 (25%), Positives = 269/586 (45%), Gaps = 18/586 (3%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           WNL+ LY  +D+ + ++D+E +       KT  +     A N  NC  L A I     + 
Sbjct: 4   WNLDALYKGYDA-DYTSDVEKL-------KTIIKSMNDLAPNLTNCKDLEAFITLDSELN 55

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
            L   + S+A L  + N S     +    +   L++  +    F+ +     + +  Q  
Sbjct: 56  TLANSLVSFASLQISANASDNESNRHMGQLQNILSETSRAYALFS-QFMADSKDVFPQWV 114

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
           ++ PL  ++   ++ +  + KH LS D+E ++S  +  G  A  + F         + N 
Sbjct: 115 SESPLVKEHEFILQEMIDLSKHNLSPDVEEVISKLNINGASAWNQLFGHLTSMTTIEFNG 174

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
           +K  +       +  D +VRK A       + K     +F  N++          R YE 
Sbjct: 175 EKHTMASIRNLAYAHDPKVRKDAYYKELELYEKMDDSIAFALNSIKGTVNTISDLRGYES 234

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFW-DRLAPLPGT 337
             +     + +    ++AL+++++ Y P    +Y + K   +  +    W D  AP    
Sbjct: 235 ALEKTLFDSRMSKKTLDALLEAIEAYLP-VFRKYLKHKAHLMNHENGLPWYDLFAPFETK 293

Query: 338 SQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVH 397
           +      E +++++L S+A FS  ++ +A+  +   WID    +GK SGAF         
Sbjct: 294 NPKTYTVEDSKEMILNSFAVFSDDLADMAKTAYEDAWIDFLPREGKRSGAFCSNQSQIKQ 353

Query: 398 PYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDS 457
            Y+L N+ G   D++T+AHELGH  H ++  E   IL  + S+ +AETAS F E + F++
Sbjct: 354 SYVLTNFDGSISDIVTIAHELGHAYHGMM-IEDLPILNTSYSMPVAETASTFCENIVFNA 412

Query: 458 LLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLE 517
            L+ ASS EE+ +L+ N ++D+   IV  +S + FE ++  ERR T  +    + EI +E
Sbjct: 413 ALK-ASSDEEKLVLIENSLQDLTQIIVDILSRFKFESEVF-ERRKTEFLFPKDLKEIMIE 470

Query: 518 TQKESLGPAFDLSDLEYGSFWMMVPHFIES--SFYVYAYAFGNCLVNSLYDIYKSNTVDC 575
            Q+++ G   D S   +   W    H+     S+Y + YAFG      LY  ++    + 
Sbjct: 471 AQRQTYGDGLDASTY-HPYMWACKGHYYSGGLSYYNFPYAFGGLFALGLYAKFEKEG-EA 528

Query: 576 FKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMID 621
           F   Y N+L+A  +    ++    +I+++D +FW+  LQ     I+
Sbjct: 529 FVPAYRNLLKATTTASCEDVAAQADIDVTDVDFWKSSLQVAADRIE 574


>gi|325290081|ref|YP_004266262.1| oligopeptidase F [Syntrophobotulus glycolicus DSM 8271]
 gi|324965482|gb|ADY56261.1| oligopeptidase F [Syntrophobotulus glycolicus DSM 8271]
          Length = 600

 Score =  182 bits (461), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 156/609 (25%), Positives = 287/609 (47%), Gaps = 24/609 (3%)

Query: 26  TMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCH 85
            + +++ +    +W LED++PS D  E +        + +A   ++ G +A + +     
Sbjct: 4   VLKTRDEIAQGDKWKLEDIFPSDDDWETTYKET---EKKIAQAEKYAGKIAESADL---- 56

Query: 86  SLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA-DFEKVLIFFAL 144
            L   +   + +   +  I +YA +  + + +  +I +  TD  A L+      L FF  
Sbjct: 57  -LVECLQWTDELSLGVENIYTYAKMRRDED-NRVSIYQAMTDRAATLSVQAGSALSFFIP 114

Query: 145 EINTL-DEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
           E+ ++ D+   E    QD     Y  +  +I + K+H+LS   E LL++ S++       
Sbjct: 115 ELMSIPDDRFAE--LRQDSRLELYDHYFDHILRRKEHVLSLAEEKLLAEASEMADAPSTI 172

Query: 204 FFCENIESLRF-KINDQK---IPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFS 257
           F   N   L+  +I D++     LTK  +  + +S DR VR+ A   L   + +  + ++
Sbjct: 173 FSMANDADLKLGRIKDEEGREQELTKGNFVKYMESKDRAVRQDAFNTLYSAYGRQINSWA 232

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
            + N   K +    R R Y+    +    + V   V ++L+ SV ++ P+  +RY +L+K
Sbjct: 233 AMLNASVKADCFFARIRHYDSARQAALDDDKVPLSVYDSLISSVHDFLPEM-YRYTKLRK 291

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           K L+L  ++ +D   P+    +  I F  ARD+V +S          + +  ++  WID 
Sbjct: 292 KVLQLSELHMYDIYVPMVAEIETKIDFAEARDMVNKSLQPLGEGYLKVLDSAYSSGWIDT 351

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK SGA++ GT  S HPY+LLNY      V TL HE+GH +H   S++ Q  L   
Sbjct: 352 YENLGKTSGAYSWGTYSS-HPYVLLNYQETLDSVFTLTHEMGHALHSYFSNQKQSHLYAG 410

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
             + +AE AS   E+L    L++  +  + +  L+ + +E    ++ RQ  F +FE  +H
Sbjct: 411 YKIFVAEVASTLNESLLIKYLIEHTNDNKMKAYLINHYLEQFRGTVFRQTMFAEFERDIH 470

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
                   +    ++ ++ E  K+  GP   +SD +    W  +PHF  ++FYVY YA G
Sbjct: 471 AAVEKNEALTAEYLSGMYFELNKKYYGPDV-VSDEQIAMEWSRIPHFY-NAFYVYKYATG 528

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                +L     +      + +YL+ L +G S +  ELL    +++  P   ++GLQ   
Sbjct: 529 FSAATALAQQILNEGEPAVR-RYLDFLGSGGSDYPIELLRKAGVDMEKPEPVKQGLQVFA 587

Query: 618 KMIDDVEKM 626
            M++++E +
Sbjct: 588 SMVNELESL 596


>gi|150019139|ref|YP_001311393.1| oligoendopeptidase F [Clostridium beijerinckii NCIMB 8052]
 gi|149905604|gb|ABR36437.1| oligoendopeptidase F [Clostridium beijerinckii NCIMB 8052]
          Length = 594

 Score =  181 bits (460), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 162/616 (26%), Positives = 289/616 (46%), Gaps = 36/616 (5%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           M+ +  +E + +  +W ++ +Y S +  E   D E +++E++  K  + G L +      
Sbjct: 1   MSDLKKREEIEDKFKWKVDKIYKSIEDWE--KDFEDVKNEAVKLKD-FSGKLVN------ 51

Query: 84  CHSLGAAIAEYERICELIGRIAS----YAMLSYNCNLSSPTIRKFYTDINAKLADFEKVL 139
               G AI +Y +  E + R A     YA L  + + S+ T +   + ++  +A+     
Sbjct: 52  ----GEAILDYLKFNEKVSRKAENLFIYAHLKCDEDTSNTTYQSLMSKVDIYMAELASYT 107

Query: 140 IFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQV--G 197
            FF  EI +LD++ ++    +     ++   I++I K K H+LS +ME LL+  S     
Sbjct: 108 AFFVPEILSLDDSFIKSEINRLDELKQFEFLIEDILKEKPHILSKEMEELLAAASDCLDA 167

Query: 198 REALKRFFCENIESLRFKINDQ---KIPLTKA-YKSFF-DSDREVRKSAAKALSHTFNKS 252
             A+      N +    KI D+   ++ LT+  Y SF    +REVRK+A + L   ++K 
Sbjct: 168 PSAIHNILT-NADMTFGKIEDEDGNEVELTEGNYSSFIRGKNREVRKAAFERLFGEYDKL 226

Query: 253 SHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRY 312
            +  +   +   K      R RKY    ++    NN+   V +  ++ + N    + HRY
Sbjct: 227 KNTLATSLSASIKTFNFSSRVRKYNNALEASLKPNNIPLEVYKNAIKVINNNLD-SLHRY 285

Query: 313 YELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTH 372
            ++KKK L LD ++ +D   P+    ++ I F    ++VL++ +    +   I +    +
Sbjct: 286 VKIKKKLLGLDEIHMYDLYVPVIEIPKEKIEFNDGVNIVLKALSPLGTEYLDIFKSGVNN 345

Query: 373 NWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQG 432
            WID  +  GK  GA++ G   ++ PY+LLNY  +  DV TLAHE+GH IH   S + Q 
Sbjct: 346 GWIDIYENKGKRGGAYSWGGYDTM-PYVLLNYNNELGDVSTLAHEMGHSIHSYYSRKEQP 404

Query: 433 ILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDF 492
               N +L  AE AS   E+L    L++    ++++  L+  ++E +  ++ RQ+ F +F
Sbjct: 405 YYYANYTLFCAEVASTTNESLLIHYLIENEKDEKKKLYLINQELEQIRTTVFRQLMFAEF 464

Query: 493 ELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVY 552
           EL  H        +     N+ W +   +  G    + D E    W  +PHF  S FYVY
Sbjct: 465 ELYTHETLEKGIPLTAEDYNKAWHDLNVKYFGNEI-VIDKEVDVEWSRIPHFY-SDFYVY 522

Query: 553 AYAFGNCLVNSLYDIY---KSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFW 609
            YA G    ++        K N V    EKY   L++G S +   +L    ++++     
Sbjct: 523 QYATGYAAASAFSKAILDGKENAV----EKYKGFLKSGGSDYPINILRNAGVDMTTDVPI 578

Query: 610 ERGLQTVEKMIDDVEK 625
           E  ++   +++D +EK
Sbjct: 579 EATIKRFNELLDMIEK 594


>gi|295702860|ref|YP_003595935.1| oligoendopeptidase F [Bacillus megaterium DSM 319]
 gi|294800519|gb|ADF37585.1| oligoendopeptidase F [Bacillus megaterium DSM 319]
          Length = 605

 Score =  181 bits (460), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 153/600 (25%), Positives = 284/600 (47%), Gaps = 31/600 (5%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKT-RWEGNLAHATNQKNCHSLGAAIAEYERI 97
           W LED++ S D+ E     E  E ++L  +  +++G L      ++  +L  A+ E + +
Sbjct: 22  WKLEDIFASDDAWE----KEFEEVKALIPQMEKFKGKLG-----ESAQTLYDALQEQDEL 72

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKL----ADFEKVLIFFALEINTLDEAL 153
              + ++ +YA + Y+ +    T   FY  +N ++          L +   EI +++E+ 
Sbjct: 73  TMRVSKLYTYAHMRYDQD----TTNSFYQGLNDRIKTLYTQIASALSYVTPEILSIEESK 128

Query: 154 LEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLR 213
           ++Q  A+      Y+  +  I + + H+LS   E LL+  S+V   +   F   N   L 
Sbjct: 129 IKQYMAEHKELKLYAHALDEITRERPHILSESEEALLAQASEVLGSSSNTFGMLNNADLE 188

Query: 214 FKI----NDQKIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSSHIFSFITNTLAKDE 267
           F      N +++ +T   Y  F +S DR VR+ A KA+  T+ K  + F+   +   K +
Sbjct: 189 FPSIKDENGEEVEITHGRYIRFLESSDRRVREEAFKAVYETYGKFKNTFASTLSGTVKKD 248

Query: 268 EIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYF 327
               R R Y     S   +NN+   V + L+++V N      HRY +L+KK L ++ ++ 
Sbjct: 249 NFSARVRHYNSARHSALSTNNIPEEVYDNLVKTV-NDNLHLLHRYIDLRKKVLGIEELHM 307

Query: 328 WDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGA 387
           +D   PL    +  + +E A+D +L+           + ++ F + W+D  +  GK SGA
Sbjct: 308 YDLYTPLVKDVKMEVTYEEAKDYILKGLKPLGEDYLNVLKEGFENRWVDVHENKGKRSGA 367

Query: 388 FAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETAS 447
           ++ GT    +PYIL+N+     ++ TLAHE GH +H   + +TQ     + S+ +AE AS
Sbjct: 368 YSSGTY-GTNPYILMNWQDNVNNLFTLAHEFGHSVHSYYTRKTQPYPYGDYSIFVAEVAS 426

Query: 448 IFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIP 507
              E L  D LL+    +++R  LL + +E    ++ RQ  F +FE  +H   ++   + 
Sbjct: 427 TCNEALLNDYLLKTIDDEKQRLYLLNHYLEGFRGTVFRQTMFAEFEHDVHVRAQNGEPLT 486

Query: 508 THRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHF-IESSFYVYAYAFGNCLVNSLYD 566
              + +++ +  K+  G    + D E G  W  +PHF      Y YA  F      S   
Sbjct: 487 PELLTKLYYDLNKKYFGDNL-VIDEEIGLEWARIPHFYYNYYVYQYATGFSAAAALSKQI 545

Query: 567 IYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           + + N      E+Y+  L++G+S +  E+L    ++++     E  L   E+ + ++E++
Sbjct: 546 LEEGNAA---VERYVGFLKSGSSDYPIEVLKKAGVDMTTSQPIEEALAVFEEKLTEMERL 602


>gi|312112000|ref|YP_003990316.1| oligoendopeptidase F [Geobacillus sp. Y4.1MC1]
 gi|311217101|gb|ADP75705.1| oligoendopeptidase F [Geobacillus sp. Y4.1MC1]
          Length = 604

 Score =  181 bits (460), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 157/621 (25%), Positives = 296/621 (47%), Gaps = 40/621 (6%)

Query: 27  MDSQENLGNLP---------RWNLEDLYPSHDSQEISNDMECIEHESLAFK-TRWEGNLA 76
           MD ++   +LP          W LED++P+ ++ E     E  E + +  K + ++G L 
Sbjct: 1   MDEKKTKKSLPLRSEIPVEETWRLEDIFPTDEAWE----QEFQEVKKMIPKLSDYQGRLG 56

Query: 77  HATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKL---- 132
            + +     +L  A+   ++I   +G++ +YA + Y+ +    T   FY  +N +     
Sbjct: 57  VSAD-----TLYEALQYQDKISMRLGKLYTYAHMRYDQD----TTNAFYQGLNDRATSLY 107

Query: 133 ADFEKVLIFFALEINTLDEALLEQSYAQDPLTLK-YSAWIKNIRKIKKHLLSNDMECLLS 191
           ++    + F   EI  +DEA L +++ ++   LK Y   +  I + + H+LS + E +L+
Sbjct: 108 SEASSAMAFIVPEILAIDEAKL-RAFLEEKKELKLYEHALDEINRQRPHVLSAEEEAILA 166

Query: 192 DTSQVGREALKRFFCENIESLRFKI----NDQKIPLTKA-YKSFFDS-DREVRKSAAKAL 245
             ++V + +   F   N   L F      N +++ +T   +  F +S DR VR+ A KA+
Sbjct: 167 QAAEVMQASSTTFGMLNNADLTFPTIIDENGEEVEVTHGRFIRFLESTDRRVRRDAFKAV 226

Query: 246 SHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYY 305
             T+ K  + F+       K +    R R+Y+   ++   +NN+   V + L++++  + 
Sbjct: 227 YETYEKYKNTFASTLAGAVKKDNFFARVRRYKSAREAALSNNNIPESVYDNLIETIHEHL 286

Query: 306 PKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSII 365
           P   HRY  L+KK L LD ++ +D   PL    +  + +E A++ +L+  A    +   I
Sbjct: 287 P-LLHRYVRLRKKVLGLDELHMYDLYTPLVQDVKMEVTYEEAKEYMLKGLAPLGDEYIRI 345

Query: 366 AEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFV 425
            ++   + W+D  +  GK SGA++ G     +PYILLN+     ++ TL HE GH +H  
Sbjct: 346 VKEGLENRWVDVRENKGKRSGAYSSGAY-GTNPYILLNWQDNVNNLFTLVHEFGHSVHSY 404

Query: 426 LSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVR 485
            + +TQ     N S+ +AE AS   E L  D LL+    +++R  LL   +E    ++ R
Sbjct: 405 YTRKTQPYPYGNYSIFVAEVASTCNEALLNDYLLKTIDDEKKRLYLLNYYLEGFRGTVFR 464

Query: 486 QISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFI 545
           Q  F +FE  +H + +    +    +  ++ E  K+  G    + D E G  W  +PHF 
Sbjct: 465 QTMFAEFEHMIHIKAQEGEALTADSLTSMYYELNKKYFGDDI-VVDKEIGLEWARIPHFY 523

Query: 546 ESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSD 605
            + + VY YA G     +L            K +Y+  L+AG+S +  E+L    ++++ 
Sbjct: 524 YNYY-VYQYATGFSAATALSRQILEEGEPAVK-RYIEFLKAGSSDYPIEVLKKAGVDMTS 581

Query: 606 PNFWERGLQTVEKMIDDVEKM 626
                +  Q   + ++++E++
Sbjct: 582 AEPIRQACQVFAEKLEEMEQL 602


>gi|168206357|ref|ZP_02632362.1| oligoendopeptidase F [Clostridium perfringens E str. JGS1987]
 gi|170662204|gb|EDT14887.1| oligoendopeptidase F [Clostridium perfringens E str. JGS1987]
          Length = 599

 Score =  181 bits (459), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 156/613 (25%), Positives = 292/613 (47%), Gaps = 24/613 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLY--PSHDSQEISNDMECIEHESLAFKTRWEGNLAHAT 79
           S++  +  ++ +    +W ++ +Y  P+  ++E++     ++ E+   K  +EG L    
Sbjct: 2   SEVKKLRRRDEIPESDKWRIDKIYETPAKWNEELNK----LKEEAPKLKD-FEGKLG--- 53

Query: 80  NQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVL 139
              N   L A +   E++   +G++  YA +  + + S+P ++     I+   A+F    
Sbjct: 54  ---NKEDLKAFLLLNEKLSRKLGKLYVYAHMRSHEDTSNPEMQSLVNKIDPYSAEFSSYT 110

Query: 140 IFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQ-VGR 198
            +F  EI +L E  +E    +D    +Y  + + I   K H+LS ++E +L+  S  +G 
Sbjct: 111 AYFVPEILSLKEGTIENFINEDKDLKQYKIYFEMILNEKPHILSKEVESVLASVSDCLGA 170

Query: 199 EALKRFFCENIESLRFKINDQ---KIPLTKA-YKSFFDS-DREVRKSAAKALSHTFNKSS 253
                    N +    +I D+   K+ LT+  Y SF  S DR+VR++A K L  T+ K  
Sbjct: 171 PESIYSMLTNSDMTFGEIVDESGRKVELTEGNYSSFIKSKDRKVREAAFKLLFGTYKKYE 230

Query: 254 HIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY 313
           +  +    +  K+   + + RKY    ++    NN+   V    +++V     +  HRY 
Sbjct: 231 NTLATSLTSSIKNFVFESKTRKYNSSLEAS