PSIBLAST alignment of GI: 254780915 and protein with PDB id: 1y79

>gi|67463890|pdb|1Y79|1 Chain 1, Crystal Structure Of The E.Coli Dipeptidyl Carboxypeptidase Dcp In Complex With A Peptidic Inhibitor Length = 680
 Score =  165 bits (417), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 74/629 (11%), Positives = 153/629 (24%), Gaps = 110/629 (17%)

Query: 72  EGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAK 131
              +A              I   E+  EL+ R+ S        + +   +++     +A+
Sbjct: 39  RAEIAAIALNPQMPDFNNTILALEQSGELLTRVTSVFFAMTAAHTNDE-LQRLDEQFSAE 97

Query: 132 LADFEKVLIFF-------------------ALEINTLDEALLEQSYAQDPLTLKYSAWIK 172
           LA+    +                        E   L E + ++         +      
Sbjct: 98  LAELANDIYLNGELFARVDAVWQRRESLGLDSESIRLVEVIHQRFVLAGAKLAQADKAKL 157

Query: 173 NIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIES---------------LRFKIN 217
            +   +   L++     L   ++ G   +         S               L  K  
Sbjct: 158 KVLNTEAATLTSQFNQRLLAANKSGGLVVNDIAQLAGMSEQEIALAAEAAREKGLDNKWL 217

Query: 218 DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKS-SHIFSFITNTLAKDEEIQDRWRKY 276
              +  T+        DR  R+    A      K+ ++    I   L +    Q     +
Sbjct: 218 IPLLNTTQQPALAEMRDRATREKLFIAGWTRAEKNDANDTRAIIQRLVEIRAQQATLLGF 277

Query: 277 EKIADSRHLSNNVEPYV-----IEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRL 331
              A  +      +        +  ++ + +            +  K     +   WD  
Sbjct: 278 PHYAAWKIADQMAKTPEAALNFMREIVPAARQRASDELASIQAVIDKQQGGFSAQPWDWA 337

Query: 332 APLPGTSQDIIPFEVAR-------------------------------DLVLQSYAKFSP 360
                  ++    + A+                               D+ +        
Sbjct: 338 FYAEQVRREKFDLDEAQLKPYFELNTVLNEGVFWTANQLFGIKFVERFDIPVYHPDVRVW 397

Query: 361 QMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPS-----VHPYILLNYLGK-------- 407
           ++           + D    D K  GA+    +        HP I      +        
Sbjct: 398 EIFDHNGVGLALFYGDFFARDSKSGGAWMGNFVEQSTLNKTHPVIYNVCNYQKPAAGEPA 457

Query: 408 ---PQDVMTLAHELGHGIHFVLS-SETQGILTNNSSLTLAETASIFGETL---------- 453
                DV+TL HE GH +H + +      +   N+     E  S   E            
Sbjct: 458 LLLWDDVITLFHEFGHTLHGLFARQRYATLSGTNTPRDFVEFPSQINEHWATHPQVFARY 517

Query: 454 TFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINE 513
                  AA   E ++ +    + +    +   +S    +++ H    +           
Sbjct: 518 ARHYQSGAAMPDELQQKMRNASLFNKGYEMSELLSAALLDMRWHCLEENEAMQDVDDFE- 576

Query: 514 IWLETQKESLGPAFDLSDLEYGSFWMMVPHFI--ESSFYVYAYAFGNCLVNSLYDIYKSN 571
                 +  +    DL  +          H      +   YAY +   L +  Y  +   
Sbjct: 577 -----LRALVAENMDLPAIPPRYRSSYFAHIFGGGYAAGYYAYLWTQMLADDGYQWFVEQ 631

Query: 572 TV---DCFKEKYLNILRAGNSKHYSELLL 597
                +        IL  GNS+    L  
Sbjct: 632 GGLTRENGLRFREAILSRGNSEDLERLYR 660