PSIBLAST alignment of GI: 254780915 and protein with PDB id: 2o3e

>gi|126031353|pdb|2O3E|A Chain A, Crystal Structure Of Engineered Neurolysin With Thimet Oligopeptidase Specificity For Neurotensin Cleavage Site Length = 678
 Score =  143 bits (360), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 76/687 (11%), Positives = 158/687 (22%), Gaps = 154/687 (22%)

Query: 38  RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERI 97
           RW+L                   E      K  ++     A  +    +    +A+ E  
Sbjct: 26  RWDLSP----------EQIKTRTEQLIAQTKQVYDTVGTIALKEVTYENCLQVLADIEVT 75

Query: 98  CELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTL-------D 150
             +   +  +     +       +R   T+ + KL+ F+  +         +       D
Sbjct: 76  YIVERTMLDFPQHVSS----DREVRAASTEADKKLSRFDIEMSMREDVFQRIVHLQETCD 131

Query: 151 EALL----EQSYAQD----------------PLTLKYSAWIKNIRKIKKHLLSNDMECLL 190
              +     +   +                          +  +       L+ D   L+
Sbjct: 132 LEKIKPEARRYLEKSIKMGKRNGLHLSEHIRNEIKSMKKRMSELCIDFNKNLNEDDTSLV 191

Query: 191 SDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFN 250
              +++G                      K P             E R+    A      
Sbjct: 192 FSKAELGALPDDFIDSLEKTDEDKYKVTLKYPH-YFPVMKKCCVPETRRKMEMAFHTRC- 249

Query: 251 KSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVE-PYVIEALMQSVKNYYPKTS 309
                 + I   L        +   Y   AD     N  +    + A +  +        
Sbjct: 250 --KQENTAILQQLLPLRAQVAKLLGYNTHADFVLELNTAKSTSRVAAFLDDLSQKLKPLG 307

Query: 310 HRYYELKKKWLKLD----------TMYFWDRLAPLPGTSQDIIPFEVA-------RDLVL 352
               E      K +           +  WD    +  T +     +          ++V 
Sbjct: 308 EAEREFILSLKKKECEERGFEYDGKINAWDLHYYMTQTEELKYSVDQESLKEYFPIEVVT 367

Query: 353 QSYAKFSPQMS------------------------IIAEKFFTHNWIDAPQYDGKGSGAF 388
           +       ++                             +     ++D    +GK + A 
Sbjct: 368 EGLLSIYQELLGLSFEQVPDAHVWNKSVSLYTVKDKATGEVLGQFYLDLYPREGKYNHAA 427

Query: 389 AHGTIPSV----------HPYILLNYLGK---------PQDVMTLAHELGHGIHFVLSS- 428
             G  P               +++N+              +V T  HE GH +H + +  
Sbjct: 428 CFGLQPGCLLPDGSRMMSVAALVVNFSQPVAGRPSLLRHDEVETYFHEFGHVMHQICAQT 487

Query: 429 ETQGILTNNSSLTLAETASIFGETLTF----------DSLLQAASSKEERKILLANKIED 478
           +       N      E  S   E   +                  + E  + L+A+++ +
Sbjct: 488 DFARFSGTNVERDFVEVPSQMLENWVWDVDSLRKLSKHYKDGHPITDELLEKLVASRLVN 547

Query: 479 MLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFW 538
                +RQI     +  LHT             +E       +       ++     +  
Sbjct: 548 TGLLTLRQIVLSKVDQSLHTNA------TLDAASE-----YAKYCTEILGVAATPGTNMP 596

Query: 539 MMVPHFIESSFYVYAYA-----------FGNCLVNSLYDI-YKSNT--VDCFKEKYLN-I 583
               H           A           +       ++   +K           KY N I
Sbjct: 597 ATFGHL----------AGGYDGQYYGYLWSEVFSMDMFHSCFKKEGIMNPEVGMKYRNLI 646

Query: 584 LRAGNSKHYSELLLPL-NINLSDPNFW 609
           L+ G S    ++L        +   F 
Sbjct: 647 LKPGGSLDGMDMLQNFLQREPNQKAFL 673