PSIBLAST alignment of GI: 254780915 and protein with PDB id: 2qr4

>gi|157836284|pdb|2QR4|A Chain A, Crystal Structure Of Oligoendopeptidase-F From Enterococcus Faecium Length = 587
>gi|157836285|pdb|2QR4|B Chain B, Crystal Structure Of Oligoendopeptidase-F From Enterococcus Faecium Length = 587
 Score =  403 bits (1036), Expect = e-110,   Method: Composition-based stats.
 Identities = 134/586 (22%), Positives = 255/586 (43%), Gaps = 17/586 (2%)

Query: 47  SHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIAS 106
           S   QE       +  E      + +G L      +       AI    R+      I  
Sbjct: 2   SLSDQEFDEKYLELSEELKQ-SEKHKGTLD-----QGASQFLNAIEFVLRVYRQTEVIYV 55

Query: 107 YAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLK 166
           YA L  + +  +   +  Y   ++  +   + + +F  EI  L +  + Q + ++P    
Sbjct: 56  YAHLKNDQDTGNTDYQALYARASSLFSKVSEAVSWFEPEILQLSDDQIWQYFKEEPKLEV 115

Query: 167 YSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND------QK 220
           Y  +I+ I   + H+LS + E LL+   ++   +   F   N   L F   +       +
Sbjct: 116 YRHYIQQIVDNRAHVLSAEQESLLAGAGEIFDASSDTFAVLNNADLVFPTIEGENGEIVQ 175

Query: 221 IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIA 280
           +      +    +DR VR++A K L   + +  + F+    T  K    + + R Y    
Sbjct: 176 LSHGVYGQLLESTDRRVREAAFKGLYSVYEQFRNTFASTLGTHIKGHNFKAKVRNYSSAR 235

Query: 281 DSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQD 340
           ++   +N++   V + L+    N +    HRY EL+K+ L+++ ++ +D   P+ G +  
Sbjct: 236 EASLSNNHIPESVYDTLVDV-VNKHLPLLHRYXELRKRLLEVEKLHXYDLYTPVLGEAPI 294

Query: 341 IIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYI 400
              +E A++  L++      +   I EK F+  WID  +  GK SGA++ G+    +PYI
Sbjct: 295 TFTYEEAKEKALEALKPXGEEYXAIVEKAFSERWIDVVENKGKRSGAYSSGSYD-TNPYI 353

Query: 401 LLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQ 460
           LLN+      + TL HE GH +H   +   Q  +  + S+ LAE AS   E +  + LL+
Sbjct: 354 LLNWHDTLDQLFTLVHEXGHSVHSYFTRSNQPYVYGDYSIFLAEIASTTNENILTEYLLE 413

Query: 461 AASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQK 520
                  R  +L + ++    ++ RQ  F +FE   HTE      + +  +++ + +   
Sbjct: 414 TEKDPRVRAYVLNHYLDGFKGTVFRQTQFAEFEHFXHTEDEKGVPLTSEYLSDSYGKLNA 473

Query: 521 ESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKY 580
           +  GPA +  D E    W  +PHF   ++YV+ Y+ G    ++L     +   +   E Y
Sbjct: 474 KYYGPAVE-EDPEIKFEWSRIPHFY-YNYYVFQYSTGFSAASALAKKILNQEPEAL-ENY 530

Query: 581 LNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           L  L+AGNS +  E+     ++ +   + E      E+ ++++E++
Sbjct: 531 LAYLKAGNSDYPVEVXKKAGVDXTQAAYIEDAXSXFEQRLNELEEL 576