BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780915|ref|YP_003065328.1| oligoendopeptidase F
[Candidatus Liberibacter asiaticus str. psy62]
         (626 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780915|ref|YP_003065328.1| oligoendopeptidase F [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040592|gb|ACT57388.1| oligoendopeptidase F [Candidatus Liberibacter asiaticus str. psy62]
          Length = 626

 Score =  525 bits (1352), Expect = e-147,   Method: Composition-based stats.
 Identities = 626/626 (100%), Positives = 626/626 (100%)

Query: 1   MTKYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECI 60
           MTKYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECI
Sbjct: 1   MTKYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECI 60

Query: 61  EHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPT 120
           EHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPT
Sbjct: 61  EHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPT 120

Query: 121 IRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKH 180
           IRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKH
Sbjct: 121 IRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKH 180

Query: 181 LLSNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKS 240
           LLSNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKS
Sbjct: 181 LLSNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKS 240

Query: 241 AAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQS 300
           AAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQS
Sbjct: 241 AAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQS 300

Query: 301 VKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSP 360
           VKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSP
Sbjct: 301 VKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSP 360

Query: 361 QMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGH 420
           QMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGH
Sbjct: 361 QMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGH 420

Query: 421 GIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDML 480
           GIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDML
Sbjct: 421 GIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDML 480

Query: 481 NSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMM 540
           NSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMM
Sbjct: 481 NSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMM 540

Query: 541 VPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLN 600
           VPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLN
Sbjct: 541 VPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLN 600

Query: 601 INLSDPNFWERGLQTVEKMIDDVEKM 626
           INLSDPNFWERGLQTVEKMIDDVEKM
Sbjct: 601 INLSDPNFWERGLQTVEKMIDDVEKM 626


>gi|225628561|ref|ZP_03786595.1| oligoendopeptidase, pepF/M3 family protein [Brucella ceti str.
           Cudo]
 gi|225616407|gb|EEH13455.1| oligoendopeptidase, pepF/M3 family protein [Brucella ceti str.
           Cudo]
          Length = 678

 Score =  518 bits (1335), Expect = e-145,   Method: Composition-based stats.
 Identities = 301/624 (48%), Positives = 416/624 (66%), Gaps = 7/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K+  Y F S+A  R     +       + +LGNLP WNL DLYP+ DS ++++D+E    
Sbjct: 60  KFMVYRFSSDAILRAPAADAI---AAKKHDLGNLPEWNLADLYPAPDSPQLASDLEKAMQ 116

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           +S+ F+ RW+G LA    + N  +L  AI E+E + EL+GRI SYA L Y  + + P   
Sbjct: 117 DSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGSYAGLYYYGDTTDPKRM 176

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           K + D   KL D    LIFF LE+N +D+ +LE++  ++P    Y  W+ ++R  K + L
Sbjct: 177 KLFGDAQQKLTDASTPLIFFTLELNRIDDTVLEKAMNENPAIGHYRPWLTDLRMDKPYQL 236

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
            + +E L  + S  G  A  R F E +  LRF+I  +++ +        D+D  VRK A+
Sbjct: 237 DDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLAIEPTLNMLQDADGAVRKQAS 296

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           +AL+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADS+HLSN VE  V++AL ++V+
Sbjct: 297 EALAKTFTANLRTFTLITNTLAKDKEISDRWRGFKDIADSQHLSNRVEREVVDALAKAVE 356

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           + YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P+M
Sbjct: 357 DAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETPQALIPWDEARETVLSAYGNFAPEM 416

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           + IA KFF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGHG+
Sbjct: 417 ADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGHGV 476

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VL+  +QG L  ++ LTLAETAS+FGE LTF  LL+    K ERK +LA K EDM+N+
Sbjct: 477 HQVLAG-SQGALMASTPLTLAETASVFGEMLTFRLLLERTRDKRERKAMLAQKAEDMINT 535

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           +VRQI+FY FE ++HTERR+   + + RI EIW++ Q+ESLG A  L+   Y +FW  +P
Sbjct: 536 VVRQIAFYQFERRVHTERRAGE-LTSERIGEIWMDVQRESLGDAVRLN-PGYETFWTYIP 593

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY  +L+AG +KH+ ELL P  ++
Sbjct: 594 HFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLD 652

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
            SDP FW +GL  +E +ID++E M
Sbjct: 653 ASDPGFWNKGLSVIEGIIDELEAM 676


>gi|237816603|ref|ZP_04595595.1| oligoendopeptidase, pepF/M3 family [Brucella abortus str. 2308 A]
 gi|237787416|gb|EEP61632.1| oligoendopeptidase, pepF/M3 family [Brucella abortus str. 2308 A]
          Length = 678

 Score =  516 bits (1328), Expect = e-144,   Method: Composition-based stats.
 Identities = 300/624 (48%), Positives = 416/624 (66%), Gaps = 7/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K+  Y F S+A  R     +       + +LGNLP WNL DLYP+ DS ++++++E    
Sbjct: 60  KFMVYRFSSDAILRAPAADAI---AAKKHDLGNLPEWNLADLYPAPDSPQLASNLEKAMQ 116

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           +S+ F+ RW+G LA    + N  +L  AI E+E + EL+GRI SYA L Y  + + P   
Sbjct: 117 DSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGSYAGLYYYGDTTDPKRM 176

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           K + D   KL D    LIFF LE+N +D+ +LE++  ++P    Y  W+ ++R  K + L
Sbjct: 177 KLFGDAQQKLTDASTPLIFFTLELNRIDDTVLEKAMNENPAIGHYRPWLTDLRMDKPYQL 236

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
            + +E L  + S  G  A  R F E +  LRF+I  +++ +        D+D  VRK A+
Sbjct: 237 DDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLAIEPTLNMLQDADGAVRKQAS 296

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           +AL+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADS+HLSN VE  V++AL ++V+
Sbjct: 297 EALAKTFTANLRTFTLITNTLAKDKEISDRWRGFKDIADSQHLSNRVEREVVDALAKAVE 356

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           + YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P+M
Sbjct: 357 DAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETPQALIPWDEARETVLSAYGNFAPEM 416

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           + IA KFF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGHG+
Sbjct: 417 ADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGHGV 476

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VL+  +QG L  ++ LTLAETAS+FGE LTF  LL+    K ERK +LA K EDM+N+
Sbjct: 477 HQVLAG-SQGALMASTPLTLAETASVFGEMLTFRLLLERTRDKRERKAMLAQKAEDMINT 535

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           +VRQI+FY FE ++HTERR+   + + RI EIW++ Q+ESLG A  L+   Y +FW  +P
Sbjct: 536 VVRQIAFYQFERRVHTERRAGE-LTSERIGEIWMDVQRESLGDAVRLN-PGYETFWTYIP 593

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY  +L+AG +KH+ ELL P  ++
Sbjct: 594 HFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLD 652

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
            SDP FW +GL  +E +ID++E M
Sbjct: 653 ASDPGFWNKGLSVIEGIIDELEAM 676


>gi|163758860|ref|ZP_02165947.1| putative oligoendopeptidase f protein [Hoeflea phototrophica
           DFL-43]
 gi|162284150|gb|EDQ34434.1| putative oligoendopeptidase f protein [Hoeflea phototrophica
           DFL-43]
          Length = 601

 Score =  514 bits (1323), Expect = e-143,   Method: Composition-based stats.
 Identities = 295/603 (48%), Positives = 409/603 (67%), Gaps = 4/603 (0%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           MT   +   LG+LP WNL+DLYP   S E ++D+     ++  F+ RW+G L  A N   
Sbjct: 1   MTARSADSELGDLPGWNLDDLYPGPQSAEFTSDLSKARTQAADFEARWKGGLKAAVNATA 60

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
              LGAAI  YER+ EL+GRI SYA L+Y  +   P   KFY D+ + + D    ++FFA
Sbjct: 61  DDGLGAAIEAYERLEELMGRIISYAGLTYFTDSVDPAKAKFYGDVQSAITDISAHILFFA 120

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
           LE+N +D+A+++     D    +Y+ WI+++R  K + L + +E L  + S  GR A  R
Sbjct: 121 LELNRIDDAVIDACIDNDSRAARYAPWIRDLRLDKPYQLEDRVEQLFHEKSVTGRAAWNR 180

Query: 204 FFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTL 263
            F E + SL F I+ + +PL        D+D E RK A  AL+ TF ++   F+ ITNTL
Sbjct: 181 LFDETMTSLEFDIDGEHLPLEATLSMLQDADGERRKKAGLALAATFKQNLRTFTLITNTL 240

Query: 264 AKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLD 323
           AKD+EI DRWR +E IADSRHL+N VE  V++AL Q+V+   P+ SHRYY +K +WL L+
Sbjct: 241 AKDKEISDRWRGFEDIADSRHLANRVERPVVDALAQAVREACPRLSHRYYAMKARWLGLE 300

Query: 324 TMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGK 383
            + FWDR APLP T +  IP++ A++ VL +Y  F+P+M+ IA +FF   WIDAP   GK
Sbjct: 301 KLEFWDRNAPLPETPKATIPWDEAKNTVLSAYHGFAPEMADIARRFFDRQWIDAPSRPGK 360

Query: 384 GSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLA 443
            SGAFAH T+PSVHPY+L+NYLGKP+DVMTLAHELGHG+H VL+   QG L  ++ LTLA
Sbjct: 361 TSGAFAHPTVPSVHPYVLVNYLGKPRDVMTLAHELGHGVHQVLAGA-QGALMASTPLTLA 419

Query: 444 ETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRST 503
           ETAS+FGE LTF +LL+    + ERK +LA K+EDM+N++VRQI+FY+FE ++HT RR  
Sbjct: 420 ETASVFGEMLTFRALLERTEDRRERKAMLAQKVEDMINTVVRQIAFYEFERRVHTARREG 479

Query: 504 GDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNS 563
             + + ++ ++WL+ Q ESLGPA +LS+  Y +FW  +PHFI S FYVYAYAFG+CLVNS
Sbjct: 480 E-LTSEQLGKLWLDVQSESLGPAVELSE-GYETFWAYIPHFIHSPFYVYAYAFGDCLVNS 537

Query: 564 LYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDV 623
           LY +Y+    D F+E+Y ++L+AG +KH+SELL P  ++ SDP FW +GL  +E +ID++
Sbjct: 538 LYAVYEKTP-DGFRERYFDMLKAGGTKHHSELLKPFGLDASDPGFWNQGLSMIEGLIDEL 596

Query: 624 EKM 626
           E M
Sbjct: 597 EAM 599


>gi|239834491|ref|ZP_04682819.1| oligoendopeptidase, pepF/M3 family [Ochrobactrum intermedium LMG
           3301]
 gi|239822554|gb|EEQ94123.1| oligoendopeptidase, pepF/M3 family [Ochrobactrum intermedium LMG
           3301]
          Length = 712

 Score =  513 bits (1321), Expect = e-143,   Method: Composition-based stats.
 Identities = 303/626 (48%), Positives = 419/626 (66%), Gaps = 8/626 (1%)

Query: 1   MTKYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECI 60
           MT++ +  FF+NA    A  ++         +LGNLP WNL DLYPS DS E+ ND+E  
Sbjct: 93  MTRFSESVFFNNASHAPAGDAAAAEK----ADLGNLPEWNLGDLYPSADSPELKNDIEKA 148

Query: 61  EHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPT 120
             ++ AF+ RW+G L     + N  +   AI E+E + EL+GRI S+A L Y  + + P 
Sbjct: 149 MKDAAAFEERWKGKLGDEAAKPNGGNFADAIKEFEALDELMGRIGSFAGLYYYGDTTDPK 208

Query: 121 IRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKH 180
             K + D   KL D    LIFF LE+N +D+A+LE++   +     Y  W+ ++R  K +
Sbjct: 209 RMKLFGDTQQKLTDASTHLIFFGLELNRIDDAVLEKAMNDNAAIGHYRPWLTDLRLDKPY 268

Query: 181 LLSNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKS 240
            L + +E L  + S  G  A  R F E +  LRF+I+ +++ +        D+D  VR+ 
Sbjct: 269 QLDDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIDGKELSIEPTLNMLQDADGAVRRK 328

Query: 241 AAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQS 300
           A++AL+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADSRHL+N VE  V++AL ++
Sbjct: 329 ASEALAKTFAANLRTFTLITNTLAKDKEISDRWRGFQDIADSRHLANRVERDVVDALAKA 388

Query: 301 VKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSP 360
           V++ YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P
Sbjct: 389 VEDAYPRLSHRYYALKAKWLGLERLENWDRNAPLPETPQALIPWDDARETVLSAYGNFAP 448

Query: 361 QMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGH 420
           +M+ IA+KFF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGH
Sbjct: 449 EMAEIAKKFFDKNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGH 508

Query: 421 GIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDML 480
           G+H VL+  +QG L  ++ LTLAETAS+FGE LTF SLL A   K ERK +LA K EDM+
Sbjct: 509 GVHQVLAG-SQGALMASTPLTLAETASVFGEMLTFRSLLAATQDKRERKAMLAQKAEDMI 567

Query: 481 NSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMM 540
           N++VRQI+FY FE ++HTERR    +   RI EIW++ Q+ESLG A +L+   Y +FW  
Sbjct: 568 NTVVRQIAFYQFERRVHTERREGE-LTAERIGEIWMDVQRESLGDAVNLN-PGYETFWTY 625

Query: 541 VPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLN 600
           +PHFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY ++L+AG +KH+ ELL P  
Sbjct: 626 IPHFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFDMLKAGGTKHHKELLAPFG 684

Query: 601 INLSDPNFWERGLQTVEKMIDDVEKM 626
           ++ SDP+FW +GL  +E +ID++E M
Sbjct: 685 LDASDPDFWSKGLSVIEGIIDELEAM 710


>gi|254720668|ref|ZP_05182479.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella sp.
           83/13]
 gi|265985718|ref|ZP_06098453.1| pepF/M3 family oligoendopeptidase [Brucella sp. 83/13]
 gi|306838879|ref|ZP_07471708.1| oligoendopeptidase, pepF/M3 family [Brucella sp. NF 2653]
 gi|264664310|gb|EEZ34571.1| pepF/M3 family oligoendopeptidase [Brucella sp. 83/13]
 gi|306406031|gb|EFM62281.1| oligoendopeptidase, pepF/M3 family [Brucella sp. NF 2653]
          Length = 620

 Score =  507 bits (1305), Expect = e-141,   Method: Composition-based stats.
 Identities = 301/624 (48%), Positives = 416/624 (66%), Gaps = 7/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K+  Y F S+A  R     +       + +LGNLP WNL DLYP+ DS +++ D+E    
Sbjct: 2   KFMVYRFSSDAILRAPAADAI---AAKKHDLGNLPEWNLADLYPAPDSPQLAGDLEKAMQ 58

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           +S+ F+ RW+G LA    + N  +L  AI E+E + EL+GRI SYA L Y  + + P   
Sbjct: 59  DSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGSYAGLYYYGDTTDPKRM 118

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           K + D   KL D    LIFF LE+N +D+++LE++  ++P    Y  W+ ++R  K + L
Sbjct: 119 KLFGDAQQKLTDASTPLIFFTLELNRIDDSVLEKAMNENPAIGHYRPWLTDLRMDKPYQL 178

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
            + +E L  + S  G  A  R F E +  LRF+I  +++ +        D+D  VRK A+
Sbjct: 179 DDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLAIEPTLNMLQDADGAVRKQAS 238

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           +AL+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADS+HLSN VE  V++AL ++V+
Sbjct: 239 EALAKTFAANLRTFTLITNTLAKDKEISDRWRGFKDIADSQHLSNRVEREVVDALAKAVE 298

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           + YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P+M
Sbjct: 299 DAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETPQALIPWDEARETVLSAYGNFAPEM 358

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           + IA KFF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGHG+
Sbjct: 359 ADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGHGV 418

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VL+  +QG L  ++ LTLAETAS+FGE LTF  LL+    K ERK +LA K EDM+N+
Sbjct: 419 HQVLAG-SQGALMASTPLTLAETASVFGEMLTFRLLLKRTRDKRERKAMLAQKAEDMINT 477

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           +VRQI+FY FE ++HTERR+   + + RI EIW++ Q+ESLG A  L+   Y +FW  +P
Sbjct: 478 VVRQIAFYQFERRVHTERRAGE-LTSERIGEIWMDVQRESLGDAVRLN-PGYETFWTYIP 535

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY  +L+AG +KH+ ELL P  ++
Sbjct: 536 HFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLD 594

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
            SDP FW +GL  +E +ID++E M
Sbjct: 595 ASDPGFWNKGLSVIEGIIDELEAM 618


>gi|163844280|ref|YP_001621935.1| pepF/M3 family oligoendopeptidase [Brucella suis ATCC 23445]
 gi|163675003|gb|ABY39113.1| oligoendopeptidase, pepF/M3 family [Brucella suis ATCC 23445]
          Length = 620

 Score =  506 bits (1303), Expect = e-141,   Method: Composition-based stats.
 Identities = 301/624 (48%), Positives = 415/624 (66%), Gaps = 7/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K+  Y F S+A  R     +       + +LGNLP WNL DLYP+ DS ++++D+E    
Sbjct: 2   KFMVYRFSSDAILRAPAADAI---AAKKHDLGNLPEWNLADLYPAPDSPQLASDLEKAMQ 58

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           +S+ F+ RW+G LA    + N  +L  AI E+E + EL+GRI SYA L Y  + + P   
Sbjct: 59  DSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGSYAGLYYYGDTTDPKRM 118

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           K + D   KL D    LIFF LE+N +D+ +LE++  ++P    Y  W+ ++R  K + L
Sbjct: 119 KLFGDAQQKLTDASTPLIFFTLELNRIDDTVLEKAMNENPAIGHYRPWLTDLRMDKPYQL 178

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
            + +E L  + S  G  A  R F E +  LRF+I  +++ +        D+D  VRK A+
Sbjct: 179 DDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLAIEPTLNMLQDADGAVRKQAS 238

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           +AL+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADS+HLSN VE  V+ AL ++V+
Sbjct: 239 EALAKTFTANLRTFTLITNTLAKDKEISDRWRGFKDIADSQHLSNRVEREVVNALAKAVE 298

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           + YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P+M
Sbjct: 299 DAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETPQALIPWDEARETVLSAYGNFAPEM 358

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           + IA KFF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGHG+
Sbjct: 359 ADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGHGV 418

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VL+  +QG L  ++ LTLAETAS+FGE LTF  LL+    K ERK +LA K EDM+N+
Sbjct: 419 HQVLAG-SQGALMASTPLTLAETASVFGEMLTFRLLLERTRDKRERKAMLAQKAEDMINT 477

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           +VRQI+FY FE ++HTERR+   + + RI EIW++ Q+ESLG A  L+   Y +FW  +P
Sbjct: 478 VVRQIAFYQFERRVHTERRAGE-LTSERIGEIWMDVQRESLGDAVRLN-PGYETFWTYIP 535

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY  +L+AG +KH+ ELL P  ++
Sbjct: 536 HFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLD 594

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
            SDP FW +GL  +E +ID++E M
Sbjct: 595 ASDPGFWNKGLSVIEGIIDELEAM 618


>gi|254699397|ref|ZP_05161225.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella suis
           bv. 5 str. 513]
 gi|254711351|ref|ZP_05173162.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella
           pinnipedialis B2/94]
 gi|256014877|ref|YP_003104886.1| oligoendopeptidase F [Brucella microti CCM 4915]
 gi|256030020|ref|ZP_05443634.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella
           pinnipedialis M292/94/1]
 gi|256059672|ref|ZP_05449867.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella
           neotomae 5K33]
 gi|256158192|ref|ZP_05456101.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella ceti
           M490/95/1]
 gi|256252866|ref|ZP_05458402.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella ceti
           B1/94]
 gi|260166929|ref|ZP_05753740.1| oligoendopeptidase F [Brucella sp. F5/99]
 gi|261219953|ref|ZP_05934234.1| pepF/M3 family oligoendopeptidase [Brucella ceti B1/94]
 gi|261318954|ref|ZP_05958151.1| pepF/M3 family oligoendopeptidase [Brucella pinnipedialis B2/94]
 gi|261323643|ref|ZP_05962840.1| pepF/M3 family oligoendopeptidase [Brucella neotomae 5K33]
 gi|261749846|ref|ZP_05993555.1| pepF/M3 family oligoendopeptidase [Brucella suis bv. 5 str. 513]
 gi|261756314|ref|ZP_06000023.1| neutral zinc metallopeptidase [Brucella sp. F5/99]
 gi|265987042|ref|ZP_06099599.1| pepF/M3 family oligoendopeptidase [Brucella pinnipedialis
           M292/94/1]
 gi|265996704|ref|ZP_06109261.1| pepF/M3 family oligoendopeptidase [Brucella ceti M490/95/1]
 gi|294853108|ref|ZP_06793780.1| oligoendopeptidase F [Brucella sp. NVSL 07-0026]
 gi|255997537|gb|ACU49224.1| oligoendopeptidase F [Brucella microti CCM 4915]
 gi|260918537|gb|EEX85190.1| pepF/M3 family oligoendopeptidase [Brucella ceti B1/94]
 gi|261298177|gb|EEY01674.1| pepF/M3 family oligoendopeptidase [Brucella pinnipedialis B2/94]
 gi|261299623|gb|EEY03120.1| pepF/M3 family oligoendopeptidase [Brucella neotomae 5K33]
 gi|261736298|gb|EEY24294.1| neutral zinc metallopeptidase [Brucella sp. F5/99]
 gi|261739599|gb|EEY27525.1| pepF/M3 family oligoendopeptidase [Brucella suis bv. 5 str. 513]
 gi|262551001|gb|EEZ07162.1| pepF/M3 family oligoendopeptidase [Brucella ceti M490/95/1]
 gi|264659239|gb|EEZ29500.1| pepF/M3 family oligoendopeptidase [Brucella pinnipedialis
           M292/94/1]
 gi|294818763|gb|EFG35763.1| oligoendopeptidase F [Brucella sp. NVSL 07-0026]
          Length = 620

 Score =  506 bits (1303), Expect = e-141,   Method: Composition-based stats.
 Identities = 301/624 (48%), Positives = 416/624 (66%), Gaps = 7/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K+  Y F S+A  R     +       + +LGNLP WNL DLYP+ DS ++++D+E    
Sbjct: 2   KFMVYRFSSDAILRAPAADAI---AAKKHDLGNLPEWNLADLYPAPDSPQLASDLEKAMQ 58

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           +S+ F+ RW+G LA    + N  +L  AI E+E + EL+GRI SYA L Y  + + P   
Sbjct: 59  DSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGSYAGLYYYGDTTDPKRM 118

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           K + D   KL D    LIFF LE+N +D+ +LE++  ++P    Y  W+ ++R  K + L
Sbjct: 119 KLFGDAQQKLTDASTPLIFFTLELNRIDDTVLEKAMNENPAIGHYRPWLTDLRMDKPYQL 178

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
            + +E L  + S  G  A  R F E +  LRF+I  +++ +        D+D  VRK A+
Sbjct: 179 DDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLAIEPTLNMLQDADGAVRKQAS 238

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           +AL+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADS+HLSN VE  V++AL ++V+
Sbjct: 239 EALAKTFTANLRTFTLITNTLAKDKEISDRWRGFKDIADSQHLSNRVEREVVDALAKAVE 298

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           + YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P+M
Sbjct: 299 DAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETPQALIPWDEARETVLSAYGNFAPEM 358

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           + IA KFF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGHG+
Sbjct: 359 ADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGHGV 418

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VL+  +QG L  ++ LTLAETAS+FGE LTF  LL+    K ERK +LA K EDM+N+
Sbjct: 419 HQVLAG-SQGALMASTPLTLAETASVFGEMLTFRLLLERTRDKRERKAMLAQKAEDMINT 477

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           +VRQI+FY FE ++HTERR+   + + RI EIW++ Q+ESLG A  L+   Y +FW  +P
Sbjct: 478 VVRQIAFYQFERRVHTERRAGE-LTSERIGEIWMDVQRESLGDAVRLN-PGYETFWTYIP 535

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY  +L+AG +KH+ ELL P  ++
Sbjct: 536 HFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLD 594

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
            SDP FW +GL  +E +ID++E M
Sbjct: 595 ASDPGFWNKGLSVIEGIIDELEAM 618


>gi|254711950|ref|ZP_05173761.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella ceti
           M644/93/1]
 gi|254715020|ref|ZP_05176831.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella ceti
           M13/05/1]
 gi|261216723|ref|ZP_05931004.1| pepF/M3 family oligoendopeptidase [Brucella ceti M13/05/1]
 gi|261319590|ref|ZP_05958787.1| pepF/M3 family oligoendopeptidase [Brucella ceti M644/93/1]
 gi|260921812|gb|EEX88380.1| pepF/M3 family oligoendopeptidase [Brucella ceti M13/05/1]
 gi|261292280|gb|EEX95776.1| pepF/M3 family oligoendopeptidase [Brucella ceti M644/93/1]
          Length = 620

 Score =  506 bits (1303), Expect = e-141,   Method: Composition-based stats.
 Identities = 300/624 (48%), Positives = 416/624 (66%), Gaps = 7/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K+  Y F S+A  R     +       + +LGNLP WNL DLYP+ DS ++++D++    
Sbjct: 2   KFMVYRFSSDAILRAPAADAI---AAKKHDLGNLPEWNLADLYPAPDSPQLASDLKKAMQ 58

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           +S+ F+ RW+G LA    + N  +L  AI E+E + EL+GRI SYA L Y  + + P   
Sbjct: 59  DSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGSYAGLYYYGDTTDPKRM 118

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           K + D   KL D    LIFF LE+N +D+ +LE++  ++P    Y  W+ ++R  K + L
Sbjct: 119 KLFGDAQQKLTDASTPLIFFTLELNRIDDTVLEKAMNENPAIGHYRPWLTDLRMDKPYQL 178

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
            + +E L  + S  G  A  R F E +  LRF+I  +++ +        D+D  VRK A+
Sbjct: 179 DDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLAIEPTLNMLQDADGAVRKQAS 238

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           +AL+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADS+HLSN VE  V++AL ++V+
Sbjct: 239 EALAKTFTANLRTFTLITNTLAKDKEISDRWRGFKDIADSQHLSNRVEREVVDALAKAVE 298

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           + YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P+M
Sbjct: 299 DAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETPQALIPWDEARETVLSAYGNFAPEM 358

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           + IA KFF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGHG+
Sbjct: 359 ADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGHGV 418

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VL+  +QG L  ++ LTLAETAS+FGE LTF  LL+    K ERK +LA K EDM+N+
Sbjct: 419 HQVLAG-SQGALMASTPLTLAETASVFGEMLTFRLLLERTRDKRERKAMLAQKAEDMINT 477

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           +VRQI+FY FE ++HTERR+   + + RI EIW++ Q+ESLG A  L+   Y +FW  +P
Sbjct: 478 VVRQIAFYQFERRVHTERRAGE-LTSERIGEIWMDVQRESLGDAVRLN-PGYETFWTYIP 535

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY  +L+AG +KH+ ELL P  ++
Sbjct: 536 HFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLD 594

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
            SDP FW +GL  +E +ID++E M
Sbjct: 595 ASDPGFWNKGLSVIEGIIDELEAM 618


>gi|306845298|ref|ZP_07477873.1| oligoendopeptidase, pepF/M3 family [Brucella sp. BO1]
 gi|306274214|gb|EFM56026.1| oligoendopeptidase, pepF/M3 family [Brucella sp. BO1]
          Length = 620

 Score =  506 bits (1302), Expect = e-141,   Method: Composition-based stats.
 Identities = 301/624 (48%), Positives = 416/624 (66%), Gaps = 7/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K+  Y F S+A  R     +       + +LGNLP WNL DLYP+ DS +++ D+E    
Sbjct: 2   KFMVYRFSSDAILRAPAADAI---AAKKHDLGNLPEWNLADLYPAPDSPQLAGDLEKAMQ 58

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           +S+ F+ RW+G LA    + N  +L  AI E+E + EL+GRI SYA L Y  + + P   
Sbjct: 59  DSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGSYAGLYYYGDTTDPKRM 118

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           K + D   KL D    LIFF LE+N +D+A+LE++  ++P    Y  W+ ++R  K + L
Sbjct: 119 KLFGDAQQKLTDASTPLIFFTLELNRIDDAVLEKAMDENPAIGHYRPWLTDLRMDKPYQL 178

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
            + +E L  + S  G  A  R F E +  LRF+I  +++ +        D+D  VR+ A+
Sbjct: 179 DDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLAIEPTLNMLQDADGTVRRQAS 238

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           +AL+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADS+HLSN VE  V++AL ++V+
Sbjct: 239 EALAKTFAANLRTFTLITNTLAKDKEISDRWRGFKDIADSQHLSNRVEREVVDALAKAVE 298

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           + YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P+M
Sbjct: 299 DAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETPQALIPWDEARETVLSAYGNFAPEM 358

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           + IA KFF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGHG+
Sbjct: 359 ADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGHGV 418

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VL+  +QG L  ++ LTLAETAS+FGE LTF  LL+    K ERK +LA K EDM+N+
Sbjct: 419 HQVLAG-SQGALMASTPLTLAETASVFGEMLTFRLLLERTRDKRERKAMLAQKAEDMINT 477

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           +VRQI+FY FE ++HTERR+   + + RI EIW++ Q+ESLG A  L+   Y +FW  +P
Sbjct: 478 VVRQIAFYQFERRVHTERRAGE-LTSERIGEIWMDVQRESLGDAVRLN-PGYETFWTYIP 535

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY  +L+AG +KH+ ELL P  ++
Sbjct: 536 HFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLD 594

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
            SDP FW +GL  +E +ID++E M
Sbjct: 595 ASDPGFWNKGLSVIEGIIDELEAM 618


>gi|254706358|ref|ZP_05168186.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella
           pinnipedialis M163/99/10]
 gi|261313805|ref|ZP_05953002.1| pepF/M3 family oligoendopeptidase [Brucella pinnipedialis
           M163/99/10]
 gi|261302831|gb|EEY06328.1| pepF/M3 family oligoendopeptidase [Brucella pinnipedialis
           M163/99/10]
          Length = 620

 Score =  505 bits (1300), Expect = e-140,   Method: Composition-based stats.
 Identities = 300/624 (48%), Positives = 415/624 (66%), Gaps = 7/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K+  Y F S+A  R     +       + +LGNLP WNL DLYP+ DS ++++D+E    
Sbjct: 2   KFMVYRFSSDAILRAPAADAI---AAKKHDLGNLPEWNLADLYPAPDSPQLASDLEKAMQ 58

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           +S+ F+ RW+G LA    + N  +L  AI E+E + EL+GRI SYA L Y  + + P   
Sbjct: 59  DSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGSYAGLYYYGDTTDPKRM 118

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           K + D   KL D    LIFF LE+N +D+ +LE++  ++P    Y  W+ ++R  K + L
Sbjct: 119 KLFGDAQQKLTDASTPLIFFTLELNRIDDTVLEKAMNENPAIGHYRPWLTDLRMDKPYQL 178

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
            + +E L  + S  G  A  R F E +  LRF+I  +++ +        D+D  VRK A+
Sbjct: 179 DDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLAIEPTLNMLQDADGAVRKQAS 238

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           + L+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADS+HLSN VE  V++AL ++V+
Sbjct: 239 EVLAKTFTANLRTFTLITNTLAKDKEISDRWRGFKDIADSQHLSNRVEREVVDALAKAVE 298

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           + YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P+M
Sbjct: 299 DAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETPQALIPWDEARETVLSAYGNFAPEM 358

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           + IA KFF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGHG+
Sbjct: 359 ADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGHGV 418

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VL+  +QG L  ++ LTLAETAS+FGE LTF  LL+    K ERK +LA K EDM+N+
Sbjct: 419 HQVLAG-SQGALMASTPLTLAETASVFGEMLTFRLLLERTRDKRERKAMLAQKAEDMINT 477

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           +VRQI+FY FE ++HTERR+   + + RI EIW++ Q+ESLG A  L+   Y +FW  +P
Sbjct: 478 VVRQIAFYQFERRVHTERRAGE-LTSERIGEIWMDVQRESLGDAVRLN-PGYETFWTYIP 535

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY  +L+AG +KH+ ELL P  ++
Sbjct: 536 HFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLD 594

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
            SDP FW +GL  +E +ID++E M
Sbjct: 595 ASDPGFWNKGLSVIEGIIDELEAM 618


>gi|306841140|ref|ZP_07473856.1| oligoendopeptidase, pepF/M3 family [Brucella sp. BO2]
 gi|306288766|gb|EFM60084.1| oligoendopeptidase, pepF/M3 family [Brucella sp. BO2]
          Length = 620

 Score =  505 bits (1299), Expect = e-140,   Method: Composition-based stats.
 Identities = 299/624 (47%), Positives = 413/624 (66%), Gaps = 7/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K+  Y F S+A  R     +       + +LGNLP WNL DLYP+ DS +++ D+E    
Sbjct: 2   KFMVYRFSSDAILRAPAADAI---AAKKHDLGNLPEWNLADLYPAPDSPQLAGDLEKAMQ 58

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           +S+ F+ RW+G LA    + N  +L  AI E+E + EL+GRI SYA L Y  + + P   
Sbjct: 59  DSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGSYAGLYYYGDTTDPKRM 118

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           K + D   KL D    LIFF LE+N +D+ +LE++  ++P    Y  W+ ++R  K + L
Sbjct: 119 KLFGDAQQKLTDASTPLIFFTLELNRIDDTVLEKAMNENPAIGHYRPWLTDLRMDKPYQL 178

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
            + +E L  + S  G  A  R F E +  LRF+I  +++ +        D+D  VR+ A+
Sbjct: 179 DDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLAIEPTLNMLQDADGAVRRQAS 238

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           +AL+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADS+HLSN VE  V++AL ++V+
Sbjct: 239 EALAKTFAANLRTFTLITNTLAKDKEISDRWRGFKDIADSQHLSNRVEREVVDALAKAVE 298

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           + YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P+M
Sbjct: 299 DAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETPQALIPWDEARETVLSAYGNFAPEM 358

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           + IA KFF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGH +
Sbjct: 359 ADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGHSV 418

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VL+  +QG L  ++ LTLAETAS+FGE LTF  LL+    K ERK +LA K EDM+N+
Sbjct: 419 HQVLAG-SQGALMASTPLTLAETASVFGEMLTFRLLLERTRDKRERKAMLAQKAEDMINT 477

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           +VRQI+FY FE ++HTERR+   + + RI EIW+  Q+ESLG A  L+   Y +FW  +P
Sbjct: 478 VVRQIAFYQFERRVHTERRAGE-LTSERIGEIWMNVQRESLGDAVRLN-PGYETFWTYIP 535

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY  +L+AG +KH+ ELL P  ++
Sbjct: 536 HFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLD 594

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
            SDP FW +GL  +E +ID++E M
Sbjct: 595 ASDPGFWNKGLSVIEGIIDELEAM 618


>gi|148558781|ref|YP_001257157.1| oligoendopeptidase F [Brucella ovis ATCC 25840]
 gi|148370066|gb|ABQ62938.1| oligoendopeptidase F [Brucella ovis ATCC 25840]
          Length = 620

 Score =  504 bits (1298), Expect = e-140,   Method: Composition-based stats.
 Identities = 299/624 (47%), Positives = 416/624 (66%), Gaps = 7/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K+  Y F S+A  R     +       + +LGNLP WNL DLYP+ DS ++++D+E    
Sbjct: 2   KFMVYRFSSDAILRAPAADAI---AAKKHDLGNLPEWNLADLYPAPDSPQLASDLEKAMQ 58

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           +S+ F+ RW+G LA    + N  +L  AI E+E + EL+GRI SYA L Y  + + P   
Sbjct: 59  DSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGSYAGLYYYGDTTDPKRM 118

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           K + D   KL D    LIFF LE+N +D+ +LE++  ++P    Y  W+ ++R  K + L
Sbjct: 119 KLFGDAQQKLTDASTPLIFFTLELNRIDDTVLEKAMNENPAIGHYRPWLTDLRMDKPYQL 178

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
            + +E L  + S  G  A  R F E +  L+F+I  +++ +        D+D  VRK A+
Sbjct: 179 DDKLEQLFHEKSITGYSAWNRLFDETMSGLQFEIGGEQLAIEPTLNMLQDADGAVRKQAS 238

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           +AL+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADS+HLSN VE  V++AL ++V+
Sbjct: 239 EALAKTFTANLRTFTLITNTLAKDKEISDRWRGFKDIADSQHLSNRVEREVVDALAKAVE 298

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           + YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P+M
Sbjct: 299 DAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETPQALIPWDEARETVLSAYGNFAPEM 358

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           + IA KFF  NWI+AP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGHG+
Sbjct: 359 ADIARKFFDRNWINAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGHGV 418

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VL+  +QG L  ++ LTLAETAS+FGE LTF  LL+    K ERK +LA K EDM+N+
Sbjct: 419 HQVLAG-SQGALMASTPLTLAETASVFGEMLTFRLLLERTRDKRERKAMLAQKAEDMINT 477

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           +VRQI+FY FE ++HTERR+   + + RI EIW++ Q+ESLG A  L+   Y +FW  +P
Sbjct: 478 VVRQIAFYQFERRVHTERRAGE-LTSERIGEIWMDVQRESLGDAVRLN-PGYETFWTYIP 535

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY  +L+AG +KH+ ELL P  ++
Sbjct: 536 HFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLD 594

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
            SDP FW +GL  +E +ID++E M
Sbjct: 595 ASDPGFWNKGLSVIEGIIDELEAM 618


>gi|225685947|ref|YP_002733919.1| oligoendopeptidase, pepF/M3 family protein [Brucella melitensis
           ATCC 23457]
 gi|256261840|ref|ZP_05464372.1| neutral zinc metallopeptidase [Brucella melitensis bv. 2 str. 63/9]
 gi|225642052|gb|ACO01965.1| oligoendopeptidase, pepF/M3 family protein [Brucella melitensis
           ATCC 23457]
 gi|263091315|gb|EEZ15851.1| neutral zinc metallopeptidase [Brucella melitensis bv. 2 str. 63/9]
 gi|326410269|gb|ADZ67333.1| oligoendopeptidase, pepF/M3 family protein [Brucella melitensis
           M28]
 gi|326553562|gb|ADZ88201.1| oligoendopeptidase, pepF/M3 family protein [Brucella melitensis
           M5-90]
          Length = 620

 Score =  504 bits (1298), Expect = e-140,   Method: Composition-based stats.
 Identities = 301/624 (48%), Positives = 416/624 (66%), Gaps = 7/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K+  Y F S+A  R     +       + +LGNLP WNL DLYP+ DS ++++D+E    
Sbjct: 2   KFMVYRFSSDAILRAPAADAI---AAKKHDLGNLPEWNLADLYPAPDSPQLASDLEKAMQ 58

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           +S+ F+ RW+G LA    + N  +L  AI E+E + EL+GRI SYA L Y  + + P   
Sbjct: 59  DSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGSYAGLYYYGDTTDPKRM 118

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           K + D   KL D    LIFF LE+N +D+ +LE++  ++P    Y  W+ ++R  K + L
Sbjct: 119 KLFGDAQQKLTDASTPLIFFTLELNCIDDTVLEKAMNENPAIGHYRPWLTDLRMDKPYQL 178

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
            + +E L  + S  G  A  R F E +  LRF+I  +++ +        D+D  VRK A+
Sbjct: 179 DDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLAIEPTLNMLQDADGAVRKQAS 238

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           +AL+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADS+HLSN VE  V++AL ++V+
Sbjct: 239 EALAKTFTANLRTFTLITNTLAKDKEISDRWRGFKDIADSQHLSNRVEREVVDALAKAVE 298

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           + YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P+M
Sbjct: 299 DAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETPQALIPWDEARETVLSAYGNFAPEM 358

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           + IA KFF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGHG+
Sbjct: 359 ADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGHGV 418

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VL+  +QG L  ++ LTLAETAS+FGE LTF  LL+    K ERK +LA K EDM+N+
Sbjct: 419 HQVLAG-SQGALMASTPLTLAETASVFGEMLTFRLLLERTRDKRERKAMLAQKAEDMINT 477

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           +VRQI+FY FE ++HTERR+   + + RI EIW++ Q+ESLG A  L+   Y +FW  +P
Sbjct: 478 VVRQIAFYQFERRVHTERRAGE-LTSERIGEIWMDVQRESLGDAVRLN-PGYETFWTYIP 535

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY  +L+AG +KH+ ELL P  ++
Sbjct: 536 HFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLD 594

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
            SDP FW +GL  +E +ID++E M
Sbjct: 595 ASDPGFWNKGLSVIEGIIDELEAM 618


>gi|254561919|ref|YP_003069014.1| oligoendopeptidase F [Methylobacterium extorquens DM4]
 gi|254269197|emb|CAX25163.1| putative oligoendopeptidase F [Methylobacterium extorquens DM4]
          Length = 625

 Score =  504 bits (1297), Expect = e-140,   Method: Composition-based stats.
 Identities = 288/597 (48%), Positives = 384/597 (64%), Gaps = 6/597 (1%)

Query: 31  ENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS-LGA 89
            +LG LP W+L DLYPS D+    +D++  E ES AF  R+ G +A      +  S LG 
Sbjct: 31  ADLGVLPEWDLTDLYPSMDAPAFRDDLDRAEAESRAFAERYAGRIAEIAAGPDASSVLGE 90

Query: 90  AIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTL 149
           A+  +ERI +L+GR+ SYA L Y+ + +  T  KFY D   +L      L+FF LE+N +
Sbjct: 91  AVQTFERIEDLMGRLMSYAGLVYSGDTTDETRAKFYGDTRERLTTASGDLLFFGLELNRV 150

Query: 150 DEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENI 209
           ++A+L+ + A  P    Y  WI+++R+ K H L +  E L  D S     A  R F E I
Sbjct: 151 EDAVLDAAMADGP-LAHYRPWIEDLRREKPHQLDDRTEKLFLDKSVTSNAAWDRLFNETI 209

Query: 210 ESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEI 269
            SLRF +  +++ L        DSD  VR+ AA+AL  T   +  IF+ ITNTLAKD+EI
Sbjct: 210 ASLRFSVQGERLTLEPTLNKLVDSDGAVRQEAAQALGETLRANLRIFTLITNTLAKDKEI 269

Query: 270 QDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWD 329
            DRWR ++ +AD+RHLSN VEP V+ A++++V+  YP+ SHRYY LK KW  ++ + +WD
Sbjct: 270 SDRWRGFKDVADARHLSNRVEPEVVAAMVEAVRAAYPRLSHRYYRLKAKWFGVEALPYWD 329

Query: 330 RLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFA 389
           R APLP   Q  IP+  ARD VL++Y  FSP M+ IA+KFF   WIDAP   GK  GAFA
Sbjct: 330 RNAPLPKVEQRTIPWAQARDTVLEAYDAFSPDMAGIAKKFFDGGWIDAPTRPGKAPGAFA 389

Query: 390 HGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIF 449
           H T+PS HPY+L+NY GKP+DVMTLAHELGHG+H VL++   G L   + LTLAETAS+F
Sbjct: 390 HPTVPSAHPYVLVNYQGKPRDVMTLAHELGHGVHQVLAAPN-GALMAPTPLTLAETASVF 448

Query: 450 GETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTH 509
           GE LTF  LL   +   +R+ +LA K+EDM+N++VRQI+FY FE K+H   R+ G++   
Sbjct: 449 GEMLTFQRLLGQTTDPTQRRAMLAAKVEDMINTVVRQIAFYSFERKVH-LARAKGELTAE 507

Query: 510 RINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYK 569
           +INE+W+  Q ESLGPA  L D  Y  FW  +PHFI S FYVYAYAFG+CLVNSLY +Y 
Sbjct: 508 QINELWMSVQSESLGPAITL-DKGYEPFWAYIPHFIHSPFYVYAYAFGDCLVNSLYGVYA 566

Query: 570 SNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
                 F E+Y  +L AG SK Y ELL P  ++ SDP FW+ GL  +E MI ++E M
Sbjct: 567 RA-EPGFVERYFALLSAGGSKPYGELLKPFGLDASDPGFWQIGLGMIEGMIAELEAM 622


>gi|327188780|gb|EGE55974.1| oligoendopeptidase F protein [Rhizobium etli CNPAF512]
          Length = 779

 Score =  504 bits (1297), Expect = e-140,   Method: Composition-based stats.
 Identities = 291/594 (48%), Positives = 403/594 (67%), Gaps = 4/594 (0%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           LG+LP W L+DLYPS  S     DME     ++AF+ RW+G LA A  +     +GAA+ 
Sbjct: 187 LGDLPVWKLQDLYPSATSTAFVADMEKAGKAAIAFEQRWKGKLADAATKAGAEGIGAALK 246

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
           EYE + +++GR+ S+A L+Y  + ++P   K Y D+ AK+ +F   L+FFALE+N +D+ 
Sbjct: 247 EYEALDDIMGRLGSFAGLTYFSDTTNPANGKLYGDVQAKITEFSGHLLFFALELNRIDDT 306

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
           +++ S A DP    Y  W+ ++RK K + L + +E L  + S     A  R F E +  L
Sbjct: 307 VIDASIANDPDAGHYRPWLIDLRKDKPYQLDDRLEQLFLEKSMTSAAAFNRLFDETMAEL 366

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           R++I+  K+PL  A     + D EVR+ AA AL+ TF  +  IF+ ITNTLAKD++I DR
Sbjct: 367 RYEIDGAKVPLEVALNMLQEKDPEVRRKAAMALAETFKANIRIFTLITNTLAKDKDISDR 426

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR +E IADSRHL+N VE  V++AL  +V+  YP+ SHRYY++K KWL ++ M FWDR A
Sbjct: 427 WRGFEDIADSRHLANRVEREVVDALAAAVREAYPRLSHRYYKMKAKWLGMEQMNFWDRNA 486

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP TS  +I +  A+D VL +Y  F+P+M+ IA +FF   WIDAP   GK  GAFAH T
Sbjct: 487 PLPETSSAVISWSDAKDTVLSAYGNFAPEMADIARRFFDEQWIDAPVRPGKAPGAFAHPT 546

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +PS HPY+L+NY+GKP+DVMTLAHELGHG+H VL+   QG L   + LTLAETAS+FGE 
Sbjct: 547 VPSAHPYVLVNYMGKPRDVMTLAHELGHGVHQVLAGA-QGALMCQTPLTLAETASVFGEM 605

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF +LL+  +   ERK +LA K+EDM+N++VRQI+FY+FE KLHT  R +G++    I 
Sbjct: 606 LTFRALLEKTTDSRERKAMLAQKVEDMINTVVRQIAFYEFERKLHTA-RKSGELTADDIG 664

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
           E+WL  Q ESLGPA  +S+  Y ++W  +PHFI S FYVYAYAFG+CLVNSLY +Y+   
Sbjct: 665 ELWLSVQSESLGPAISISE-GYETYWAYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQKA- 722

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              F+EKY  +L+AG +KH+SELL P  ++ +DP+FW  GL  +E +ID++E +
Sbjct: 723 EKGFQEKYFELLKAGGTKHHSELLKPFGLDATDPSFWSHGLSMIEGLIDELEAL 776


>gi|256112010|ref|ZP_05452955.1| oligoendopeptidase, pepF/M3 family protein [Brucella melitensis bv.
           3 str. Ether]
 gi|265993456|ref|ZP_06106013.1| pepF/M3 family oligoendopeptidase [Brucella melitensis bv. 3 str.
           Ether]
 gi|262764326|gb|EEZ10358.1| pepF/M3 family oligoendopeptidase [Brucella melitensis bv. 3 str.
           Ether]
          Length = 620

 Score =  504 bits (1297), Expect = e-140,   Method: Composition-based stats.
 Identities = 301/624 (48%), Positives = 416/624 (66%), Gaps = 7/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K+  Y F S+A  R     +       + +LGNLP WNL DLYP+ DS ++++D+E    
Sbjct: 2   KFMVYRFSSDAILRAPAADAI---AAKKHDLGNLPEWNLADLYPAPDSPQLASDLEKAMQ 58

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           +S+ F+ RW+G LA    + N  +L  AI E+E + EL+GRI SYA L Y  + + P   
Sbjct: 59  DSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGSYAGLYYYGDTTDPKRM 118

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           K + D   KL D    LIFF LE+N +D+ +LE++  ++P    Y  W+ ++R  K + L
Sbjct: 119 KLFGDAQQKLTDASTPLIFFTLELNCIDDTVLEKAMNENPAIGHYRPWLTHLRMDKPYQL 178

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
            + +E L  + S  G  A  R F E +  LRF+I  +++ +        D+D  VRK A+
Sbjct: 179 DDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLAIEPTLNMLQDADGAVRKQAS 238

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           +AL+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADS+HLSN VE  V++AL ++V+
Sbjct: 239 EALAKTFTANLRTFTLITNTLAKDKEISDRWRGFKDIADSQHLSNRVEREVVDALAKAVE 298

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           + YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P+M
Sbjct: 299 DAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETPQALIPWDEARETVLSAYGNFAPEM 358

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           + IA KFF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGHG+
Sbjct: 359 ADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGHGV 418

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VL+  +QG L  ++ LTLAETAS+FGE LTF  LL+    K ERK +LA K EDM+N+
Sbjct: 419 HQVLAG-SQGALMASTPLTLAETASVFGEMLTFRLLLERTRDKRERKAMLAQKAEDMINT 477

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           +VRQI+FY FE ++HTERR+   + + RI EIW++ Q+ESLG A  L+   Y +FW  +P
Sbjct: 478 VVRQIAFYQFERRVHTERRAGE-LTSERIGEIWMDVQRESLGDAVRLN-PGYETFWTYIP 535

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY  +L+AG +KH+ ELL P  ++
Sbjct: 536 HFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLD 594

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
            SDP FW +GL  +E +ID++E M
Sbjct: 595 ASDPGFWNKGLSVIEGIIDELEAM 618


>gi|23499848|ref|NP_699288.1| oligoendopeptidase F [Brucella suis 1330]
 gi|161620171|ref|YP_001594057.1| pepF/M3 family oligoendopeptidase [Brucella canis ATCC 23365]
 gi|254702515|ref|ZP_05164343.1| pepF/M3 family oligoendopeptidase [Brucella suis bv. 3 str. 686]
 gi|260568579|ref|ZP_05839048.1| neutral zinc metallopeptidase [Brucella suis bv. 4 str. 40]
 gi|261753088|ref|ZP_05996797.1| pepF/M3 family oligoendopeptidase [Brucella suis bv. 3 str. 686]
 gi|23463419|gb|AAN33293.1| oligoendopeptidase F [Brucella suis 1330]
 gi|161336982|gb|ABX63286.1| oligoendopeptidase, pepF/M3 family [Brucella canis ATCC 23365]
 gi|260155244|gb|EEW90325.1| neutral zinc metallopeptidase [Brucella suis bv. 4 str. 40]
 gi|261742841|gb|EEY30767.1| pepF/M3 family oligoendopeptidase [Brucella suis bv. 3 str. 686]
          Length = 620

 Score =  504 bits (1297), Expect = e-140,   Method: Composition-based stats.
 Identities = 300/624 (48%), Positives = 415/624 (66%), Gaps = 7/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K+  Y F S+A  R     +       + +LGNLP WNL DLYP+ DS ++++D+E    
Sbjct: 2   KFMVYRFSSDAILRAPAADAI---AAKKHDLGNLPEWNLADLYPAPDSPQLASDLEKAMQ 58

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           +S+ F+ RW+G LA    + N  +L  AI E+E + EL+GRI SYA L Y  + + P   
Sbjct: 59  DSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGSYAGLYYYGDTTDPKRM 118

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           K + D   KL D    LIFF LE+N +D+ +LE++  ++P    Y  W+ ++R  K + L
Sbjct: 119 KLFGDAQQKLTDASTPLIFFTLELNRIDDTVLEKAMNENPAIGHYRPWLTDLRMDKPYQL 178

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
            + +E L  + S  G  A  R F E +  LRF+I  +++ +        D+D  VRK A+
Sbjct: 179 DDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLAIEPTLNMLQDADGAVRKQAS 238

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           +AL+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADS+HLSN VE  V++AL ++V+
Sbjct: 239 EALAKTFTANLRTFTLITNTLAKDKEISDRWRGFKDIADSQHLSNRVEREVVDALAKAVE 298

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           + YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P+M
Sbjct: 299 DAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETPQALIPWDEARETVLSAYGNFAPEM 358

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           + IA KFF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP +VMTLAHELGHG+
Sbjct: 359 ADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPHNVMTLAHELGHGV 418

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VL+  +QG L  ++ LTLAETAS+FGE LTF  LL+    K ERK +LA K EDM+N+
Sbjct: 419 HQVLAG-SQGALMASTPLTLAETASVFGEMLTFRLLLERTRDKRERKAMLAQKAEDMINT 477

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           +VRQI+FY FE ++HTERR+   + + RI EIW++ Q+ESLG A  L+   Y +FW  +P
Sbjct: 478 VVRQIAFYQFERRVHTERRAGE-LTSERIGEIWMDVQRESLGDAVRLN-PGYETFWTYIP 535

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY  +L+AG +KH+ ELL P  ++
Sbjct: 536 HFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLD 594

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
            SDP FW +GL  +E +ID++E M
Sbjct: 595 ASDPGFWNKGLSVIEGIIDELEAM 618


>gi|240139505|ref|YP_002963980.1| putative oligoendopeptidase F [Methylobacterium extorquens AM1]
 gi|240009477|gb|ACS40703.1| putative oligoendopeptidase F [Methylobacterium extorquens AM1]
          Length = 625

 Score =  504 bits (1297), Expect = e-140,   Method: Composition-based stats.
 Identities = 288/596 (48%), Positives = 382/596 (64%), Gaps = 6/596 (1%)

Query: 32  NLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS-LGAA 90
           +LG LP W+L DLYPS D+     D++  E ES AF  R+ G +A      +  S LG A
Sbjct: 32  DLGVLPEWDLTDLYPSMDAPAFREDLDRAEAESRAFAERYAGRIAEIAAGPDASSVLGEA 91

Query: 91  IAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLD 150
           +  +ERI +L+GR+ SYA L Y+ + +  T  KFY D   +L      L+FF LE+N ++
Sbjct: 92  VQTFERIEDLMGRLMSYAGLVYSGDTTDETRAKFYGDTRERLTTASGDLLFFGLELNRVE 151

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIE 210
           +A+L+ + A  P    Y  WI+++R+ K H L +  E L  D S     A  R F E I 
Sbjct: 152 DAVLDAAMADGP-LAHYRPWIEDLRREKPHQLDDRTEKLFLDKSVTSNAAWDRLFNETIA 210

Query: 211 SLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
           SLRF +  +++ L        DSD  VR+ AA+AL  T   +  IF+ ITNTLAKD+EI 
Sbjct: 211 SLRFSVQGERLTLEPTLNKLVDSDGAVRQEAAQALGETLRANLRIFTLITNTLAKDKEIS 270

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
           DRWR ++ +AD+RHLSN VEP V+ A++++V+  YP+ SHRYY LK KW  ++ + +WDR
Sbjct: 271 DRWRGFKDVADARHLSNRVEPEVVAAMVEAVRAAYPRLSHRYYRLKAKWFGVEALPYWDR 330

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
            APLP   Q  IP+  ARD VL++Y  FSP M+ IA KFF   WIDAP   GK  GAFAH
Sbjct: 331 NAPLPKVEQRTIPWAQARDTVLEAYDAFSPDMAGIARKFFDGGWIDAPTRPGKAPGAFAH 390

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
            T+PS HPY+L+NY GKP+DVMTLAHELGHG+H VL++   G L   + LTLAETAS+FG
Sbjct: 391 PTVPSAHPYVLVNYQGKPRDVMTLAHELGHGVHQVLAAPN-GALMAPTPLTLAETASVFG 449

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E LTF  LL   +   +R+ +LA K+EDM+N++VRQI+FY FE K+H   R+ G++   +
Sbjct: 450 EMLTFQRLLGQTTDPTQRRAMLAAKVEDMINTVVRQIAFYSFERKVH-LARAKGELTAEQ 508

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
           INE+W+  Q ESLGPA  L D  Y  FW  +PHFI S FYVYAYAFG+CLVNSLY +Y  
Sbjct: 509 INELWMSVQSESLGPAITL-DKGYEPFWAYIPHFIHSPFYVYAYAFGDCLVNSLYGVYAR 567

Query: 571 NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
                F E+Y  +L AG SK Y ELL P  ++ SDP FW+ GL  +E MI ++E M
Sbjct: 568 A-EPGFVERYFALLSAGGSKPYGELLKPFGLDASDPGFWQIGLGMIEGMIAELESM 622


>gi|319781622|ref|YP_004141098.1| oligoendopeptidase, pepF/M3 family [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167510|gb|ADV11048.1| oligoendopeptidase, pepF/M3 family [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 610

 Score =  504 bits (1297), Expect = e-140,   Method: Composition-based stats.
 Identities = 298/596 (50%), Positives = 400/596 (67%), Gaps = 4/596 (0%)

Query: 31  ENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAA 90
             LG+LP WNL DLY   D+ E+  D+     ++ +F++RW+G LA    +     LG A
Sbjct: 17  AELGDLPEWNLADLYAGMDAPELKRDIAKAATDATSFESRWKGTLAAEAERGGAGRLGEA 76

Query: 91  IAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLD 150
           +  YE + ELIGRI SYA L Y  N + P   K Y DI  K+ D    L+FFALE+N +D
Sbjct: 77  LVAYEALEELIGRIVSYAGLVYAGNTADPQRAKLYGDIQEKMTDASAHLLFFALELNLID 136

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIE 210
           +A +E + A DP    Y  W+ ++RK K + L + +E L  + S  GR A  R F E + 
Sbjct: 137 DASIEGALAVDPAFGHYRPWVLDLRKDKPYQLEDRVEQLFHEKSITGRGAWNRLFDETMT 196

Query: 211 SLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
            LRF I+ +++ L  A     D+D EVR+ A++AL+ TF K+   F+ ITNTLAKD+EI 
Sbjct: 197 DLRFHIDGEELTLEPALNRLQDADGEVRRRASEALATTFRKNLRTFTLITNTLAKDKEIS 256

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
           DRWR +E IADSRHL+N VE  V++AL  +V++ YP+ SHRYY +K +WL ++ M  WDR
Sbjct: 257 DRWRGFEDIADSRHLANRVERSVVDALASAVRDAYPRLSHRYYAMKARWLGMEVMNHWDR 316

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
            APLP T Q II ++ AR+ VL +Y +FSP M+ IA  FF  NWIDAP   GK  GAFAH
Sbjct: 317 NAPLPDTPQAIIGWDEARNTVLSAYQRFSPDMAEIARTFFDRNWIDAPVRPGKSPGAFAH 376

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
            T+PS HPY+LLNY+GKP+DVMTLAHELGHG+H VL+   QG L  ++ LTLAETAS+FG
Sbjct: 377 PTVPSAHPYVLLNYMGKPRDVMTLAHELGHGVHQVLAG-GQGALMASTPLTLAETASVFG 435

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E LTF SLL   + + ERK +LA K+EDM+N++VRQI+FY+FE K+H E R  G++ + R
Sbjct: 436 EMLTFRSLLDQTTDRRERKAMLAQKVEDMINTVVRQIAFYEFERKVHAE-RKNGELTSDR 494

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
           + + WLE Q ESLGPA  L +  Y  FW  +PHFI S FYVYAYAFG+CLVNSLY +Y+ 
Sbjct: 495 LGQFWLEVQAESLGPAIKLRE-GYEVFWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQ- 552

Query: 571 NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           N    F++KY  +LRAG +KH+SELL P  ++ +DP FW+ GL  +  +ID++E +
Sbjct: 553 NAERGFQDKYFEMLRAGGTKHHSELLAPFGLDATDPAFWQIGLGVIGGLIDELEAL 608


>gi|217978714|ref|YP_002362861.1| oligoendopeptidase, pepF/M3 family [Methylocella silvestris BL2]
 gi|217504090|gb|ACK51499.1| oligoendopeptidase, pepF/M3 family [Methylocella silvestris BL2]
          Length = 620

 Score =  504 bits (1297), Expect = e-140,   Method: Composition-based stats.
 Identities = 283/613 (46%), Positives = 385/613 (62%), Gaps = 5/613 (0%)

Query: 14  FFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEG 73
            F     ++  +  +   +LG+LP WNL  LYP+ DS E + D+     E  AF   ++G
Sbjct: 9   IFHGPEAAARQSAANPSVDLGDLPEWNLSALYPAPDSPEFAGDLARAATECKAFAEAFKG 68

Query: 74  NLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA 133
            +A      +  SL AA+  YE + EL+GRI SYA L Y  + S P   KFY D   K+ 
Sbjct: 69  RIAELAADSSGASLTAAVKHYEALDELLGRIMSYAGLIYAGDTSDPVRAKFYGDAQEKIT 128

Query: 134 DFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDT 193
           +    L+FF LE+N LD+  L+ + AQ+P    Y  WI+++RK K + LS+++E L  + 
Sbjct: 129 NASSDLLFFELELNRLDDGALDAALAQEP-LAHYRPWIEDVRKGKPYQLSDELEKLFHEK 187

Query: 194 SQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSS 253
           S     A  R F E I +LRF ++ +++ +        D +   R+ AAK L      + 
Sbjct: 188 SSTSYSAWNRLFDETITALRFPLDGKELSIEPVLNLLQDPNEAAREKAAKILGSVLKDNL 247

Query: 254 HIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY 313
             F+ ITNTLAKD+EI DRWR ++ +ADSRHLSN VE  V++AL+ +V+  YP+ SHRYY
Sbjct: 248 RQFALITNTLAKDKEISDRWRGFQDVADSRHLSNRVEREVVDALVGAVRAAYPRLSHRYY 307

Query: 314 ELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHN 373
            LK KW     + FWDR APLP     +  ++ ARD VL +Y  FSP+M+ IA +FF   
Sbjct: 308 RLKAKWFGKPALKFWDRNAPLPDAPARVYKWDAARDAVLGAYGDFSPKMADIARRFFDER 367

Query: 374 WIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGI 433
           WIDAP   GK  GAFAH T+PS HP++LLNY GKP+DVMTLAHELGHG+H VL++   G 
Sbjct: 368 WIDAPVRPGKSPGAFAHPTVPSAHPFVLLNYQGKPRDVMTLAHELGHGVHQVLAAHN-GA 426

Query: 434 LTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFE 493
           L   + LTLAETAS+FGE LTF +LL  A +  ER+ +LA K+EDMLN++VRQI+FY FE
Sbjct: 427 LMAPTPLTLAETASVFGEMLTFRALLARAGTLAERRAMLAGKVEDMLNTVVRQIAFYSFE 486

Query: 494 LKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYA 553
            K+HTERR    +    + + W+E Q ESLGPA + +D +Y S+W  +PHFI S FYVYA
Sbjct: 487 RKVHTERRKGE-LTADNLCDFWMEEQSESLGPAIEFTD-DYRSYWAYIPHFIHSPFYVYA 544

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YAFG+CLVNSLY +Y+ N  + F E+Y  +L AG SK Y ELL P  ++  DP FW+ GL
Sbjct: 545 YAFGDCLVNSLYGVYQ-NASEGFAERYFALLSAGGSKPYGELLKPFGLDARDPAFWQIGL 603

Query: 614 QTVEKMIDDVEKM 626
             +E MI ++E +
Sbjct: 604 SMIEGMIAELEAL 616


>gi|163852173|ref|YP_001640216.1| pepF/M3 family oligoendopeptidase [Methylobacterium extorquens PA1]
 gi|163663778|gb|ABY31145.1| oligoendopeptidase, pepF/M3 family [Methylobacterium extorquens
           PA1]
          Length = 625

 Score =  503 bits (1296), Expect = e-140,   Method: Composition-based stats.
 Identities = 288/596 (48%), Positives = 383/596 (64%), Gaps = 6/596 (1%)

Query: 32  NLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS-LGAA 90
           +LG LP W+L DLYPS D+     D++  E ES AF  R+ G +A      +  S LG A
Sbjct: 32  DLGVLPEWDLTDLYPSMDAPAFREDLDRAEAESRAFAERYAGRIAEIAAGPDASSVLGEA 91

Query: 91  IAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLD 150
           +  +ERI +L+GR+ SYA L Y+ + +  T  KFY D   +L      L+FF LE+N ++
Sbjct: 92  VQTFERIEDLMGRLMSYAGLVYSGDTTDETRAKFYGDTRERLTTASGDLLFFGLELNRVE 151

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIE 210
           +A+L+ + A  P    Y  WI+++R+ K H L +  E L  D S     A  R F E I 
Sbjct: 152 DAVLDAAMADGP-LAHYRPWIEDLRREKPHQLDDRTEKLFLDKSVTSNAAWDRLFNETIA 210

Query: 211 SLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
           SLRF +  +++ L        DSD  VR+ AA+AL  T   +  IF+ ITNTLAKD+EI 
Sbjct: 211 SLRFSVQGERLTLEPTLNKLVDSDGAVRQEAAQALGETLRANLRIFTLITNTLAKDKEIS 270

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
           DRWR ++ +AD+RHLSN VEP V+ A++++V+  YP+ SHRYY LK KW  ++ + +WDR
Sbjct: 271 DRWRGFKDVADARHLSNRVEPEVVAAMVEAVRAAYPRLSHRYYRLKAKWFGVEALPYWDR 330

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
            APLP   Q  IP+  ARD VL++Y  FSP M+ IA+KFF   WIDAP   GK  GAFAH
Sbjct: 331 NAPLPKVEQRTIPWAQARDTVLEAYDAFSPDMAGIAKKFFDGGWIDAPTRPGKAPGAFAH 390

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
            T+PS HPY+L+NY GKP+DVMTLAHELGHG+H VL++   G L   + LTLAETAS+FG
Sbjct: 391 PTVPSAHPYVLVNYQGKPRDVMTLAHELGHGVHQVLAAPN-GALMAPTPLTLAETASVFG 449

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E LTF  LL   +   +R+ +LA K+EDM+N++VRQI+FY FE K+H   R+ G++   +
Sbjct: 450 EMLTFQRLLGQTTDPTQRRAMLAAKVEDMINTVVRQIAFYSFERKVH-LARAKGELTAEQ 508

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
           INE+W+  Q ESLGPA  L D  Y  FW  +PHFI S FYVYAYAFG+CLVNSLY +Y  
Sbjct: 509 INELWMSVQSESLGPAITL-DKGYEPFWAYIPHFIHSPFYVYAYAFGDCLVNSLYGVYAR 567

Query: 571 NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
                F E+Y  +L AG SK Y ELL P  ++ SDP FW+ GL  +E MI ++E M
Sbjct: 568 A-EPGFVERYFALLSAGGSKPYGELLKPFGLDASDPGFWQIGLGMIEGMIAELEAM 622


>gi|62317040|ref|YP_222893.1| PepF, oligoendopeptidase F [Brucella abortus bv. 1 str. 9-941]
 gi|83269034|ref|YP_418325.1| peptidase M3 [Brucella melitensis biovar Abortus 2308]
 gi|189022307|ref|YP_001932048.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella
           abortus S19]
 gi|254691476|ref|ZP_05154730.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella
           abortus bv. 6 str. 870]
 gi|254695228|ref|ZP_05157056.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella
           abortus bv. 3 str. Tulya]
 gi|254698327|ref|ZP_05160155.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|254731770|ref|ZP_05190348.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella
           abortus bv. 4 str. 292]
 gi|256256661|ref|ZP_05462197.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella
           abortus bv. 9 str. C68]
 gi|260544276|ref|ZP_05820097.1| neutral zinc metallopeptidase [Brucella abortus NCTC 8038]
 gi|260757096|ref|ZP_05869444.1| pepF/M3 family oligoendopeptidase [Brucella abortus bv. 6 str. 870]
 gi|260759534|ref|ZP_05871882.1| pepF/M3 family oligoendopeptidase [Brucella abortus bv. 4 str. 292]
 gi|260762778|ref|ZP_05875110.1| pepF/M3 family oligoendopeptidase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260882905|ref|ZP_05894519.1| pepF/M3 family oligoendopeptidase [Brucella abortus bv. 9 str. C68]
 gi|261215590|ref|ZP_05929871.1| pepF/M3 family oligoendopeptidase [Brucella abortus bv. 3 str.
           Tulya]
 gi|297250016|ref|ZP_06933717.1| oligoendopeptidase F [Brucella abortus bv. 5 str. B3196]
 gi|62197233|gb|AAX75532.1| PepF, oligoendopeptidase F [Brucella abortus bv. 1 str. 9-941]
 gi|82939308|emb|CAJ12246.1| Peptidase M3:Neutral zinc metallopeptidases, zinc-binding region
           [Brucella melitensis biovar Abortus 2308]
 gi|189020881|gb|ACD73602.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella
           abortus S19]
 gi|260097547|gb|EEW81421.1| neutral zinc metallopeptidase [Brucella abortus NCTC 8038]
 gi|260669852|gb|EEX56792.1| pepF/M3 family oligoendopeptidase [Brucella abortus bv. 4 str. 292]
 gi|260673199|gb|EEX60020.1| pepF/M3 family oligoendopeptidase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260677204|gb|EEX64025.1| pepF/M3 family oligoendopeptidase [Brucella abortus bv. 6 str. 870]
 gi|260872433|gb|EEX79502.1| pepF/M3 family oligoendopeptidase [Brucella abortus bv. 9 str. C68]
 gi|260917197|gb|EEX84058.1| pepF/M3 family oligoendopeptidase [Brucella abortus bv. 3 str.
           Tulya]
 gi|297173885|gb|EFH33249.1| oligoendopeptidase F [Brucella abortus bv. 5 str. B3196]
          Length = 620

 Score =  503 bits (1296), Expect = e-140,   Method: Composition-based stats.
 Identities = 300/624 (48%), Positives = 416/624 (66%), Gaps = 7/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K+  Y F S+A  R     +       + +LGNLP WNL DLYP+ DS ++++++E    
Sbjct: 2   KFMVYRFSSDAILRAPAADAI---AAKKHDLGNLPEWNLADLYPAPDSPQLASNLEKAMQ 58

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           +S+ F+ RW+G LA    + N  +L  AI E+E + EL+GRI SYA L Y  + + P   
Sbjct: 59  DSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGSYAGLYYYGDTTDPKRM 118

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           K + D   KL D    LIFF LE+N +D+ +LE++  ++P    Y  W+ ++R  K + L
Sbjct: 119 KLFGDAQQKLTDASTPLIFFTLELNRIDDTVLEKAMNENPAIGHYRPWLTDLRMDKPYQL 178

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
            + +E L  + S  G  A  R F E +  LRF+I  +++ +        D+D  VRK A+
Sbjct: 179 DDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLAIEPTLNMLQDADGAVRKQAS 238

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           +AL+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADS+HLSN VE  V++AL ++V+
Sbjct: 239 EALAKTFTANLRTFTLITNTLAKDKEISDRWRGFKDIADSQHLSNRVEREVVDALAKAVE 298

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           + YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P+M
Sbjct: 299 DAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETPQALIPWDEARETVLSAYGNFAPEM 358

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           + IA KFF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGHG+
Sbjct: 359 ADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGHGV 418

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VL+  +QG L  ++ LTLAETAS+FGE LTF  LL+    K ERK +LA K EDM+N+
Sbjct: 419 HQVLAG-SQGALMASTPLTLAETASVFGEMLTFRLLLERTRDKRERKAMLAQKAEDMINT 477

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           +VRQI+FY FE ++HTERR+   + + RI EIW++ Q+ESLG A  L+   Y +FW  +P
Sbjct: 478 VVRQIAFYQFERRVHTERRAGE-LTSERIGEIWMDVQRESLGDAVRLN-PGYETFWTYIP 535

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY  +L+AG +KH+ ELL P  ++
Sbjct: 536 HFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLD 594

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
            SDP FW +GL  +E +ID++E M
Sbjct: 595 ASDPGFWNKGLSVIEGIIDELEAM 618


>gi|86359140|ref|YP_471032.1| oligoendopeptidase F protein [Rhizobium etli CFN 42]
 gi|86283242|gb|ABC92305.1| oligoendopeptidase F protein [Rhizobium etli CFN 42]
          Length = 699

 Score =  503 bits (1295), Expect = e-140,   Method: Composition-based stats.
 Identities = 290/594 (48%), Positives = 406/594 (68%), Gaps = 4/594 (0%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           LG+LP W L+DLYPS  S     DME     ++AF+ +W+G LA A        +GAA+ 
Sbjct: 107 LGDLPVWKLQDLYPSATSTAFVADMEKAGKAAIAFEEKWKGKLAEAAVMTGAEGIGAALK 166

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
           EYE + +++GR+ S+A L+Y  + ++P   K Y D+ AK+ +F   L+FFALE+N +D+A
Sbjct: 167 EYEALDDIMGRLGSFAGLTYFSDTTNPANGKLYGDVQAKITEFSGHLLFFALELNRIDDA 226

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
           +++   A+DP    Y  W+ ++RK K + L + +E L  + S     A  R F E +  L
Sbjct: 227 VIDACMAKDPDAGHYRPWLIDLRKDKPYQLDDRLEQLFLEKSMTSASAFNRLFDETMAEL 286

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           R++I+ +K+PL  A     + D EVR+ AA AL+ TF  +  IF+ ITNTLAKD++I DR
Sbjct: 287 RYEIDGEKVPLEVALNMLQEKDPEVRRKAAMALAETFKANIRIFTLITNTLAKDKDISDR 346

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR +E IADSRHL+N VE  V++AL  +V+  YP+ SHRYY++K KWL ++ M FWDR A
Sbjct: 347 WRGFEDIADSRHLANRVEREVVDALAAAVREAYPRLSHRYYKMKAKWLGMEQMNFWDRNA 406

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP TS  +I +  A+D VL +Y  F+ +M+ IA +FF   WIDAP   GK  GAFAH T
Sbjct: 407 PLPETSSAVISWSDAKDTVLSAYGNFAAEMADIARRFFDEQWIDAPVRPGKAPGAFAHPT 466

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +PS HPY+L+NY+GKP+DVMTLAHELGHG+H VL+   QG L   + LTLAETAS+FGE 
Sbjct: 467 VPSAHPYVLVNYMGKPRDVMTLAHELGHGVHQVLAGA-QGALMCQTPLTLAETASVFGEM 525

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF +LL+  + + ERK +LA K+EDM+N++VRQI+FY+FE KLHT  R  G++    I 
Sbjct: 526 LTFRALLEKTTDRRERKAMLAQKVEDMINTVVRQIAFYEFERKLHTA-RKAGELTAEDIG 584

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
           E+WL  Q ESLGPA ++S+  Y ++W  +PHFI S FYVYAYAFG+CLVNSLY +Y+  T
Sbjct: 585 ELWLSVQSESLGPAINISE-GYETYWAYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQK-T 642

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              F+EKY  +L+AG +KH+SELL P  ++ +DP+FW +GL  +E +ID++E +
Sbjct: 643 EKGFQEKYFELLKAGGTKHHSELLKPFGLDATDPSFWSQGLSMIEGLIDELETL 696


>gi|254504890|ref|ZP_05117041.1| oligoendopeptidase, pepF/M3 family [Labrenzia alexandrii DFL-11]
 gi|222440961|gb|EEE47640.1| oligoendopeptidase, pepF/M3 family [Labrenzia alexandrii DFL-11]
          Length = 606

 Score =  503 bits (1295), Expect = e-140,   Method: Composition-based stats.
 Identities = 274/596 (45%), Positives = 394/596 (66%), Gaps = 6/596 (1%)

Query: 31  ENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAA 90
             LG+LP W+L DLYPS D+ ++++D++     +  F+  ++G LA      N  +L  A
Sbjct: 16  AELGDLPVWDLTDLYPSVDAPKVTSDLKEALDRAKTFEASYKGRLADLAAN-NVAALVTA 74

Query: 91  IAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLD 150
           I  YE + +L+GR+ S+A L Y  N +    +KFY D+  ++      L+FF+LE+N ++
Sbjct: 75  IRAYEDLEDLMGRLISFAGLVYAGNTTDAAAQKFYGDVQEQITTASSHLLFFSLELNRIE 134

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIE 210
           +A+++ +  +D     Y  WI+++RK K + L + +E L  + S  G  A  R F E + 
Sbjct: 135 DAVVDAAL-EDAHLAHYRPWIEDLRKDKPYQLEDRVEQLFHEKSVTGSSAWNRLFDETMA 193

Query: 211 SLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
            L F ++ +++P+ +      D   E R+ A+KAL+ TF+K+   F+ ITNTL KD+EI 
Sbjct: 194 RLTFTVSGEELPVEQTLNLLTDPSPEKREEASKALTETFSKNLSTFALITNTLTKDKEIS 253

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
           DRWR +  IADSRHL+N VE  V++A++ +V+  YP+ SHRYY+LK KWL +D +  WDR
Sbjct: 254 DRWRNFSDIADSRHLANRVEREVVDAMVSAVREAYPRLSHRYYKLKAKWLGVDQLNTWDR 313

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
            APLP     IIP+  A+D VL +Y  FSP M+ IA +FF   WIDAP   GK  GAFAH
Sbjct: 314 NAPLPDADTRIIPWAEAKDTVLSAYNTFSPDMAEIASRFFDKGWIDAPARSGKAPGAFAH 373

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
            T+PS HPY+L+NY GK +DVMTLAHELGHG+H VL+     ++   + LTLAETAS+FG
Sbjct: 374 PTVPSAHPYVLVNYQGKVRDVMTLAHELGHGVHQVLAGPNGPLM-APTPLTLAETASVFG 432

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E LTF SLL  A   + +K++LA+K EDM+N++VRQI+FY FE KLHTERR+   +   +
Sbjct: 433 EMLTFKSLLAKAEDPKTKKVMLASKAEDMINTVVRQIAFYTFERKLHTERRNGE-LTADK 491

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
           I E+WL  Q ESLGPA  L+   Y +FW  +PHFI S FYVYAYAFG+CLVNSLY +Y+ 
Sbjct: 492 IGELWLSVQGESLGPAIKLN-AGYETFWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVYEE 550

Query: 571 NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
                F+EKY  +L+AG +KH+SELL P  ++ +DP+FW++GL  +E++ID++E +
Sbjct: 551 A-ETGFQEKYFELLKAGGTKHHSELLKPFGLDATDPDFWKKGLSVIERLIDELETL 605


>gi|153011575|ref|YP_001372789.1| pepF/M3 family oligoendopeptidase [Ochrobactrum anthropi ATCC
           49188]
 gi|151563463|gb|ABS16960.1| oligoendopeptidase, pepF/M3 family [Ochrobactrum anthropi ATCC
           49188]
          Length = 620

 Score =  503 bits (1295), Expect = e-140,   Method: Composition-based stats.
 Identities = 298/626 (47%), Positives = 414/626 (66%), Gaps = 8/626 (1%)

Query: 1   MTKYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECI 60
           MT++ +   F+      A  +    T     +LGNLP WNL DLYPS DS E+ ND+E  
Sbjct: 1   MTRFSESVSFNKVLHAPASDAVAAETT----DLGNLPEWNLGDLYPSADSAELKNDIEKA 56

Query: 61  EHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPT 120
             ++ AF+ RW+G L     + N  +   AI E+E + EL+GRI S+A L Y  + S P 
Sbjct: 57  MKDAAAFEERWKGKLGDEAAKTNGGNFVDAIREFEALDELMGRIGSFAGLYYYGDTSDPK 116

Query: 121 IRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKH 180
             K + D+  KL D    LIFF LE+N +++A+LE++ + +     Y  W+ ++R  K +
Sbjct: 117 RMKLFGDVQQKLTDASTHLIFFGLELNRIEDAVLEKAMSDNAAIGHYRPWLTDLRMDKPY 176

Query: 181 LLSNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKS 240
            L + +E L  + S  G  A  R F E +  LRF+I+ +++ +        D+D  VRK 
Sbjct: 177 QLDDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIDGKELSIEPTLNMLQDADGAVRKK 236

Query: 241 AAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQS 300
           A+ AL+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADSRHL+N VE  V++AL ++
Sbjct: 237 ASDALAKTFAANLRTFTLITNTLAKDKEISDRWRGFQDIADSRHLANRVEREVVDALAKA 296

Query: 301 VKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSP 360
           V++ YP+ SHRYY LK KWL L+ +  WDR APLP T Q +I ++ AR+ VL +Y  F+P
Sbjct: 297 VEDAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETPQALISWDEARETVLSAYGNFAP 356

Query: 361 QMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGH 420
           +M+ IA+ FF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGH
Sbjct: 357 EMAAIAKDFFDKNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGH 416

Query: 421 GIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDML 480
           G+H +L+   QG L  ++ LTLAETAS+FGE LTF SLL+    K ERK +LA K EDM+
Sbjct: 417 GVHQILAG-GQGALMASTPLTLAETASVFGEMLTFRSLLERTKDKRERKAMLAQKAEDMI 475

Query: 481 NSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMM 540
           N++VRQI+FY FE ++HTERR    +   RI EIW++ Q+ESLG A +L+   Y +FW  
Sbjct: 476 NTVVRQIAFYQFERRVHTERREGE-LTAERIGEIWMDVQRESLGDAVNLN-PGYETFWTY 533

Query: 541 VPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLN 600
           +PHFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY ++L+AG +KH+ ELL P  
Sbjct: 534 IPHFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFDMLKAGGTKHHKELLAPFG 592

Query: 601 INLSDPNFWERGLQTVEKMIDDVEKM 626
           ++ SDP+FW +GL  +E +ID++E M
Sbjct: 593 LDASDPDFWSKGLSVIEGIIDELEAM 618


>gi|84515397|ref|ZP_01002759.1| Oligoendopeptidase F [Loktanella vestfoldensis SKA53]
 gi|84510680|gb|EAQ07135.1| Oligoendopeptidase F [Loktanella vestfoldensis SKA53]
          Length = 601

 Score =  502 bits (1293), Expect = e-140,   Method: Composition-based stats.
 Identities = 281/593 (47%), Positives = 376/593 (63%), Gaps = 8/593 (1%)

Query: 34  GNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAE 93
           G+LP W+L DLYPS DS EI+ DM  +E E  AF   +EG LA      +   L  A+  
Sbjct: 17  GDLPEWDLTDLYPSPDSPEITRDMAWLETECAAFAADYEGKLASL----DAAGLLGAVQR 72

Query: 94  YERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEAL 153
           YE+I  + GRI S+A L Y    +     KF  D   ++  F   L+F+ LE N LD+  
Sbjct: 73  YEQIDVIAGRIMSFAGLRYYQITTDSDRAKFMADCQDRITRFTTPLVFYGLEFNRLDDTH 132

Query: 154 LEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLR 213
           L    A +    +Y      +R +K H LS+++E  L D S VG  A  R F E +  L 
Sbjct: 133 LAGLLAANADLARYKPVFDRMRAMKPHQLSDELEKFLHDQSTVGAAAWNRLFDETMAGLE 192

Query: 214 FKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRW 273
           F ++   + L        D DR  R++A  AL+  F ++  IF+ + NTLAK++EI DRW
Sbjct: 193 FVVDGDVLSLEGTLNLLTDPDRAKREAATHALTAVFRENIKIFARVHNTLAKEKEIHDRW 252

Query: 274 RKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAP 333
           RK      +RHL+N+VEP V+EAL  +V   YP+ SHRYY LK KWL LD M  WDR AP
Sbjct: 253 RKMPSPQAARHLANHVEPEVVEALRNAVVAAYPRLSHRYYALKAKWLGLDRMQVWDRNAP 312

Query: 334 LPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTI 393
           LP     +I +E ARD VL +YA F P+M+ IA +FF   WIDA    GK  GAFAH T+
Sbjct: 313 LPMDQTRVIGWEEARDTVLTAYAGFDPRMAEIAGRFFDKGWIDAATKPGKAPGAFAHPTV 372

Query: 394 PSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETL 453
             VHPY++LNYLGKP+DVMTLAHELGHG+H VL++E QG L +++ LTLAETAS+FGE L
Sbjct: 373 TPVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAE-QGELLSSTPLTLAETASVFGEML 431

Query: 454 TFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINE 513
           TF  L   A + ++RK+LLA K+EDM+N++VRQI+FYDFE KLH   R+ G++    IN 
Sbjct: 432 TFRQLRDTAKTPQDRKVLLAGKVEDMINTVVRQIAFYDFECKLHAA-RAEGELTPEDINA 490

Query: 514 IWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTV 573
           +W+  Q ESLGP FD +D  Y +FW  +PHF+ S FYVYAYAFG+ LVN+LY +++    
Sbjct: 491 LWMSVQAESLGPVFDFAD-GYETFWAYIPHFVHSPFYVYAYAFGDGLVNALYAVFEEGDA 549

Query: 574 DCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           D F++KY  +LRAG SKH+ +LL P  ++ SDP FW++GL  +E MID++E +
Sbjct: 550 D-FRDKYFAMLRAGGSKHHKDLLAPFGLDASDPAFWDKGLALIESMIDELEAL 601


>gi|110679110|ref|YP_682117.1| oligoendopeptidase F, putative [Roseobacter denitrificans OCh 114]
 gi|109455226|gb|ABG31431.1| oligoendopeptidase F, putative [Roseobacter denitrificans OCh 114]
          Length = 606

 Score =  502 bits (1293), Expect = e-140,   Method: Composition-based stats.
 Identities = 277/613 (45%), Positives = 382/613 (62%), Gaps = 9/613 (1%)

Query: 14  FFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEG 73
            F+      D     + + LG+LP WNL+DLY   D+ E+  D++ +E    +F T +EG
Sbjct: 1   MFQLPFPVRDANASGAADPLGDLPEWNLDDLYTGEDAPELKRDLDWLEQACASFATDYEG 60

Query: 74  NLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA 133
           NL       +       +   E+I ++ GRI SYA L Y    +     KF +D+  K+ 
Sbjct: 61  NLETL----DAAGFLECVLRNEKISQIAGRIMSYAGLRYYQLTTDAGRAKFMSDLQEKIT 116

Query: 134 DFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDT 193
           +F   L+FF LEIN L +  L+  YA +    +Y      IR +K + LS+++E  L D 
Sbjct: 117 NFTTPLVFFTLEINRLADDHLDGLYAHNGDLARYKPIFDRIRAMKPYQLSDELEKFLHDL 176

Query: 194 SQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSS 253
             VG +A +R F E I  L F ++ + + +  A     D DR  R++AA+ L+  F  + 
Sbjct: 177 GVVG-DAWERLFDETIAGLEFDVDGETLNIEGALNLLTDPDRTKREAAARELADVFGANV 235

Query: 254 HIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY 313
             F+ + NT AK++EI DRWR  E     RHLSN VEP V+EAL  +V   YPK SHRYY
Sbjct: 236 KTFARVHNTQAKEKEIADRWRGMESPQQGRHLSNQVEPEVVEALRNAVVKSYPKLSHRYY 295

Query: 314 ELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHN 373
           ELK+KWL LD M  WDR APLP     I+ ++ A+D+V+++Y  F P+M  IA  FF+  
Sbjct: 296 ELKRKWLGLDKMQVWDRNAPLPLEDNRIVGWDQAQDMVMEAYTAFDPRMGEIAAPFFSKG 355

Query: 374 WIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGI 433
           WIDA    GK  GAFAH T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG 
Sbjct: 356 WIDAGVKPGKAPGAFAHPTVTDVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGE 414

Query: 434 LTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFE 493
           + +++ LTLAETAS+FGE LTF  +L  A    ERK+LLA K+EDM+N++VRQI+FYDFE
Sbjct: 415 MLSSTPLTLAETASVFGEMLTFRKMLDGAKDNAERKVLLAGKVEDMINTVVRQIAFYDFE 474

Query: 494 LKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYA 553
            KLH  RR  G++    IN +W+  Q ESLGPAF+  D  Y +FW  +PHF+ S FYVYA
Sbjct: 475 CKLHDARR-GGELTPDDINALWMSVQAESLGPAFEFMD-GYETFWAYIPHFVHSPFYVYA 532

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YAFG+ LVN+LY +Y +   + F+EKY ++L+AG SKH+ ELL P  ++ SDP FW++GL
Sbjct: 533 YAFGDGLVNALYSVY-AEGTEGFEEKYFDMLKAGGSKHHKELLAPFGLDASDPAFWDKGL 591

Query: 614 QTVEKMIDDVEKM 626
             +   ID++E M
Sbjct: 592 SMISGFIDELEAM 604


>gi|83311927|ref|YP_422191.1| oligoendopeptidase F-like protein [Magnetospirillum magneticum
           AMB-1]
 gi|82946768|dbj|BAE51632.1| Oligoendopeptidase F homolog [Magnetospirillum magneticum AMB-1]
          Length = 878

 Score =  501 bits (1291), Expect = e-140,   Method: Composition-based stats.
 Identities = 273/609 (44%), Positives = 393/609 (64%), Gaps = 8/609 (1%)

Query: 18  ALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAH 77
           A R   MT +   ++LG LP W+L DLYP+ DS E+  D++  +  + AF+T + G LA 
Sbjct: 278 ATRRQRMTFVAPADDLGTLPEWDLSDLYPAPDSPELEADLQAADAAAQAFETAYAGKLAE 337

Query: 78  ATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEK 137
               +     GAAIAE+ERI ++I R  SYA L Y+ ++S     +FY  +  ++     
Sbjct: 338 LPGAQ----FGAAIAEWERIGQIIYRAMSYAQLLYSGDVSDSERGRFYQGMQERVTGITT 393

Query: 138 VLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVG 197
             +FF LEIN LD+ +L +     P T  Y++W+++ R  + H LS++ E +L +   VG
Sbjct: 394 RTLFFTLEINRLDDTVLAEKLK-SPETAHYASWLRDTRVFRPHQLSDEAEKMLHELHVVG 452

Query: 198 REALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
             A  R F E +  LRF ++ +++   +      D D   RK+AAK+L      ++ +F+
Sbjct: 453 TAAWNRLFDETMARLRFPLDGREVTSAEVLNCLSDKDGARRKAAAKSLGKVLGDNAPLFA 512

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
            ITNTLAK++EI+D+WR Y +    R+LSN VE  V++AL+++VK  +P+ SHRYY+LK 
Sbjct: 513 LITNTLAKEKEIEDKWRNYARPQSFRNLSNQVEDGVVDALVEAVKGCFPQLSHRYYKLKA 572

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           KW  +D M +WDR APLP        +E ARD VL +Y  FSP M+ + ++FF +NWIDA
Sbjct: 573 KWFGVDVMDYWDRNAPLPDDDDRKYTWEQARDTVLGAYGAFSPDMAEVGKRFFDNNWIDA 632

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
           P   GK  GAFAH T+P+VHPY+L+N+LGK +DVMTLAHELGHG+H VL+   QG+L ++
Sbjct: 633 PVRPGKSPGAFAHPTVPTVHPYLLVNFLGKSRDVMTLAHELGHGVHQVLAG-GQGLLMSD 691

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
           + LTLAETAS+FGE LTF ++L+  +S + R+I+LA+K+EDM+N++VRQ++FY FE  LH
Sbjct: 692 TPLTLAETASVFGEMLTFRAMLERETSPKSRRIMLASKVEDMINTVVRQVAFYQFESLLH 751

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
            ERR    +   RI E+W+  Q +SLGPAF   D EY  FW  +PHF+ S FYVYAYAFG
Sbjct: 752 DERRRGE-LSPERIGELWMSVQADSLGPAFRFDD-EYRHFWTYIPHFVHSPFYVYAYAFG 809

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
           +CLVNSLY ++    +  F  KYL++LRAG +  + +LL P  ++  DP FW +GL  V 
Sbjct: 810 DCLVNSLYSVHAKGGLADFPAKYLDMLRAGGTLRHQDLLAPFGLDAGDPQFWRQGLDVVI 869

Query: 618 KMIDDVEKM 626
             ID++E M
Sbjct: 870 GFIDELEAM 878


>gi|218530931|ref|YP_002421747.1| oligoendopeptidase, pepF/M3 family [Methylobacterium
           chloromethanicum CM4]
 gi|218523234|gb|ACK83819.1| oligoendopeptidase, pepF/M3 family [Methylobacterium
           chloromethanicum CM4]
          Length = 625

 Score =  501 bits (1291), Expect = e-140,   Method: Composition-based stats.
 Identities = 288/597 (48%), Positives = 383/597 (64%), Gaps = 6/597 (1%)

Query: 31  ENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS-LGA 89
            +LG LP W+L DLYPS D+     D++  E ES AF  R+ G +A      +  S LG 
Sbjct: 31  ADLGVLPEWDLTDLYPSMDAPAFREDLDRAEAESRAFAERYAGRIAEIAAGPDASSVLGE 90

Query: 90  AIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTL 149
           A+  +ERI +L+GR+ SYA L Y+ + +  T  KFY D   +L      L+FF LE+N +
Sbjct: 91  AVQTFERIEDLMGRLMSYAGLVYSGDTTDETRAKFYGDTRERLTTASGDLLFFGLELNRV 150

Query: 150 DEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENI 209
           ++A+L+ + A  P    YS WI+++R+ K H L +  E L  D S     A  R F E I
Sbjct: 151 EDAVLDAAMADGP-LAHYSPWIEDLRREKPHQLDDRTEKLFLDKSVTSNAAWDRLFNETI 209

Query: 210 ESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEI 269
            SLRF +  +++ L        DSD  VR+ AA+AL  T   +  IF+ ITNTLAKD+EI
Sbjct: 210 ASLRFSVQGERLTLEPTLNKLVDSDGAVRQEAAQALGETLRANLRIFTLITNTLAKDKEI 269

Query: 270 QDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWD 329
            DRWR ++ +AD+RHLSN VEP V+ A++++V+  YP+ SHRYY LK KW  ++ + +WD
Sbjct: 270 SDRWRGFKDVADARHLSNRVEPEVVAAMVEAVREAYPRLSHRYYRLKAKWFGVEALPYWD 329

Query: 330 RLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFA 389
           R APLP   Q  I +  ARD VL++Y  FSP M+ IA+KFF   WIDAP   GK  GAFA
Sbjct: 330 RNAPLPKVEQRTISWAQARDTVLEAYDAFSPDMAGIAKKFFDGGWIDAPTRPGKAPGAFA 389

Query: 390 HGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIF 449
           H T+PS HPY+L+NY GKP+DVMTLAHELGHG+H VL++   G L   + LTLAETAS+F
Sbjct: 390 HPTVPSAHPYVLVNYQGKPRDVMTLAHELGHGVHQVLAAPN-GALMAPTPLTLAETASVF 448

Query: 450 GETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTH 509
           GE LTF  LL   +   +R+ +LA K+EDM+N++VRQI+FY FE K+H   R+ G++   
Sbjct: 449 GEMLTFQRLLGQTTDPTQRRAMLAAKVEDMINTVVRQIAFYSFERKVH-LARAKGELTAE 507

Query: 510 RINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYK 569
           +INE+W+  Q ESLGPA  L D  Y  FW  +PHFI S FYVYAYAFG+CLVNSLY +Y 
Sbjct: 508 QINELWMSVQSESLGPAITL-DKGYEPFWAYIPHFIHSPFYVYAYAFGDCLVNSLYGVYA 566

Query: 570 SNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
                 F E+Y  +L AG SK Y ELL P  ++ SDP FW+ GL  +E MI ++E M
Sbjct: 567 RA-EPGFVERYFALLSAGGSKPYGELLKPFGLDASDPGFWQIGLGMIEGMIAELEAM 622


>gi|220920260|ref|YP_002495561.1| oligoendopeptidase, pepF/M3 family [Methylobacterium nodulans ORS
           2060]
 gi|219944866|gb|ACL55258.1| oligoendopeptidase, pepF/M3 family [Methylobacterium nodulans ORS
           2060]
          Length = 616

 Score =  501 bits (1291), Expect = e-139,   Method: Composition-based stats.
 Identities = 282/617 (45%), Positives = 386/617 (62%), Gaps = 6/617 (0%)

Query: 11  SNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTR 70
           + A        S    M    +LG LP W+L DLY   D    + D+   E E  AF   
Sbjct: 3   TRAAAPSEAPQSAAQAMARAVDLGPLPEWDLSDLYAGLDDPAFARDLARAEAECRAFAEA 62

Query: 71  WEGNLAHATNQKNCHS-LGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDIN 129
           ++G +A           LG A+A YE + +L+GR+ S+A L Y+ + + P   KFY D  
Sbjct: 63  YQGRIAALAAGDGASDRLGTAVAAYEALEDLMGRLLSFAGLVYSGDTTDPARAKFYGDTQ 122

Query: 130 AKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECL 189
            +L      L+FF LE+N + + +L+ + A  P   +Y  WI++IR+ K H LS+++E L
Sbjct: 123 ERLTAASSDLLFFTLELNRVPDEVLDAATALPP-LARYRPWIEDIRREKPHQLSDELERL 181

Query: 190 LSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTF 249
           L + S  GR A  R F E + SLRF +  + + L        D+D  +R+ AA+ALS  F
Sbjct: 182 LLEKSVTGRAAWNRLFDETVASLRFPVRGELLTLEPTLNKLQDADEGLRRDAAEALSGVF 241

Query: 250 NKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTS 309
             +  +F+ ITNTLAKD+EI DRWR++  +ADSRHL+N VEP V+ AL+++V   YP+ S
Sbjct: 242 RANLRLFTLITNTLAKDKEIADRWRRFGDVADSRHLANRVEPEVVAALVEAVTAAYPRLS 301

Query: 310 HRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKF 369
           HRYY LK +W   D++ +WDR APLP   Q  IP+  AR+ VL +Y  FSP+M+ IA  F
Sbjct: 302 HRYYRLKARWFGRDSLAYWDRNAPLPKVEQRTIPWAEARETVLSAYGAFSPRMAEIARTF 361

Query: 370 FTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSE 429
           F   WIDAP   GK  GAFAH T+PS HPY+L+NY GKP+DVMTLAHELGHG+H VL++ 
Sbjct: 362 FDGGWIDAPVRPGKAPGAFAHPTVPSSHPYVLVNYQGKPRDVMTLAHELGHGVHQVLAAG 421

Query: 430 TQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISF 489
             G L   + LTLAETAS+FGE LTF  +L A + + +R+ LLA K+EDM+N++VRQI+F
Sbjct: 422 N-GALMAPTPLTLAETASVFGEMLTFRRVLDATTDRRQRRALLAAKVEDMINTVVRQIAF 480

Query: 490 YDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSF 549
           Y FE +LH  RR+   +   +I  +W+  Q ESLGPA  L D  Y  FW  +PHFI S F
Sbjct: 481 YVFERELHLARRAGE-LTADQICALWMSVQAESLGPAIRL-DAGYEPFWAYIPHFIHSPF 538

Query: 550 YVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFW 609
           YVYAYAFG+CLVNSLY +Y+ N  + F ++Y  +L AG SK Y ELL P  ++  DP+FW
Sbjct: 539 YVYAYAFGDCLVNSLYGVYR-NAEEGFVDRYFALLSAGGSKPYGELLAPFGLDARDPSFW 597

Query: 610 ERGLQTVEKMIDDVEKM 626
           + GL  +E MI ++E+M
Sbjct: 598 QIGLSMIEGMIAELEEM 614


>gi|83308660|emb|CAJ01568.1| oligoendopeptidase F [uncultured bacterium]
          Length = 633

 Score =  501 bits (1289), Expect = e-139,   Method: Composition-based stats.
 Identities = 281/636 (44%), Positives = 387/636 (60%), Gaps = 17/636 (2%)

Query: 1   MTKYPDYEFFSNAFFRKALRSS--------DMTTMDSQ--ENLGNLPRWNLEDLYPSHDS 50
           MT +P Y F    F    +RS+          T+   +  ++LG LP+WNL DLYPS DS
Sbjct: 1   MTSFP-YNFQGLGFPMPRMRSNKPLGIFRKAQTSAKPRQTDDLGALPQWNLADLYPSMDS 59

Query: 51  QEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAML 110
               +D+     E   F   ++G L       +   L  AI  YE + EL+G I +YA L
Sbjct: 60  PAFESDLAKAAAECKGFDAAYKGKLEALAKNASGAGLLEAIQRYEAVEELLGHIMAYAGL 119

Query: 111 SYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAW 170
            Y  + + P   KFY D   K+ D    ++FF LE+N LD+AL  +  A   L   Y  W
Sbjct: 120 VYAEDTTDPARMKFYGDAQEKVTDASSDILFFELELNRLDDALAAKVAA--GLLKHYKPW 177

Query: 171 IKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSF 230
           +++IRK K + L + +E L  + S  G  A  R F E I  +RF ++ +++ +       
Sbjct: 178 LEDIRKGKPYQLEDKLEKLFHEKSITGYGAWNRLFDETIAGMRFNVDGKQLAIEPVLNLM 237

Query: 231 FDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVE 290
            D D + R+ AA A      ++   F+ ITNTL+KD+EI DRWR +  +AD+RHL+N VE
Sbjct: 238 QDPDEKTREKAAIAFGAGLKENLRTFALITNTLSKDKEISDRWRGFSDVADARHLANRVE 297

Query: 291 PYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDL 350
             V++AL+ +V+  YP+ SHRYY LK KW     +  WDR APLP       P++ ARD+
Sbjct: 298 REVVDALVAAVRAAYPRLSHRYYRLKAKWFGKPALKHWDRNAPLPQVPAKTYPWDDARDI 357

Query: 351 VLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQD 410
           VL +Y  FSP+M+ IA++FF   WIDAP   GK  GAFAH T+PS HPY+L+NY GKP+D
Sbjct: 358 VLDAYDAFSPKMADIAKRFFDERWIDAPVRPGKQPGAFAHPTVPSAHPYVLMNYQGKPRD 417

Query: 411 VMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKI 470
           VMTLAHELGHG+H VL+    G L   + LTLAETAS+FGE LTF +LL   +S  +R+ 
Sbjct: 418 VMTLAHELGHGVHQVLAGPN-GALMAPTPLTLAETASVFGEMLTFRALLLRTTSAAKRRA 476

Query: 471 LLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLS 530
           +LA K+EDMLN++VRQI+FY FE KLH ERR+   +   +I  +W+  Q ESLGP  +L 
Sbjct: 477 MLAAKVEDMLNTVVRQIAFYSFERKLHIERRNGE-LTAAQICGLWMSEQAESLGPGIEL- 534

Query: 531 DLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSK 590
              Y S+W  +PHF+ S FYVYAYAFG+CLVNSLY +Y+    + F E+YL +L AG +K
Sbjct: 535 GTGYESYWAYIPHFVHSPFYVYAYAFGDCLVNSLYGVYQ-GAREGFAERYLAMLSAGGTK 593

Query: 591 HYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           H+SELL P  ++  DP+FW+ GL+ +E MI D+E +
Sbjct: 594 HHSELLAPFGLDARDPSFWQIGLKMIEGMIADLESL 629


>gi|258543050|ref|YP_003188483.1| oligoendopeptidase F [Acetobacter pasteurianus IFO 3283-01]
 gi|256634128|dbj|BAI00104.1| oligoendopeptidase F [Acetobacter pasteurianus IFO 3283-01]
 gi|256637188|dbj|BAI03157.1| oligoendopeptidase F [Acetobacter pasteurianus IFO 3283-03]
 gi|256640240|dbj|BAI06202.1| oligoendopeptidase F [Acetobacter pasteurianus IFO 3283-07]
 gi|256643297|dbj|BAI09252.1| oligoendopeptidase F [Acetobacter pasteurianus IFO 3283-22]
 gi|256646352|dbj|BAI12300.1| oligoendopeptidase F [Acetobacter pasteurianus IFO 3283-26]
 gi|256649405|dbj|BAI15346.1| oligoendopeptidase F [Acetobacter pasteurianus IFO 3283-32]
 gi|256652391|dbj|BAI18325.1| oligoendopeptidase F [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655449|dbj|BAI21376.1| oligoendopeptidase F [Acetobacter pasteurianus IFO 3283-12]
          Length = 645

 Score =  501 bits (1289), Expect = e-139,   Method: Composition-based stats.
 Identities = 260/615 (42%), Positives = 380/615 (61%), Gaps = 9/615 (1%)

Query: 11  SNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTR 70
           S++    A ++  +    + +   +LPRW+L  LY   D  ++  D+   E ++  F  +
Sbjct: 39  SHSLPVFATQAGTVANTPAGQGAASLPRWDLSALYAGMDDPKLHADLAEAEKKAQDFAKQ 98

Query: 71  WEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINA 130
           ++G +       +   L  AIA +E I E++G+  SYA L +  + S  +I +F   IN 
Sbjct: 99  YQGKIGSL----SGKELADAIATFEVIEEMLGKAGSYASLLFAADSSDASISQFSQSINE 154

Query: 131 KLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLL 190
           +L      L+FF LE+N L+EA L++    DP    +  ++++IR  + H LS+D+E +L
Sbjct: 155 RLTAISTHLLFFTLELNRLEEADLQEKLK-DPALAHWQPYLRDIRMYRPHQLSDDVEKVL 213

Query: 191 SDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFN 250
            + S  G +A  R F E I +LR  ++ Q I +  A     D++R  R+ A KA+   F 
Sbjct: 214 LEKSVTGGQAWCRLFDETIAALRVTLDGQAITVGDALNRLSDTNRATREQAGKAVGDVFE 273

Query: 251 KSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSH 310
           K+  +F+ ITNTLAKD+ I D  R + +   SR+LSN VE  V++AL+ +V+  YP+ SH
Sbjct: 274 KNVRLFALITNTLAKDKSISDNLRHFARPTSSRNLSNMVEDEVVDALVSAVRADYPRLSH 333

Query: 311 RYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFF 370
           RYY LK KW+ LD +  WDR APLPG    +IP+  A+++V ++Y  F P+M  +   F 
Sbjct: 334 RYYALKAKWMGLDKLEHWDRNAPLPGNDDKLIPWSEAKNIVQKAYDGFDPRMGKVINTFL 393

Query: 371 THNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSET 430
           T+ WID P   GK  GAFAH T+PS HPYILLNY G+ +DVMTLAHELGHG+H VL+++ 
Sbjct: 394 TNPWIDVPPAPGKSPGAFAHPTVPSAHPYILLNYHGRIRDVMTLAHELGHGVHQVLAAK- 452

Query: 431 QGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFY 490
           QG   +++ LTLAETAS+FGE LTF SLL A    + R++LLA K+EDMLN++VRQI+FY
Sbjct: 453 QGYFMSDTPLTLAETASVFGEMLTFQSLLDAEKDPQRRRLLLAAKVEDMLNTVVRQIAFY 512

Query: 491 DFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFY 550
           +FE ++H  R+    +   +I  IW   Q ESLGPAF+ +  EY  FW  +PHFI S FY
Sbjct: 513 EFETRVHDARKKGELL-PEQIGAIWRSVQTESLGPAFNFT-PEYDVFWAYIPHFIHSPFY 570

Query: 551 VYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWE 610
           VYAYAFG+CLVN+LY ++ S     F++KY+ +L AG +  + ELL P  ++ SDP FW 
Sbjct: 571 VYAYAFGDCLVNALYQVF-SEGAPGFQDKYIAMLEAGGTLRHKELLAPFGLDASDPGFWR 629

Query: 611 RGLQTVEKMIDDVEK 625
           +GL  +   ID +E+
Sbjct: 630 KGLDVISGFIDQLEQ 644


>gi|332716498|ref|YP_004443964.1| Oligoendopeptidase F [Agrobacterium sp. H13-3]
 gi|325063183|gb|ADY66873.1| Oligoendopeptidase F [Agrobacterium sp. H13-3]
          Length = 616

 Score =  501 bits (1289), Expect = e-139,   Method: Composition-based stats.
 Identities = 297/594 (50%), Positives = 399/594 (67%), Gaps = 4/594 (0%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           LG+LP W L DLYPS DS E   D+E     + AF+ +W+G L  A      + +GAA+ 
Sbjct: 22  LGDLPGWKLSDLYPSGDSPEYKGDIEKAATLAAAFEDKWKGKLEDAAKATGANGIGAALK 81

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
           EYE + +LIGRI S+A L+Y  + S+P   K Y D  AKL D    L+FF LE+N +D+A
Sbjct: 82  EYEALDDLIGRIGSFAGLTYFSDTSNPANGKLYGDAQAKLTDISAHLLFFTLELNRIDDA 141

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
           +++   A D L   Y  W+ ++RK K H L + +E L  + S     A  R F E +  L
Sbjct: 142 VMDACMANDALAGHYRPWLVDLRKDKPHQLDDQLEQLFLEKSMTSASAFNRLFDETMADL 201

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           RF I+   + L        + + E RK AA+ALS TF  +  +F+ ITNTLAKD++I DR
Sbjct: 202 RFDIDGASLSLEVTLNMLQEPEPETRKKAAQALSTTFTNNLRVFTLITNTLAKDKDISDR 261

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WRK+E IADSRHL+N VE  V++AL  +VKN YP+ SHRYY +K KWL ++ M +WDR A
Sbjct: 262 WRKFEDIADSRHLANRVEREVVDALAAAVKNAYPRLSHRYYAMKAKWLGMEQMNYWDRNA 321

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP TS  IIP++ A+D VL +Y  F+P+M+ IA +FF   WIDAP   GK  GAFAH T
Sbjct: 322 PLPDTSNTIIPWDEAKDTVLSAYGDFAPEMADIARRFFDEQWIDAPARPGKAPGAFAHPT 381

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +PS HPY+L+NYLGKP+DVMTLAHELGHG+H VL+ + QG L   + LTLAETAS+FGE 
Sbjct: 382 VPSAHPYVLVNYLGKPRDVMTLAHELGHGVHQVLAGD-QGALMCATPLTLAETASVFGEM 440

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF  LL       ERK +LA K+EDM+N++VRQI+FY+FE KLHT  R  G++ + +I 
Sbjct: 441 LTFRKLLDDTKDVRERKAMLARKVEDMINTVVRQIAFYEFERKLHTA-RKQGELTSEQIG 499

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
           E+WL  Q ESLGPA  +S+  Y ++W  +PHFI S FYVYAYAFG+CLVNSLY +Y+   
Sbjct: 500 ELWLSIQAESLGPAIKISE-GYETWWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQKA- 557

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              F+EKY  +L+AG +KH+SELL P  ++ +DP+FW++GL  +E +ID++E +
Sbjct: 558 ETGFQEKYFELLKAGGTKHHSELLKPFGLDATDPSFWDKGLAVIEGLIDELEAL 611


>gi|115526097|ref|YP_783008.1| pepF/M3 family oligoendopeptidase [Rhodopseudomonas palustris
           BisA53]
 gi|115520044|gb|ABJ08028.1| oligoendopeptidase, pepF/M3 family [Rhodopseudomonas palustris
           BisA53]
          Length = 635

 Score =  501 bits (1289), Expect = e-139,   Method: Composition-based stats.
 Identities = 287/593 (48%), Positives = 389/593 (65%), Gaps = 5/593 (0%)

Query: 35  NLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGA-AIAE 93
            LP WNL DLY   D+ EI+ D++ I+ + +AF+  ++G LA  T ++   +  A A+  
Sbjct: 46  KLPEWNLADLYLGIDAPEIARDLDRIDADCIAFEQDYKGKLAEETAKEGGGAWLAGAVKR 105

Query: 94  YERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEAL 153
           YE I +L GR+ SYA L++  +   P I KFY D++ +L      L+FFALE+N +D+ +
Sbjct: 106 YEAIDDLAGRLGSYAGLAHAGDSVDPAITKFYGDVSERLTAASVHLLFFALELNRIDDTV 165

Query: 154 LEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLR 213
           +E++  Q P    Y  WI++ RK K + L + +E L  + SQ G  A  R F + I  LR
Sbjct: 166 IERAMQQAPELGHYRPWIEDSRKDKPYQLEDRVEQLFHEKSQTGYSAFNRLFDQTIAGLR 225

Query: 214 FKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRW 273
           FK+  +++ +        D D   RK+A +AL+ TF  +   F+ ITNTLAKD+EI DRW
Sbjct: 226 FKLGGKELAIEPTLNQLQDRDPAKRKAAGQALAKTFKANERTFALITNTLAKDKEISDRW 285

Query: 274 RKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAP 333
           R +E IAD+RHLSN VE  V++AL+ SV+  YPK SHRYY LK +W K  ++  WDR AP
Sbjct: 286 RGFEDIADARHLSNRVEREVVDALVNSVRAAYPKLSHRYYALKARWFKKKSLAHWDRNAP 345

Query: 334 LPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTI 393
           LP  +   I +  A+D+VL +Y  FSP+M+ IA++FF   WIDAP   GK  GAF+H T 
Sbjct: 346 LPFAATGSIGWPEAQDMVLSAYGAFSPEMASIAQRFFADRWIDAPVRPGKAPGAFSHPTT 405

Query: 394 PSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETL 453
           PS HPY+L+NY GKP+DVMTLAHELGHG+H VL+++  G L   + LTLAETAS+FGE L
Sbjct: 406 PSAHPYVLMNYQGKPRDVMTLAHELGHGVHQVLAAKN-GALMAPTPLTLAETASVFGEML 464

Query: 454 TFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINE 513
           TF  LL    S ++R+ LLA K+EDM+N++VRQI+FY FE  +HTERR    +   RI +
Sbjct: 465 TFKRLLGQTKSPKQRQALLAGKVEDMINTVVRQIAFYSFERAIHTERRQGE-LTAERIGQ 523

Query: 514 IWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTV 573
           IWL  Q ESLGPA D+    Y +FWM +PHFI S FYVYAYAFG+CLVNSLY +Y  N  
Sbjct: 524 IWLSVQSESLGPAIDIK-PGYETFWMYIPHFIHSPFYVYAYAFGDCLVNSLYAVY-ENAQ 581

Query: 574 DCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           + F E+YL +L AG +KHYSELL P  ++  DP FW+ GL  +  MID++E M
Sbjct: 582 EGFAERYLAMLSAGGTKHYSELLKPFGLDARDPQFWDGGLSVIAGMIDELEAM 634


>gi|256043006|ref|ZP_05445952.1| oligoendopeptidase, pepF/M3 family protein [Brucella melitensis bv.
           1 str. Rev.1]
 gi|260564239|ref|ZP_05834724.1| neutral zinc metallopeptidase [Brucella melitensis bv. 1 str. 16M]
 gi|265989443|ref|ZP_06102000.1| pepF/M3 family oligoendopeptidase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|260151882|gb|EEW86975.1| neutral zinc metallopeptidase [Brucella melitensis bv. 1 str. 16M]
 gi|263000112|gb|EEZ12802.1| pepF/M3 family oligoendopeptidase [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 620

 Score =  500 bits (1288), Expect = e-139,   Method: Composition-based stats.
 Identities = 301/624 (48%), Positives = 416/624 (66%), Gaps = 7/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K+  Y F S+A  R     +       + +LGNLP WNL DLYP+ DS ++++D+E    
Sbjct: 2   KFMVYRFSSDAILRAPAADAI---AAKKHDLGNLPEWNLADLYPAPDSPQLASDLEKAMQ 58

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           +S+ F+ RW+G LA    + N  +L  AI E+E + EL+GRI SYA L Y  + + P   
Sbjct: 59  DSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGSYAGLYYYGDTTDPKRM 118

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           K + D   KL D    LIFF LE+N +D+ +LE++  ++P    Y  W+ ++R  K + L
Sbjct: 119 KLFGDAQQKLTDASTPLIFFTLELNCIDDTVLEKAMNENPAIGHYRPWLTDLRMDKPYQL 178

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
            + +E L  + S  G  A  R F E +  LRF+I  +++ +        D+D  VRK A+
Sbjct: 179 DDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLAIEPTLNMLQDADGAVRKQAS 238

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           +AL+ TF  +   F+ ITNTLAKD+EI DRWR ++ IADS+HLSN VE  V++AL ++V+
Sbjct: 239 EALAKTFTANLRTFTLITNTLAKDKEISDRWRGFKDIADSQHLSNRVEREVVDALAKAVE 298

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           + YP+ SHRYY LK KWL L+ +  WDR APLP T Q +IP++ AR+ VL +Y  F+P+M
Sbjct: 299 DAYPRLSHRYYALKAKWLDLEKLENWDRNAPLPETPQALIPWDEARETVLSAYGNFAPEM 358

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           + IA KFF  NWIDAP   GK  GAFAH T+PS HPY+LLNY+GKP+DVMTLAHELGHG+
Sbjct: 359 ADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSAHPYVLLNYMGKPRDVMTLAHELGHGV 418

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VL+  +QG L  ++ LTLAETAS+FGE LTF  LL+    K ERK +LA K EDM+N+
Sbjct: 419 HQVLAG-SQGALMASTPLTLAETASVFGEMLTFRLLLERTRDKRERKAMLAQKAEDMINT 477

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           +VRQI+FY FE ++HTERR+   + + RI EIW++ Q+ESLG A  L+   Y +FW  +P
Sbjct: 478 VVRQIAFYQFERRVHTERRAGE-LTSERIGEIWMDVQRESLGDAVRLN-PGYETFWTYIP 535

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI S FYVYAYAFG+CLVNSLY +Y+ N+   F++KY  +L+AG +KH+ ELL P  ++
Sbjct: 536 HFIHSPFYVYAYAFGDCLVNSLYAVYQ-NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLD 594

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
            SDP FW +GL  +E +ID++E M
Sbjct: 595 ASDPGFWNKGLSVIEGIIDELEAM 618


>gi|83941132|ref|ZP_00953594.1| oligoendopeptidase F [Sulfitobacter sp. EE-36]
 gi|83846952|gb|EAP84827.1| oligoendopeptidase F [Sulfitobacter sp. EE-36]
          Length = 606

 Score =  500 bits (1288), Expect = e-139,   Method: Composition-based stats.
 Identities = 274/613 (44%), Positives = 376/613 (61%), Gaps = 9/613 (1%)

Query: 14  FFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEG 73
            F+  +   D          G LP WNL+DLY   D+ E+  D++ +E    +F   +EG
Sbjct: 1   MFQLPVPVLDANAGSGASAFGKLPEWNLDDLYTGEDAPELKRDLDWLEEACRSFAEDYEG 60

Query: 74  NLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA 133
            LA      + + L   +   E+I ++ GRI SYA L Y    +     KF +D   K+ 
Sbjct: 61  KLAEL----DANELLDCVLRNEKINQIAGRIMSYAGLRYYQLTTDSGRAKFMSDAQEKIT 116

Query: 134 DFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDT 193
           +F   L+FF LE+N L++  L    +Q     +Y      IR +K + LS++ME  L D 
Sbjct: 117 NFTTPLVFFTLELNRLEDDHLANLLSQKADLARYKPVFDRIRAMKDYQLSDEMEKFLHDL 176

Query: 194 SQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSS 253
             VG +A +R F E I  L F++ND+ + +        D  R++R++AA+ L+  F  + 
Sbjct: 177 GVVG-DAWERLFDETIAGLEFEVNDEPLNIEGVLNLLTDPSRDLREAAARELADVFQANI 235

Query: 254 HIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY 313
             F+ + NT AK++E+ DRWR        RHLSN+VEP V+EAL  +V N YPK SHRYY
Sbjct: 236 RTFARVHNTQAKEKEVIDRWRGMPTPQTGRHLSNHVEPEVVEALRDAVVNAYPKLSHRYY 295

Query: 314 ELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHN 373
           ELK+KWL LDTM  WDR APLP      + +E A   V+ +Y  F P+M  IA  FFT  
Sbjct: 296 ELKRKWLGLDTMQVWDRNAPLPMEDPKTVSWEQAEKTVMDAYNAFDPRMGEIAAPFFTEG 355

Query: 374 WIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGI 433
           WIDA    GK  GAFAH T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG 
Sbjct: 356 WIDAGVKPGKAPGAFAHPTVTDVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGE 414

Query: 434 LTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFE 493
           + +++ LTLAETAS+FGE LTF  +L  A +  ERK+LLA K+EDM+N++VRQI+FYDFE
Sbjct: 415 MLSSTPLTLAETASVFGEMLTFRKMLDGAKTNAERKVLLAGKVEDMINTVVRQIAFYDFE 474

Query: 494 LKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYA 553
            KLH  RR  G++    IN +W+  Q ESLGPAF+  D  Y +FW  +PHF+ S FYVYA
Sbjct: 475 CKLHDARR-GGELTPDDINALWMSVQGESLGPAFEFMD-GYETFWAYIPHFVHSPFYVYA 532

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YAFG+ LVN+LY +Y       F++KY ++L+AG SKH+ ELL P  ++ SDP FW++GL
Sbjct: 533 YAFGDGLVNALYAVY-EEGEPGFEDKYFDMLKAGGSKHHKELLAPFGLDASDPAFWDKGL 591

Query: 614 QTVEKMIDDVEKM 626
             +   ID++E M
Sbjct: 592 SMISGFIDELEAM 604


>gi|163747414|ref|ZP_02154766.1| oligoendopeptidase F, putative [Oceanibulbus indolifex HEL-45]
 gi|161379267|gb|EDQ03684.1| oligoendopeptidase F, putative [Oceanibulbus indolifex HEL-45]
          Length = 605

 Score =  500 bits (1288), Expect = e-139,   Method: Composition-based stats.
 Identities = 273/613 (44%), Positives = 383/613 (62%), Gaps = 9/613 (1%)

Query: 14  FFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEG 73
            F+      D       ++LGNLP W+L DLY S D+ E+  D++ +E    +F   +EG
Sbjct: 1   MFQLPFPLYDANASAGGKDLGNLPEWDLSDLYTSEDAAELKRDLDWLEEACASFAADYEG 60

Query: 74  NLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA 133
            LA      +   L   +   E+I ++ GRI SYA L Y    +     KF +D+  K+ 
Sbjct: 61  KLAEL----DAKGLLDCVLRNEKINQVAGRIMSYAGLRYYQQTTDSGRAKFMSDMQEKIT 116

Query: 134 DFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDT 193
           D+   L+FF LE+N L +  L     QDP   +Y      IR +K + LS++ME  L D 
Sbjct: 117 DYTTPLVFFTLELNKLPDDHLADLLNQDPDLARYKPVFDRIRAMKPYQLSDEMEKFLHDL 176

Query: 194 SQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSS 253
             VG +A +R F E I  L F+++ + + +        D DR  R++ A+ L+     + 
Sbjct: 177 GVVG-DAWERMFDETIAGLEFEVDGETLTIEGTLNLLTDPDRAKREAGARELAEVLGANI 235

Query: 254 HIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY 313
             F+ + NT  K++E+ DRWR  E     RHLSN+VEP V+EAL  +V N YPK SHRYY
Sbjct: 236 RTFARVHNTQVKEKEVMDRWRGMETPQTGRHLSNHVEPEVVEALRNAVVNAYPKLSHRYY 295

Query: 314 ELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHN 373
           ELK+KWL LD M  WDR APLP     ++ +  A + V+++Y  F P+M  +A+ FFT  
Sbjct: 296 ELKRKWLGLDVMQVWDRNAPLPMEDPKVVNWAQAEETVMEAYTAFDPRMGELAKPFFTDG 355

Query: 374 WIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGI 433
           WIDA    GK  GAFAH T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H VL+++ QG 
Sbjct: 356 WIDAGVKPGKAPGAFAHPTVTNVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAD-QGE 414

Query: 434 LTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFE 493
           + +++ LTLAETAS+FGE LTF  +L  A ++ ERK+LLA K+EDM+N++VRQI+FYDFE
Sbjct: 415 MLSSTPLTLAETASVFGEMLTFRKMLDKAKTQAERKVLLAGKVEDMINTVVRQIAFYDFE 474

Query: 494 LKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYA 553
            KLH  RR  G++    IN +W+  Q ESLGPAF+  D  Y +FW  +PHF+ S FYVYA
Sbjct: 475 CKLHEARR-GGELTPDDINALWMSVQAESLGPAFEYMD-GYETFWAYIPHFVHSPFYVYA 532

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YAFG+ LVN+LY +Y +   + F++KY ++L+AG SKH+ ELL P  ++ SDP FW++GL
Sbjct: 533 YAFGDGLVNALYAVY-AAGEEGFEDKYFDMLKAGGSKHHRELLAPFGLDASDPAFWDKGL 591

Query: 614 QTVEKMIDDVEKM 626
             +  MID++E M
Sbjct: 592 SMISDMIDELEAM 604


>gi|110635064|ref|YP_675272.1| pepF/M3 family oligoendopeptidase [Mesorhizobium sp. BNC1]
 gi|110286048|gb|ABG64107.1| oligoendopeptidase, pepF/M3 family [Chelativorans sp. BNC1]
          Length = 616

 Score =  500 bits (1287), Expect = e-139,   Method: Composition-based stats.
 Identities = 305/626 (48%), Positives = 404/626 (64%), Gaps = 13/626 (2%)

Query: 1   MTKYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECI 60
           M  YP              ++++     +  +LG LP WNL DLYPS DS E S D+   
Sbjct: 1   MAHYPK-------TPAGLAQATEAGARKA--DLGALPEWNLADLYPSMDSTEFSEDLARA 51

Query: 61  EHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPT 120
             E+ AF+  W+G LA    +     LG A+ EYE + EL GRI SYA L Y  + S P 
Sbjct: 52  AREATAFEQNWKGRLAEEAGKGTSGRLGEAVREYEALDELFGRIGSYAGLLYTGDTSDPK 111

Query: 121 IRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKH 180
             KFY D+  KL D    L+FF LE+N +D+AL+E +   DP+   Y  W+ +IRK + H
Sbjct: 112 RAKFYGDVQEKLTDASTHLLFFTLELNKIDDALIEAAMKDDPIFGHYRPWVLDIRKYRPH 171

Query: 181 LLSNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKS 240
            L + +E L  ++   GR A  R F E +  LRF ++ +++ L        D D E R+ 
Sbjct: 172 QLEDSIERLFHESDVTGRGAWNRLFDETMTGLRFDVDGEELTLEPTLNLMQDPDGEKRRK 231

Query: 241 AAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQS 300
           AA AL+ T   +  +F+ ITNTLAKD+EI DRWR +  +ADSRHLSN VE  V+EAL  S
Sbjct: 232 AAAALAVTLKDNMRLFTLITNTLAKDKEISDRWRNFADVADSRHLSNRVEREVVEALAAS 291

Query: 301 VKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSP 360
           V   +P+ SHRYY +K KWL ++ +  WDR APLP T Q +I ++ A++ VL +YA F+P
Sbjct: 292 VCAAFPRISHRYYAMKAKWLGMEKLNHWDRNAPLPETPQSVIGWDEAKETVLSAYASFAP 351

Query: 361 QMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGH 420
           +M+ IA+ FF  NWIDAP   GK  GAFAH T+PSVHPY++LNY+GKP+DVMTLAHELGH
Sbjct: 352 EMADIAKHFFDRNWIDAPVRPGKSPGAFAHPTVPSVHPYVMLNYMGKPRDVMTLAHELGH 411

Query: 421 GIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDML 480
           G+H VL++  QG L   + LTLAETAS+FGE LTF SLL   + K ERK +LA K EDM+
Sbjct: 412 GVHQVLAA-GQGSLMAATPLTLAETASVFGEMLTFRSLLARTTDKRERKAMLAQKAEDMI 470

Query: 481 NSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMM 540
           N++VRQI+FY+FE K+HTERR    +   RI EIWLE Q ESLGPA  L +  Y +FW  
Sbjct: 471 NTVVRQIAFYEFERKVHTERRQGE-LTADRIGEIWLEVQAESLGPAIALRE-GYETFWAY 528

Query: 541 VPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLN 600
           +PHFI S FYVYAYAFG+CLVNSL+ +Y+      F+EKY  +L+AG +KH+SELL P  
Sbjct: 529 IPHFIHSPFYVYAYAFGDCLVNSLFAVYQQA-EKGFQEKYFEMLKAGGTKHHSELLAPFG 587

Query: 601 INLSDPNFWERGLQTVEKMIDDVEKM 626
           ++ SDP FW +GL  +E +ID++E +
Sbjct: 588 LDASDPAFWTKGLSVIESLIDELEAL 613


>gi|83955691|ref|ZP_00964271.1| oligoendopeptidase F [Sulfitobacter sp. NAS-14.1]
 gi|83839985|gb|EAP79161.1| oligoendopeptidase F [Sulfitobacter sp. NAS-14.1]
          Length = 606

 Score =  499 bits (1285), Expect = e-139,   Method: Composition-based stats.
 Identities = 273/613 (44%), Positives = 376/613 (61%), Gaps = 9/613 (1%)

Query: 14  FFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEG 73
            F+  +   D          G LP WNL+DLY   D+ E+  D++ +E    +F   +EG
Sbjct: 1   MFQLPVPVLDANAGSGASAFGKLPEWNLDDLYTGEDAPELKRDLDWLEEACRSFAEDYEG 60

Query: 74  NLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA 133
            LA      + + L   +   E+I ++ GRI SYA L Y    +     KF +D   K+ 
Sbjct: 61  KLAEL----DANELLECVLRNEKINQIAGRIMSYAGLRYYQLTTDSGRAKFMSDAQEKIT 116

Query: 134 DFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDT 193
           +F   L+FF LE+N L++  L    +Q     +Y      IR +K + LS++ME  L D 
Sbjct: 117 NFTTPLVFFTLELNRLEDDHLANVLSQKADLARYKPVFDRIRAMKDYQLSDEMEKFLHDL 176

Query: 194 SQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSS 253
             VG +A +R F E I  L F++ND+ + +        D  R++R++AA+ L+  F  + 
Sbjct: 177 GVVG-DAWERLFDETIAGLEFEVNDEPLNIEGVLNLLTDPSRDLREAAARELADVFQANI 235

Query: 254 HIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY 313
             F+ + NT AK++E+ DRWR        RHLSN+VEP V+EAL  +V N YPK SHRYY
Sbjct: 236 RTFARVHNTQAKEKEVIDRWRGMPTPQTGRHLSNHVEPEVVEALRDAVVNAYPKLSHRYY 295

Query: 314 ELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHN 373
           ELK+KWL LDTM  WDR APLP      + +E A   V+ +Y  F P+M  IA  FFT  
Sbjct: 296 ELKRKWLGLDTMQVWDRNAPLPMEDPKTVSWEQAEKTVMDAYNAFDPRMGEIAAPFFTEG 355

Query: 374 WIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGI 433
           WIDA    GK  GAFAH T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG 
Sbjct: 356 WIDAGVKPGKAPGAFAHPTVTDVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGE 414

Query: 434 LTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFE 493
           + +++ LTLAETAS+FGE LTF  +L  A +  ERK+LLA K+EDM+N++VRQI+FYDFE
Sbjct: 415 MLSSTPLTLAETASVFGEMLTFRKMLDGAKTNAERKVLLAGKVEDMINTVVRQIAFYDFE 474

Query: 494 LKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYA 553
            KLH  RR  G++    IN +W+  Q ESLGPAF+  D  Y +FW  +PHF+ S FYVYA
Sbjct: 475 CKLHDARR-GGELTPDDINALWMSVQGESLGPAFEFMD-GYETFWAYIPHFVHSPFYVYA 532

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YAFG+ LVN+LY +Y       F++KY ++L+AG SKH+ ELL P  ++ SDP FW++GL
Sbjct: 533 YAFGDGLVNALYAVY-EEGEPGFEDKYFDMLKAGGSKHHKELLAPFGLDASDPAFWDKGL 591

Query: 614 QTVEKMIDDVEKM 626
             +   I+++E M
Sbjct: 592 SMISGFINELEAM 604


>gi|227823369|ref|YP_002827341.1| oligoendopeptidase F [Sinorhizobium fredii NGR234]
 gi|227342370|gb|ACP26588.1| oligoendopeptidase F [Sinorhizobium fredii NGR234]
          Length = 622

 Score =  499 bits (1284), Expect = e-139,   Method: Composition-based stats.
 Identities = 300/615 (48%), Positives = 413/615 (67%), Gaps = 4/615 (0%)

Query: 12  NAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRW 71
            AF    +R+  +    +  +LG+LP W LEDLY S  S E   D+   E ++LAF+ RW
Sbjct: 9   AAFGPSPVRAPAVQAASAVADLGDLPTWRLEDLYASAGSDEFRRDLAKAEADALAFENRW 68

Query: 72  EGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAK 131
           +GNLA A  +     +GAA+ E+E + +L+GRIAS+A L+Y  + S+P   K Y D+ +K
Sbjct: 69  KGNLADAAARTGDQGIGAAVKEFEALEDLMGRIASFAGLTYFSDTSNPANGKLYGDVQSK 128

Query: 132 LADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLS 191
           L D    L+FF+LE+N +D+ +++ +   D L   Y  WI ++RK K + L + +E L  
Sbjct: 129 LTDISAHLLFFSLELNRIDDKVIDATLEADSLAGHYKPWILDLRKDKPYQLDDRLEQLFL 188

Query: 192 DTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNK 251
           + S  G  A  R F E I SL F ++ + +PL        D+  E RK AA AL+ TF  
Sbjct: 189 EKSMTGANAFNRLFDETIASLTFSVDGEALPLEVTLNLLQDASSENRKKAAIALAETFKA 248

Query: 252 SSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHR 311
           +   F+ +TNTLAKD+EI DRWR +E IADSRHL+N VE  V++AL  +VK+ YP+ SHR
Sbjct: 249 NIRTFTLVTNTLAKDKEISDRWRGFEDIADSRHLANRVEREVVDALAAAVKDAYPRLSHR 308

Query: 312 YYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFT 371
           YY LK KWL ++ M FWDR APLP T   +IP+  A+D VL +Y  F+P+M+ IA +FF 
Sbjct: 309 YYGLKAKWLGMEQMEFWDRNAPLPETPNALIPWGEAKDTVLSAYHGFAPEMASIARRFFD 368

Query: 372 HNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQ 431
             WIDAP   GK  GAFAH T+PSVHPY+L+NY+GKP+DVMTLAHELGHG+H VL+   Q
Sbjct: 369 DRWIDAPVRPGKAPGAFAHPTVPSVHPYVLVNYMGKPRDVMTLAHELGHGVHQVLAG-GQ 427

Query: 432 GILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYD 491
           G L  ++ LTLAETAS+FGE LTF +LL     K ERK +LA K+EDM+N++VRQI+FY+
Sbjct: 428 GALMASTPLTLAETASVFGEMLTFRALLDRTKDKRERKAMLAQKVEDMINTVVRQIAFYE 487

Query: 492 FELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYV 551
           FE K+HT  R  G++    + E+WL  Q+ESLGPA  +S+  Y ++W  +PHFI S FYV
Sbjct: 488 FERKVHTA-RKQGELTADDLGELWLSVQRESLGPAIRISE-GYETYWAYIPHFIHSPFYV 545

Query: 552 YAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWER 611
           YAYAFG+CLVNSLY +Y+ N    F+EKY N+L+AG +KH+SELL P  ++ +DP+FW +
Sbjct: 546 YAYAFGDCLVNSLYAVYR-NAESGFQEKYFNLLKAGGTKHHSELLAPFGLDAADPSFWAQ 604

Query: 612 GLQTVEKMIDDVEKM 626
           GL  +E +ID++E +
Sbjct: 605 GLSMIEGLIDELEAL 619


>gi|114327031|ref|YP_744188.1| oligoendopeptidase F [Granulibacter bethesdensis CGDNIH1]
 gi|114315205|gb|ABI61265.1| oligoendopeptidase F [Granulibacter bethesdensis CGDNIH1]
          Length = 611

 Score =  498 bits (1282), Expect = e-138,   Method: Composition-based stats.
 Identities = 268/592 (45%), Positives = 383/592 (64%), Gaps = 8/592 (1%)

Query: 34  GNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAE 93
           G LP W+L DLYP  DS  +  D+     +S+ F  R+ G LA      +   L  A+ +
Sbjct: 26  GQLPAWDLSDLYPGPDSPALEADIAAATRDSVRFAERYAGQLAGL----DGAGLDEALRD 81

Query: 94  YERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEAL 153
           YERI E++GR+ SYA L ++ + S P I +FY  +N ++      LIFF LE+N LD+A 
Sbjct: 82  YERIEEILGRLMSYAQLRFSEDSSDPEIGRFYQSMNERVTGISSHLIFFTLELNRLDDAT 141

Query: 154 LEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLR 213
           LE+  A DP   ++  +++++R  + H LS+D+E  L +    G  A  R F E I ++R
Sbjct: 142 LERQLA-DPKAARWQPFLRDLRVFRPHQLSDDVEKALHEKDVTGHSAWTRLFDETIAAMR 200

Query: 214 FKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRW 273
             +  +++ ++ A       +R +R+ A KA+   F     +FSFITNTLAKD+EI D  
Sbjct: 201 VTVGGEELTVSAALNRLSSGNRTMREEAGKAIGAAFGAQKRLFSFITNTLAKDKEIVDTL 260

Query: 274 RKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAP 333
           R YE+    R+ +N VE  V++AL+ +V+  Y + SHRYY LK KWL LD +  WDR AP
Sbjct: 261 RHYERPGSYRNRANMVEDEVVDALVSAVRADYGRLSHRYYALKAKWLGLDKLSHWDRNAP 320

Query: 334 LPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTI 393
           LPG     IP+  A+  VL +Y  FSP+M+ I  +FF H WIDA    GK  GAFAH T+
Sbjct: 321 LPGDDDREIPWPEAKRRVLDAYGAFSPEMAEIGSRFFDHPWIDARLLPGKSGGAFAHPTV 380

Query: 394 PSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETL 453
           PSVHPYILLNY G+ +DVMTLAHELGHG+H V++ + QG + +N+ LTLAETAS+FGE L
Sbjct: 381 PSVHPYILLNYHGRTRDVMTLAHELGHGVHQVVAGQAQGYMLSNTPLTLAETASVFGEML 440

Query: 454 TFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINE 513
           TF ++L+A +    R+++LA+K+EDMLN++VRQ +FY+FE ++H ERRS   +   R+ E
Sbjct: 441 TFRAMLEAETDPVRRRLMLASKVEDMLNTVVRQTAFYEFETRVHNERRSGEIL-PERLGE 499

Query: 514 IWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTV 573
           IW + Q ESLGP FD +  EY  FW  +PHFI + FYVYAYAFG+CLVN+LY +++ +  
Sbjct: 500 IWRQVQVESLGPVFDFT-PEYDVFWAYIPHFIHTPFYVYAYAFGDCLVNALYAVFQ-DGH 557

Query: 574 DCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEK 625
             F++KY+++LRAG +K + ELL P  ++ SDP FW++GL  +   ID +E+
Sbjct: 558 PDFQQKYMDMLRAGGTKRHRELLAPFGLDASDPAFWKKGLDVIAGFIDALEE 609


>gi|259417190|ref|ZP_05741109.1| putative oligoendopeptidase F [Silicibacter sp. TrichCH4B]
 gi|259346096|gb|EEW57910.1| putative oligoendopeptidase F [Silicibacter sp. TrichCH4B]
          Length = 606

 Score =  497 bits (1280), Expect = e-138,   Method: Composition-based stats.
 Identities = 270/613 (44%), Positives = 387/613 (63%), Gaps = 9/613 (1%)

Query: 14  FFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEG 73
            F+      D        +LG LP W+L DLY   D+ E+S D++ ++ E   F   +EG
Sbjct: 1   MFQLPFPVRDANASSGSGDLGKLPEWDLSDLYAGEDAPELSRDLDWLQKECAGFAADYEG 60

Query: 74  NLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA 133
            LA      +   L   +   E+I  + GRI SYA L Y    +     KF +D+  K+ 
Sbjct: 61  KLADL----DADGLLTCVHRNEKINNIAGRIMSYAGLRYYQLTTDADRAKFLSDVQEKVT 116

Query: 134 DFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDT 193
            F   L+FF LEIN +++A L+  +A +    +Y      IR +K + LS+++E  + D 
Sbjct: 117 IFTTPLVFFTLEINRIEDATLDALFAANADLARYKPVFDRIRAMKPYQLSDELERFMHDL 176

Query: 194 SQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSS 253
             VG +A ++ F E I  L F+I+ +++ +        + DR  R++AA+ L+  F  + 
Sbjct: 177 GIVG-DAWEKLFDETIAGLTFEIDGEELGIEATLNFLTEQDRSKREAAARELARVFADNI 235

Query: 254 HIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY 313
            IF+ + NT AK++EI DRWR        RHLSN+VEP V+EAL ++V   YPK SHRYY
Sbjct: 236 KIFARVHNTQAKEKEIIDRWRGMPSPQMGRHLSNDVEPEVVEALREAVVAAYPKLSHRYY 295

Query: 314 ELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHN 373
           ELK+KWL LD M  WDR APLP  +  I+ ++ AR  V+++Y  F P+M  +A+ FF   
Sbjct: 296 ELKRKWLGLDRMQVWDRNAPLPMETTRIVDWDEARATVMEAYEAFDPRMGELAQPFFDKG 355

Query: 374 WIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGI 433
           WIDA    GK  GAFAH T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H VL+++ QG 
Sbjct: 356 WIDAGVKPGKAPGAFAHPTVTNVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAD-QGE 414

Query: 434 LTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFE 493
           + +++ LTLAETAS+FGE LTF  +L+ A +KEERK+LLA K+EDM+N++VRQI+FYDFE
Sbjct: 415 MLSSTPLTLAETASVFGEMLTFRKMLEKAKTKEERKVLLAGKVEDMINTVVRQIAFYDFE 474

Query: 494 LKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYA 553
            KLH   R+ G++    IN +W+  Q ESLG  FD  +  Y +FW  +PHF+ S FYVYA
Sbjct: 475 CKLHAA-RAEGELTPEDINALWMSVQAESLGEGFDFME-GYETFWAYIPHFVHSPFYVYA 532

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YAFG+ LVN+LY +Y +   + F++KY ++L+AG SKH+ ELL P  ++ SDP FW++GL
Sbjct: 533 YAFGDGLVNALYSVY-AEGAEGFEDKYFDLLKAGGSKHHKELLAPFGLDASDPKFWDKGL 591

Query: 614 QTVEKMIDDVEKM 626
             +  +ID++E M
Sbjct: 592 SMISGLIDELEAM 604


>gi|17988356|ref|NP_540989.1| oligoendopeptidase F [Brucella melitensis bv. 1 str. 16M]
 gi|17984133|gb|AAL53253.1| oligoendopeptidase f [Brucella melitensis bv. 1 str. 16M]
          Length = 607

 Score =  497 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 295/598 (49%), Positives = 407/598 (68%), Gaps = 4/598 (0%)

Query: 29  SQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG 88
            + +LGNLP WNL DLYP+ DS ++++D+E    +S+ F+ RW+G LA    + N  +L 
Sbjct: 12  KKHDLGNLPEWNLADLYPAPDSPQLASDLEKAMQDSVRFEERWKGKLADEAAKPNGGNLA 71

Query: 89  AAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINT 148
            AI E+E + EL+GRI SYA L Y  + + P   K + D   KL D    LIFF LE+N 
Sbjct: 72  EAIREFEALSELMGRIGSYAGLYYYGDTTDPKRMKLFGDAQQKLTDASTPLIFFTLELNC 131

Query: 149 LDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCEN 208
           +D+ +LE++  ++P    Y  W+ ++R  K + L + +E L  + S  G  A  R F E 
Sbjct: 132 IDDTVLEKAMNENPAIGHYRPWLTDLRMDKPYQLDDKLEQLFHEKSITGYSAWNRLFDET 191

Query: 209 IESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEE 268
           +  LRF+I  +++ +        D+D  VRK A++AL+ TF  +   F+ ITNTLAKD+E
Sbjct: 192 MSGLRFEIGGEQLAIEPTLNMLQDADGAVRKQASEALAKTFTANLRTFTLITNTLAKDKE 251

Query: 269 IQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFW 328
           I DRWR ++ IADS+HLSN VE  V++AL ++V++ YP+ SHRYY LK KWL L+ +  W
Sbjct: 252 ISDRWRGFKDIADSQHLSNRVEREVVDALAKAVEDAYPRLSHRYYALKAKWLDLEKLENW 311

Query: 329 DRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAF 388
           DR APLP T Q +IP++ AR+ VL +Y  F+P+M+ IA KFF  NWIDAP   GK  GAF
Sbjct: 312 DRNAPLPETPQALIPWDEARETVLSAYGNFAPEMADIARKFFDRNWIDAPVRPGKAPGAF 371

Query: 389 AHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASI 448
           AH T+PS HPY+LLNY+GKP+DVMTLAHELGHG+H VL+  +QG L  ++ LTLAETAS+
Sbjct: 372 AHPTVPSAHPYVLLNYMGKPRDVMTLAHELGHGVHQVLAG-SQGALMASTPLTLAETASV 430

Query: 449 FGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPT 508
           FGE LTF  LL+    K ERK +LA K EDM+N++VRQI+FY FE ++HTERR+   + +
Sbjct: 431 FGEMLTFRLLLERTRDKRERKAMLAQKAEDMINTVVRQIAFYQFERRVHTERRAGE-LTS 489

Query: 509 HRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIY 568
            RI EIW++ Q+ESLG A  L+   Y +FW  +PHFI S FYVYAYAFG+CLVNSLY +Y
Sbjct: 490 ERIGEIWMDVQRESLGDAVRLN-PGYETFWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVY 548

Query: 569 KSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           + N+   F++KY  +L+AG +KH+ ELL P  ++ SDP FW +GL  +E +ID++E M
Sbjct: 549 Q-NSEKGFQQKYFEMLKAGGTKHHKELLAPFGLDASDPGFWNKGLSVIEGIIDELEAM 605


>gi|329115656|ref|ZP_08244378.1| Oligoendopeptidase F-like protein [Acetobacter pomorum DM001]
 gi|326695084|gb|EGE46803.1| Oligoendopeptidase F-like protein [Acetobacter pomorum DM001]
          Length = 645

 Score =  497 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 261/618 (42%), Positives = 384/618 (62%), Gaps = 12/618 (1%)

Query: 11  SNAFFRKALRSSDMTTM---DSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAF 67
           S       + +++  T+    + +   +LPRW+L  LY   D  ++  D+   E ++ AF
Sbjct: 36  SLRSHPLPVFATEAGTVANTPAGQGAASLPRWDLSALYAGMDDPKLHADLAEAEKKAQAF 95

Query: 68  KTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTD 127
             +++G ++      +   L  AIA +E I E++G+  SYA L +  + S  +I +F   
Sbjct: 96  AKQYQGKISGL----SGKELADAIATFEIIEEMLGKAGSYASLLFAADSSDASISQFSQS 151

Query: 128 INAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDME 187
           IN +L      L+FF LE+N L+EA L +   QDP    +  ++++IR  + H LS+D+E
Sbjct: 152 INERLTAISTHLLFFTLELNRLEEADLREKL-QDPTLAHWQPYLRDIRMYRPHQLSDDVE 210

Query: 188 CLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSH 247
            +L + S  G +A  R F E I +LR  ++ Q+I +  A     D++R  R+ A KA+  
Sbjct: 211 KVLLEKSVTGGQAWCRLFDETIAALRVTLDGQEITVGDALNRLSDTNRATREQAGKAVGG 270

Query: 248 TFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPK 307
            F K+  +F+ ITNTLAKD+ I D  R + +   SR+LSN VE  V++AL+ +V++ YP+
Sbjct: 271 VFEKNVRLFALITNTLAKDKSISDNLRHFARPTSSRNLSNMVEDEVVDALVSAVRSDYPR 330

Query: 308 TSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAE 367
            SHRYY LK KW+ LD +  WDR APLPG    +IP+  A+++V ++Y  F P+M  +  
Sbjct: 331 LSHRYYALKAKWMGLDKLEHWDRNAPLPGNDDKLIPWSEAKNIVQKAYDGFDPRMGKVIN 390

Query: 368 KFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLS 427
            F T+ WID P   GK  GAFAH T+PS HPYILLNY G+ +DVMTLAHELGHG+H V++
Sbjct: 391 TFLTNPWIDVPPAPGKSPGAFAHPTVPSAHPYILLNYHGRIRDVMTLAHELGHGVHQVMA 450

Query: 428 SETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQI 487
           ++ QG   +++ LTLAETAS+FGE LTF SLL A    + R++LLA K+EDMLN++VRQI
Sbjct: 451 AK-QGYFMSDTPLTLAETASVFGEMLTFQSLLDAEKDPQRRRLLLAAKVEDMLNTVVRQI 509

Query: 488 SFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIES 547
           +FY+FE ++H  R+    +   +I  IW   Q ESLGPAF+ +  EY  FW  +PHFI S
Sbjct: 510 AFYEFETRVHDARKKGELL-PEQIGAIWRGVQTESLGPAFNFT-PEYDVFWAYIPHFIHS 567

Query: 548 SFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPN 607
            FYVYAYAFG+CLVN+LY ++ S     F++KY+ +L AG +  + ELL P  ++ SDP 
Sbjct: 568 PFYVYAYAFGDCLVNALYQVF-SEGAPGFQDKYIAMLEAGGTLRHKELLAPFGLDASDPG 626

Query: 608 FWERGLQTVEKMIDDVEK 625
           FW +GL  +   ID +E+
Sbjct: 627 FWRKGLDVISGFIDQLEQ 644


>gi|254486948|ref|ZP_05100153.1| oligoendopeptidase F [Roseobacter sp. GAI101]
 gi|214043817|gb|EEB84455.1| oligoendopeptidase F [Roseobacter sp. GAI101]
          Length = 610

 Score =  497 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 273/613 (44%), Positives = 385/613 (62%), Gaps = 9/613 (1%)

Query: 14  FFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEG 73
            F+      D     +   LGNLP WNL+DLY   D+ E+  D++ +E    +F T +EG
Sbjct: 5   MFQLPFPVRDANAGAAASPLGNLPEWNLDDLYTGEDATELKRDLDWLEEACRSFATDFEG 64

Query: 74  NLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA 133
           NLA+     +       +   E+I ++ GRI S+A L Y    +     KF +D+  K+ 
Sbjct: 65  NLANL----DAAGFLDCVLRNEKINQVAGRIMSFAGLRYYQQTTDAGRTKFMSDVQEKIT 120

Query: 134 DFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDT 193
           +F   L+FF LE+N L++  L +   Q+    +Y      IR +K + LS+++E  L D 
Sbjct: 121 NFTTPLVFFTLELNRLEDDHLGKLLVQNADLARYKPVFDRIRAMKDYQLSDELEKFLHDL 180

Query: 194 SQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSS 253
             VG +A +R F E I +L F ++ +++ +        D +R++R+SAA+ L+  F  + 
Sbjct: 181 GVVG-DAWERLFDETIAALEFVVDGEQLNIEGVLNLLTDPNRDLRESAARELADVFRSNI 239

Query: 254 HIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY 313
             F+ + NT AK++E+ DRWR        RHLSN+VEP V+EAL  +V N YPK SHRYY
Sbjct: 240 KTFARVHNTQAKEKEVIDRWRGMPTPQTGRHLSNHVEPEVVEALRNAVVNAYPKLSHRYY 299

Query: 314 ELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHN 373
           ELK+KWL LD M  WDR APLP     +I ++ A  +V+ +Y  F P+M  IA+ FFT  
Sbjct: 300 ELKRKWLGLDVMQVWDRNAPLPMEDPKLIGWDRAEHMVMDAYNAFDPRMGEIAKPFFTDG 359

Query: 374 WIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGI 433
           WIDA    GK  GAFAH T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG 
Sbjct: 360 WIDAGVKPGKAPGAFAHPTVTNVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGE 418

Query: 434 LTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFE 493
           + +++ LTLAETAS+FGE LTF  +L  A +  ERK+LLA K+EDM+N++VRQI+FYDFE
Sbjct: 419 MLSSTPLTLAETASVFGEMLTFRKMLDNAKTNAERKVLLAGKVEDMINTVVRQIAFYDFE 478

Query: 494 LKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYA 553
            KLH  RR  G++    IN +W+  Q ESLGPAF+  D  Y +FW  +PHF+ S FYVYA
Sbjct: 479 CKLHDARR-GGELTPDDINALWMSVQAESLGPAFEFMD-GYETFWAYIPHFVHSPFYVYA 536

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YAFG+ LVN+LY +Y       F++KY ++L+AG SKH+ ELL P  ++ SDP FW++GL
Sbjct: 537 YAFGDGLVNALYAVY-DEGTPGFEDKYFDMLKAGGSKHHKELLAPFGLDASDPAFWDKGL 595

Query: 614 QTVEKMIDDVEKM 626
             +   ID++E M
Sbjct: 596 SMISGFIDELEAM 608


>gi|126727495|ref|ZP_01743329.1| Peptidase M3B, oligoendopeptidase-related clade 3 [Rhodobacterales
           bacterium HTCC2150]
 gi|126703275|gb|EBA02374.1| Peptidase M3B, oligoendopeptidase-related clade 3 [Rhodobacterales
           bacterium HTCC2150]
          Length = 612

 Score =  496 bits (1278), Expect = e-138,   Method: Composition-based stats.
 Identities = 273/605 (45%), Positives = 382/605 (63%), Gaps = 8/605 (1%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
            D  T       G+LP WNL+DLY   ++ E++ DM  +E+    F   +EGNLA     
Sbjct: 14  RDAATSGGTNEFGDLPEWNLDDLYKGEEASELTRDMAWLENACADFAKTYEGNLAGL--- 70

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            N  ++   I  YE+I    GRI S+A L Y  N +     KF +D    +  F   L+F
Sbjct: 71  -NADAMLECILAYEKIDSTAGRIMSFAGLRYYQNTTDADRAKFMSDCQENITVFTTPLVF 129

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
           F+LE N +++A  E   A +    +Y   +  +R +K + LS+++E  L D S VG  A 
Sbjct: 130 FSLEFNRIEDADYEAIIAANADLARYRPVLDRMRAMKPYQLSDELEKFLHDQSTVGSAAW 189

Query: 202 KRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITN 261
            R F E++  L F+++ + +PL        D DR  R+  A+A++     +  +++ I N
Sbjct: 190 NRLFDESMAGLEFEVDGEMLPLEATLNLMSDQDRATREKGARAVAAVLQDNVKLYARIHN 249

Query: 262 TLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLK 321
           TLAK++EI+DRWR        RHLSN+VEP V+EAL  +V   YPK SHRYY LK KW+ 
Sbjct: 250 TLAKEKEIEDRWRGLPTPQTGRHLSNHVEPEVVEALRNAVVAAYPKLSHRYYALKAKWMG 309

Query: 322 LDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYD 381
           LD M  WDR APLP   +  +P++ A DLV+++Y  F+P+M+ +A+ FFT  WIDA    
Sbjct: 310 LDEMQVWDRNAPLPSEIKRTVPWDEAEDLVMKAYGDFAPEMAELAKPFFTDGWIDAAVKP 369

Query: 382 GKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLT 441
           GK  GAFAH T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL++E QG + +++ LT
Sbjct: 370 GKAPGAFAHPTVTDVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAE-QGEMLSSTPLT 428

Query: 442 LAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERR 501
           LAETAS+FGE LTF  +L+ A  + ERKILLA K+EDM+N++VRQI+FYDFE KLH   R
Sbjct: 429 LAETASVFGEMLTFRKMLEGAKDQSERKILLAGKVEDMINTVVRQIAFYDFECKLHAA-R 487

Query: 502 STGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLV 561
           + G++    IN +W+  Q ESLGP F+  +  Y +FW  +PHF+ S FYVYAYAFG+ LV
Sbjct: 488 ADGELTPDDINALWMSVQAESLGPVFEYME-GYETFWAYIPHFVHSPFYVYAYAFGDGLV 546

Query: 562 NSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMID 621
           N+LY +Y       F+EKY ++L+AG SKH+ ELL P  ++ SDP FW++GL  +  MID
Sbjct: 547 NALYAVY-EEGTPGFQEKYFDMLKAGGSKHHKELLAPFGLDASDPAFWDKGLSMISGMID 605

Query: 622 DVEKM 626
           ++E M
Sbjct: 606 ELEAM 610


>gi|241206286|ref|YP_002977382.1| oligoendopeptidase, pepF/M3 family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860176|gb|ACS57843.1| oligoendopeptidase, pepF/M3 family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 617

 Score =  496 bits (1277), Expect = e-138,   Method: Composition-based stats.
 Identities = 295/593 (49%), Positives = 402/593 (67%), Gaps = 4/593 (0%)

Query: 34  GNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAE 93
           G LP W L+DLYPS  S     DME     ++AF+ +W+G L  AT +     +GAA+ E
Sbjct: 26  GVLPVWKLQDLYPSATSTAFVADMEKAGKAAIAFEEKWKGTLTEATAKTGAEGIGAALKE 85

Query: 94  YERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEAL 153
           YE + ++IGR+ S+A L+Y  + ++PT  K Y D+ AK+ +F   L+FFALE+N +D+A+
Sbjct: 86  YEALDDIIGRLGSFAGLTYFSDTTNPTNGKLYGDVQAKITEFSGHLLFFALELNRIDDAV 145

Query: 154 LEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLR 213
           ++   A DP    Y  W+ ++RK K + L + +E L  + S     A  R F E +  LR
Sbjct: 146 IDACMANDPAAGHYRPWLLDLRKDKPYQLDDRLEQLFLEKSMTSAAAFNRLFDETMAELR 205

Query: 214 FKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRW 273
           ++I+ +K+PL  A     + D EVR+ AA AL+ TF  +   F+ ITNTLAKD+EI DRW
Sbjct: 206 YEIDGEKVPLEVALNKLQEKDPEVRRKAAMALAETFKANIRTFTLITNTLAKDKEIADRW 265

Query: 274 RKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAP 333
           R +E IADSRHL+N VE  V++AL  +V+  YP+ SHRYY++K KWL ++ M FWDR AP
Sbjct: 266 RGFEDIADSRHLANRVEREVVDALAAAVREAYPRLSHRYYKMKAKWLGMEQMNFWDRNAP 325

Query: 334 LPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTI 393
           LP TS  II +  A+D VL +Y  FSP+M+ IA +FF   WIDAP   GK  GAFAH T+
Sbjct: 326 LPETSSAIISWPEAKDTVLSAYGNFSPEMADIARRFFDEQWIDAPVRAGKAPGAFAHPTV 385

Query: 394 PSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETL 453
           PS HPY+L+NY+GKP+DVMTLAHELGHG+H VL+   QG L   + LTLAETAS+FGE L
Sbjct: 386 PSAHPYVLVNYMGKPRDVMTLAHELGHGVHQVLAGA-QGALMCQTPLTLAETASVFGEML 444

Query: 454 TFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINE 513
           TF +LLQ  +   ERK +LA K+EDM+N++VRQI+FY+FE KLHT  R  G++    I E
Sbjct: 445 TFRALLQKTTDTRERKAMLAQKVEDMINTVVRQIAFYEFERKLHTA-RKAGELTADDIGE 503

Query: 514 IWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTV 573
           +WL  Q ESLGPA  +S+  Y ++W  +PHFI S FYVYAYAFG+CLVNSLY +Y+    
Sbjct: 504 LWLSVQSESLGPAISISE-GYETYWAYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQKA-E 561

Query: 574 DCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
             F+EKY  +LRAG +KH+SELL P  ++ +DP+FW +GL  +E +ID++E +
Sbjct: 562 KGFQEKYFELLRAGGTKHHSELLKPFGLDATDPSFWSQGLSMIEGLIDELEAL 614


>gi|15966549|ref|NP_386902.1| putative oligoendopeptidase F protein [Sinorhizobium meliloti 1021]
 gi|307300414|ref|ZP_07580194.1| oligoendopeptidase, pepF/M3 family [Sinorhizobium meliloti BL225C]
 gi|307318279|ref|ZP_07597714.1| oligoendopeptidase, pepF/M3 family [Sinorhizobium meliloti AK83]
 gi|15075820|emb|CAC47375.1| Putative oligoendopeptidase F [Sinorhizobium meliloti 1021]
 gi|306895961|gb|EFN26712.1| oligoendopeptidase, pepF/M3 family [Sinorhizobium meliloti AK83]
 gi|306904580|gb|EFN35164.1| oligoendopeptidase, pepF/M3 family [Sinorhizobium meliloti BL225C]
          Length = 627

 Score =  496 bits (1276), Expect = e-138,   Method: Composition-based stats.
 Identities = 296/603 (49%), Positives = 401/603 (66%), Gaps = 6/603 (0%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
            T   +   LG LP W L DLY S  S+E  +D+   E +++AF+ +W+G L  A  +  
Sbjct: 28  ATAAPT--ELGELPSWRLTDLYLSPSSEEFRSDLAKAEADAIAFEAKWKGKLKEAAGRTG 85

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
              +GAA+ E+E + +L+GRIAS+A L+Y  + S+P   K Y D+ +KL D    L+FF+
Sbjct: 86  DQGIGAAVKEFEALDDLMGRIASFAGLTYFSDTSNPANGKLYGDVQSKLTDISAHLLFFS 145

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
           LE+N +D+ +++ +   D L   Y  WI ++RK K + L + +E L  + S  G  A  R
Sbjct: 146 LELNRIDDKVIDDALTTDSLAAHYRPWILDLRKDKPYQLDDRLEQLFLEKSMTGANAFNR 205

Query: 204 FFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTL 263
            F E I SL F ++ ++ PL        D   EVRK AA AL+ TF  +   F+ +TNTL
Sbjct: 206 LFDETIASLTFSVDGKEQPLEVTLNLLQDPSVEVRKKAALALAETFKANIRTFTLVTNTL 265

Query: 264 AKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLD 323
           AKD+EI DRWR +E IADSRHL+N VE  V++AL  SVK  YP+ SHRYY +K KWL ++
Sbjct: 266 AKDKEISDRWRGFEDIADSRHLANRVEREVVDALAASVKAAYPRLSHRYYAMKAKWLGME 325

Query: 324 TMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGK 383
            M FWDR APLP T   +IP+  ARD VL +Y  F+P+M+ IA +FF   WIDAP   GK
Sbjct: 326 QMDFWDRNAPLPETPNALIPWNEARDTVLSAYHAFAPEMAAIARRFFDDGWIDAPVRPGK 385

Query: 384 GSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLA 443
             GAFAH T+PSVHPY+L+NY+GKP+DVMTLAHELGHG+H VL+   QG L  ++ LTLA
Sbjct: 386 APGAFAHPTVPSVHPYVLVNYMGKPRDVMTLAHELGHGVHQVLAGA-QGALMASTPLTLA 444

Query: 444 ETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRST 503
           ETAS+FGE LTF +LL     K ERK +LA K+EDM+N++VRQI+FYDFE K+HT  R  
Sbjct: 445 ETASVFGEMLTFRALLDRTKDKRERKAMLAQKVEDMINTVVRQIAFYDFERKVHTA-RKE 503

Query: 504 GDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNS 563
           G++    +  IWL  Q ESLGPA  LS+  Y ++W  +PHFI S FYVYAYAFG+CLVNS
Sbjct: 504 GELTAEDLGRIWLSVQSESLGPAIRLSE-SYETYWAYIPHFIHSPFYVYAYAFGDCLVNS 562

Query: 564 LYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDV 623
           LY +Y+ N    F+EKY  +L+AG +KH+SELL P  ++ +DP+FW +GL  +E +ID++
Sbjct: 563 LYAVYQ-NAERGFQEKYFEMLKAGGTKHHSELLAPFGLDATDPSFWAQGLSMIEGLIDEL 621

Query: 624 EKM 626
           E +
Sbjct: 622 EAL 624


>gi|317129600|ref|YP_004095882.1| oligoendopeptidase F [Bacillus cellulosilyticus DSM 2522]
 gi|315474548|gb|ADU31151.1| oligoendopeptidase F [Bacillus cellulosilyticus DSM 2522]
          Length = 604

 Score =  496 bits (1276), Expect = e-138,   Method: Composition-based stats.
 Identities = 144/601 (23%), Positives = 266/601 (44%), Gaps = 18/601 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           ++ T++  ++ +     W+LED+Y ++D  E   D   ++      K  ++G L      
Sbjct: 2   ANTTSLPKRDEIPKELTWDLEDIYATNDDWE--KDFSQVKEMLPKLKE-FKGKLG----- 53

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
           ++  SL   +   + +  L+G++ +YA + Y+ + ++   +      +  L+       F
Sbjct: 54  ESADSLYDLLKYQDEVSILLGKLYTYAHMRYDQDTTNSFYQGLNDRASQLLSQVSNAASF 113

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              E+ ++ E  + Q   +      Y   ++ I + + H+LS   E +L+  S+V   + 
Sbjct: 114 VTPELLSIPEEKINQFLDEKDELKLYKHALEKINRQRPHVLSEKEESILAQVSEVTDSSS 173

Query: 202 KRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   ++F     +      I   +  +     D+ VR  A KA+  T+ K  + 
Sbjct: 174 NTFGMLNNADMKFPSVKDEEGNEIEITHGRYIRFLESDDQRVRSDAFKAVYDTYGKFKNT 233

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K        R YE    +    N++   V + L+ +  N +    HRY +L
Sbjct: 234 FASTISGNVKRNIFNANVRNYESARQAALSKNDIPEVVYDQLVST-VNDHLHLLHRYVKL 292

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +KK L +D ++ +D   PL       IP+E A+DLV +  A    +   I E+ F + W+
Sbjct: 293 RKKVLGVDELHMYDLYTPLVKEVDMKIPYEEAKDLVTKGVAPLGEEYVSIVEEGFNNRWV 352

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G      PYIL+N+     ++ TLAHE GH +H   + + Q    
Sbjct: 353 DVEENVGKRSGAYSSG-AYGTMPYILMNWQDNVNNLFTLAHEFGHSVHSYYTRKHQPYPY 411

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            N S+ +AE AS   E L  D LL+    K++R  LL + +E    ++ RQ  F +FE  
Sbjct: 412 ANYSIFVAEVASTCNEALLNDYLLKVTDDKQKRLYLLNHFLEGFRGTVFRQTMFAEFEKL 471

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H +  +   +    ++ ++ +  K+  G    + D E    W  +PHF   +FYVY YA
Sbjct: 472 MHEKAANGEPLTPDLLSSMYYDLNKKYFGDDIVIDD-EIALEWARIPHFY-YNFYVYQYA 529

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +    + L+AGNS +  E+L    ++++     ++ L  
Sbjct: 530 TGYSAATALAKQILDEGEPAVQRYIDHFLKAGNSDYPIEVLKKAGVDMTSSEPIKQALAV 589

Query: 616 V 616
            
Sbjct: 590 F 590


>gi|126738727|ref|ZP_01754423.1| oligoendopeptidase F [Roseobacter sp. SK209-2-6]
 gi|126719908|gb|EBA16615.1| oligoendopeptidase F [Roseobacter sp. SK209-2-6]
          Length = 606

 Score =  495 bits (1275), Expect = e-138,   Method: Composition-based stats.
 Identities = 274/613 (44%), Positives = 383/613 (62%), Gaps = 9/613 (1%)

Query: 14  FFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEG 73
                    D       E LGNLP W+L DLY   D+ E+S D++ +E E  AF   +EG
Sbjct: 1   MLHLPFPVKDANAASGSEELGNLPEWDLSDLYKGEDAAELSRDLDWLEQECSAFAADYEG 60

Query: 74  NLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA 133
            LA      +   L   +   E+I  + GRI SYA L Y    +     KF +D+  K+ 
Sbjct: 61  KLAGL----DAAGLLDCVLRNEKINAIAGRIMSYAGLRYYQLTTDADRAKFMSDMQEKIT 116

Query: 134 DFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDT 193
            F   L+FF LEIN +D+ +L   +A +    +Y      IR +K + LS+++E  L D 
Sbjct: 117 IFTTPLVFFTLEINRIDDDVLAGHFAANADLARYQPIFDRIRAMKPYQLSDELEKFLHDL 176

Query: 194 SQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSS 253
             VG +A +R F E I  L+F I+ +++ +        + DR  R++A++ L+  F ++ 
Sbjct: 177 GVVG-DAWERLFDETIAGLKFTIDGEELNIEGTLNFLTEQDRSKREAASRELARVFAENV 235

Query: 254 HIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY 313
             F+ + NT AK++EI DRWR        RHLSN+VEP V+EAL ++V   YPK SHRYY
Sbjct: 236 KTFARVHNTQAKEKEIVDRWRGMPTPQTGRHLSNHVEPEVVEALREAVVAAYPKLSHRYY 295

Query: 314 ELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHN 373
           ELK+KWL LD M  WDR APLP     ++ ++ A   V+++Y  F P+M  IA  FF+  
Sbjct: 296 ELKRKWLGLDRMQVWDRNAPLPMEDSRVVNWDEAEQTVMEAYNAFDPRMGEIAAPFFSDG 355

Query: 374 WIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGI 433
           WIDA    GK  GAFAH T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL++E QG 
Sbjct: 356 WIDAGVKPGKAPGAFAHPTVTEVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAE-QGE 414

Query: 434 LTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFE 493
           + +++ LTLAETAS+FGE LTF  +L  A +KE+RK+LLA K+EDM+N++VRQI+FYDFE
Sbjct: 415 MLSSTPLTLAETASVFGEMLTFRKMLDKAETKEQRKVLLAGKVEDMINTVVRQIAFYDFE 474

Query: 494 LKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYA 553
            KLH   R+ G++    IN +W+  Q ESLG AFD  +  Y +FW  +PHF+ S FYVYA
Sbjct: 475 CKLHAA-RAEGELTPDDINALWMSVQAESLGDAFDFME-GYETFWCYIPHFVHSPFYVYA 532

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YAFG+ LVN+LY +Y +   + F++KY ++L+AG SKH+ ELL P  ++ SDP FW++GL
Sbjct: 533 YAFGDGLVNALYSVY-AEGGEGFEDKYFDMLKAGGSKHHKELLAPFGLDASDPKFWDKGL 591

Query: 614 QTVEKMIDDVEKM 626
             +  MID++E M
Sbjct: 592 AMISGMIDELEAM 604


>gi|288958999|ref|YP_003449340.1| oligoendopeptidase F [Azospirillum sp. B510]
 gi|288911307|dbj|BAI72796.1| oligoendopeptidase F [Azospirillum sp. B510]
          Length = 604

 Score =  495 bits (1274), Expect = e-138,   Method: Composition-based stats.
 Identities = 278/607 (45%), Positives = 385/607 (63%), Gaps = 8/607 (1%)

Query: 19  LRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHA 78
           + SS  T  +   +LG LP W+L DLYP  +S E+  D++ +E E  AF+ R  G L   
Sbjct: 1   MTSSAATAANDTPDLGALPTWDLSDLYPGTESPELKADLDRMEAECKAFRERHAGKLGTL 60

Query: 79  TNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKV 138
           T       L  AI +YE+I E + R+ SYA L YN ++  PT+ KFY     ++ D    
Sbjct: 61  T----GDELATAIRQYEQIDETLSRVMSYAGLVYNGDMVDPTVAKFYQSAQERVNDISAH 116

Query: 139 LIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGR 198
           LIFF LEIN LDEA L           +Y  W++++R  + H LS+++E LL +   VGR
Sbjct: 117 LIFFTLEINRLDEADLTAKQVASAALRQYGPWLRDVRLYRDHQLSDEIERLLHEKHVVGR 176

Query: 199 EALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSF 258
            A  R F E I SLRF +  + +   +A     D +  VR+ A + +      ++ +F+ 
Sbjct: 177 AAWNRLFDETIASLRFPMGGKDLTCAEALNRLSDRNPAVRREAGEVVGKVLGDNARLFAL 236

Query: 259 ITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKK 318
           +TNTLAKD+EI+D WR Y     +R+LSN VE  V++AL+ +VK  YP  SHRYY +K K
Sbjct: 237 VTNTLAKDKEIEDDWRNYPMPTSARNLSNRVEDEVVDALVSAVKGAYPDLSHRYYAMKAK 296

Query: 319 WLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAP 378
           W   D + +WDR APLP  +   IP++ ARD+VL +Y +FSP ++ + ++FF + WIDAP
Sbjct: 297 WFGQDHLDYWDRNAPLPEDADRSIPWDEARDIVLGAYGRFSPDLASLGKRFFDNPWIDAP 356

Query: 379 QYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNS 438
              GK  GAFAH T+PSVHPY+L+NY GK +DVMTLAHELGHG+H +L+   QG   +++
Sbjct: 357 VRPGKAPGAFAHPTVPSVHPYLLVNYQGKTRDVMTLAHELGHGVHQILAGR-QGHFLSDT 415

Query: 439 SLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHT 498
            LTLAETAS+FGE LTF +LL A +  + R+I+LA K+EDMLN++VRQI+F+DFE ++HT
Sbjct: 416 PLTLAETASVFGEMLTFRALLAAETDPKRRRIMLAGKVEDMLNTVVRQIAFFDFERRVHT 475

Query: 499 ERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGN 558
           ERR    + + RI EIW+  Q ESLGPA    D  Y  +W  +PHFI S FYVYAYAFG+
Sbjct: 476 ERREGE-LTSDRIGEIWMAVQTESLGPALRF-DEGYRHYWSYIPHFIHSPFYVYAYAFGD 533

Query: 559 CLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
           CLVNSLY +Y+ +    F EKYL +L AG +  + ELL P  ++ SDP FW++GL  +  
Sbjct: 534 CLVNSLYAVYQ-DAELGFAEKYLAMLSAGGTLRHKELLAPFGLDASDPAFWQKGLGVIRG 592

Query: 619 MIDDVEK 625
            ID++E 
Sbjct: 593 FIDELEA 599


>gi|188582122|ref|YP_001925567.1| oligoendopeptidase, pepF/M3 family [Methylobacterium populi BJ001]
 gi|179345620|gb|ACB81032.1| oligoendopeptidase, pepF/M3 family [Methylobacterium populi BJ001]
          Length = 601

 Score =  495 bits (1273), Expect = e-137,   Method: Composition-based stats.
 Identities = 283/597 (47%), Positives = 379/597 (63%), Gaps = 6/597 (1%)

Query: 31  ENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS-LGA 89
            +LG LP W+L DLYPS D+    +D++  E ES  F  R+ G +A      +  + LG 
Sbjct: 8   ADLGALPEWDLTDLYPSMDAPAFRDDLDRAEAESRTFAERYAGRIAGIAAAPDASTVLGE 67

Query: 90  AIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTL 149
           A+  YERI +L+GR+ SYA L Y+ + +     KFY D   +L      L+FF LE+N +
Sbjct: 68  AVETYERIEDLMGRLMSYAGLVYSGDTTDEIRAKFYGDTRERLTTASGDLLFFGLELNRV 127

Query: 150 DEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENI 209
           ++A+L+ + A  P   +Y  WI+++R+ K H L +  E L  + S     A  R F E I
Sbjct: 128 EDAVLDAAMADGP-LARYRPWIEDLRREKPHQLDDRTEKLFLEKSVTSSAAWDRLFNETI 186

Query: 210 ESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEI 269
            SLRF +  +++ L        D D  VRK AA A+  T   +  IF+ ITNTLAKD+EI
Sbjct: 187 ASLRFPVQGERLTLEPTLNKLQDPDGAVRKEAALAIGDTLQANLRIFTLITNTLAKDKEI 246

Query: 270 QDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWD 329
            DRWR ++ +AD+RHLSN VEP V+ A++++V+  YP+ SHRYY LK KW  ++ + +WD
Sbjct: 247 SDRWRGFKDVADARHLSNRVEPEVVAAMVEAVRAAYPRLSHRYYRLKAKWFGVEALPYWD 306

Query: 330 RLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFA 389
           R APLP   Q  IP+  ARD VL++Y  FSP M+ IA KFF   WIDAP   GK  GAFA
Sbjct: 307 RNAPLPKVEQRTIPWAQARDTVLEAYNAFSPDMAGIARKFFDGGWIDAPTRPGKAPGAFA 366

Query: 390 HGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIF 449
           H T+PS HPY+L+NY GKP+DVMTLAHELGHG+H VL++   G L   + LTLAETAS+F
Sbjct: 367 HPTVPSAHPYVLVNYQGKPRDVMTLAHELGHGVHQVLAASN-GALMAPTPLTLAETASVF 425

Query: 450 GETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTH 509
           GE LTF  LL   +   +R+ +LA K+EDM+N++VRQI+FY FE K+H   R+ G++   
Sbjct: 426 GEMLTFRRLLGQTTDPTQRRAMLAAKVEDMINTVVRQIAFYSFERKVH-LARAQGELTAE 484

Query: 510 RINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYK 569
           +INE+W+  Q ESLGPA  L D  Y  FW  +PHFI S FYVYAYAFG+CLVNSLY +Y 
Sbjct: 485 QINELWMSVQAESLGPAITL-DKGYEPFWAYIPHFIHSPFYVYAYAFGDCLVNSLYGVYA 543

Query: 570 SNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
                 F E+Y  +L AG SK Y ELL P  ++  DP FW+ GL  +E MI ++E M
Sbjct: 544 RA-EPGFVERYFALLSAGGSKPYGELLKPFGLDARDPGFWQIGLGMIEGMIAELEAM 599


>gi|149202310|ref|ZP_01879283.1| Peptidase M3B, oligoendopeptidase-related clade 3 [Roseovarius sp.
           TM1035]
 gi|149144408|gb|EDM32439.1| Peptidase M3B, oligoendopeptidase-related clade 3 [Roseovarius sp.
           TM1035]
          Length = 631

 Score =  494 bits (1272), Expect = e-137,   Method: Composition-based stats.
 Identities = 275/613 (44%), Positives = 377/613 (61%), Gaps = 9/613 (1%)

Query: 14  FFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEG 73
                    D        NLG LP W+L DLY S  + E+  D++ +      F T +EG
Sbjct: 26  MLNLPFPVRDANASSGNRNLGQLPEWDLSDLYTSEKAPELKRDLDWLHSACAEFATDYEG 85

Query: 74  NLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA 133
            LA      +   L   I   E I    GRI SYA L Y    +     KF +D   K+ 
Sbjct: 86  KLATL----DAAGLLECIRRDEAISTTAGRIMSYAGLRYYQLTTDGGRAKFMSDCQEKVT 141

Query: 134 DFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDT 193
           +    L+FF+LE+N LDE  L   YA++    +Y   +  IR +K + LS+++E  L D 
Sbjct: 142 NSTTPLVFFSLELNRLDEGALTAMYAENADLARYKPVLDRIRAMKPYQLSDELEKFLHDL 201

Query: 194 SQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSS 253
             VG +A +R F E I  L F ++   + +        + DR  R+SAA+ L+  F ++ 
Sbjct: 202 GVVG-DAWERLFDETIAGLTFTVDGDDLTIEGTLNLLTEQDRSKRESAARELARVFGENI 260

Query: 254 HIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY 313
             F+ + NT AK++E+ DRWRK       RHLSN+VEP V+EAL  +V   YPK SHRYY
Sbjct: 261 RTFARVHNTQAKEKEVIDRWRKMPTAQTGRHLSNDVEPEVVEALRNAVVAAYPKLSHRYY 320

Query: 314 ELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHN 373
           ELK+KWL L+ M  WDR APLP  +  ++ ++ ARD V+ +YA F P+M+ +A+ FF   
Sbjct: 321 ELKRKWLGLERMQVWDRNAPLPMEATRLVDWDEARDTVMGAYAAFDPRMADLAQPFFERG 380

Query: 374 WIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGI 433
           WIDA    GK  GAFAH T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H  L+++ QG 
Sbjct: 381 WIDAGVKPGKAPGAFAHPTVTTVHPYVMLNYLGKPRDVMTLAHELGHGVHQRLAAD-QGE 439

Query: 434 LTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFE 493
           L +++ LTLAETAS+FGE LTF  +L  A ++ ERK+LLA K+EDM+N++VRQI+FYDFE
Sbjct: 440 LLSSTPLTLAETASVFGEMLTFRRMLAGAQTQAERKVLLAGKVEDMINTVVRQIAFYDFE 499

Query: 494 LKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYA 553
            KLH  RR    +    IN +W+  Q +SLG AFD  D  Y +FW  +PHFI S FYVYA
Sbjct: 500 CKLHAARREGE-LTPDDINALWMSVQAQSLGEAFDFMD-GYETFWAYIPHFIHSPFYVYA 557

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YAFG+ LVN+LY +Y+ N  D F++KY ++L+AG SKH+ ELL P  ++ SDP FW++GL
Sbjct: 558 YAFGDGLVNALYAVYEENP-DGFQDKYFDLLKAGGSKHHKELLAPFGLDASDPAFWDKGL 616

Query: 614 QTVEKMIDDVEKM 626
             +  MID++E M
Sbjct: 617 SMISGMIDELEAM 629


>gi|222087066|ref|YP_002545601.1| oligoendopeptidase F protein [Agrobacterium radiobacter K84]
 gi|221724514|gb|ACM27670.1| oligoendopeptidase F protein [Agrobacterium radiobacter K84]
          Length = 618

 Score =  493 bits (1270), Expect = e-137,   Method: Composition-based stats.
 Identities = 287/594 (48%), Positives = 405/594 (68%), Gaps = 4/594 (0%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           LG+LP W L DLYPS  S   + DME     ++AF+ +W+G LA A  +     +GAA+ 
Sbjct: 25  LGDLPAWKLSDLYPSATSTAFTGDMEKAGKLAVAFEEKWKGKLAEAATKSGDAGIGAALK 84

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
           EYE + ++IGR+ S+A L+Y  N S P   K Y D+  +L D+   L+FF LE+N +D+A
Sbjct: 85  EYEALDDIIGRLGSFAGLTYFSNTSDPANGKLYGDVQTRLTDYAAHLLFFPLELNRIDDA 144

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
           +++   A DP    Y  W+ ++RK K + L + +E L  + S     A  R F E +  L
Sbjct: 145 VMDACMANDPTAGHYRPWLVDLRKDKPYQLDDRLEQLFLEKSMTSAAAFNRLFDETMAEL 204

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           RF+++ +K+PL        + D EVR+ AA+AL+ TF  +  +F+ ITNTLAKD++I DR
Sbjct: 205 RFEVDGEKLPLEVTLNMLQEKDPEVRRKAAEALTTTFKANLRVFTLITNTLAKDKDIADR 264

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR +E IADSRHL+N VE  V++AL  +V++ YP+ SHRYY++K KWL ++ M FWDR A
Sbjct: 265 WRGFEDIADSRHLANRVEREVVDALAAAVRDAYPRLSHRYYKMKAKWLGMEQMNFWDRNA 324

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP +S  +IP+  A++ VL +Y  F+P+M+ IA++FF   WIDAP   GK  GAFAH T
Sbjct: 325 PLPESSNALIPWSEAKETVLSAYGNFAPEMADIAKRFFDEEWIDAPVRPGKAPGAFAHPT 384

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +PS HPY+L+NY+GKP+DVMTLAHELGHG+H VL+   QG L   + LTLAETAS+FGE 
Sbjct: 385 VPSAHPYVLVNYMGKPRDVMTLAHELGHGVHQVLAG-GQGALMCQTPLTLAETASVFGEM 443

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF +LL   + K ERK +LA K+EDM+N++VRQI+FY+FE K+H   R  G++ +  I 
Sbjct: 444 LTFRALLDKTTDKRERKAMLAQKVEDMINTVVRQIAFYEFERKVHAA-RKNGELTSDDIG 502

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
           E+WL  Q ESLGPA  +S+  Y ++W  +PHFI S FYVYAYAFG+CLVNSLY +Y+ N 
Sbjct: 503 ELWLSVQSESLGPAIRISE-GYETYWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQ-NA 560

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + F+ KY  +L+AG +KH+SELL P  ++ +DP+FW +GL  +E +ID++E +
Sbjct: 561 EEGFQAKYFELLKAGGTKHHSELLKPFGLDATDPSFWSKGLSMIEGLIDELEAL 614


>gi|222149716|ref|YP_002550673.1| oligoendopeptidase F [Agrobacterium vitis S4]
 gi|221736698|gb|ACM37661.1| oligoendopeptidase F [Agrobacterium vitis S4]
          Length = 619

 Score =  493 bits (1270), Expect = e-137,   Method: Composition-based stats.
 Identities = 294/594 (49%), Positives = 406/594 (68%), Gaps = 4/594 (0%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           LG LP W L DLYP+  S     D+      SLAF+T+W+G L  A  +     LGAA+ 
Sbjct: 26  LGTLPEWQLTDLYPAPSSDLFKADLAKASEMSLAFETKWKGRLEDAAAKDADQGLGAALK 85

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
           E+E + +L+G+I SYA L Y   ++ P   KF+ D+ A+L +    L+FF LE+N LD+A
Sbjct: 86  EFEELEDLLGKIGSYAGLYYYSEMTKPENGKFFGDVQARLTELAAHLLFFTLELNRLDDA 145

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
           +++ + A+DP T  Y  W+ ++R+ K + L + +E L  + SQ G  A  R F E + SL
Sbjct: 146 VIDAAIARDPATAHYKPWLIDLRQDKPYQLDDKLEQLFLEKSQTGSAAFNRLFDETLASL 205

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           RF+I+ +++ L        ++D  +R+ AA ALS TF  +  IF  +TNTLAKD+EI DR
Sbjct: 206 RFEIDGEQLTLEPVLTMLQEADPALREKAAMALSKTFKDNIRIFVLVTNTLAKDKEISDR 265

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR +  IADSRHLSN VE  V++AL  +V++ YP+ SHRYY++K KWL ++ M FWDR A
Sbjct: 266 WRGFADIADSRHLSNRVERPVVDALAAAVRDAYPRLSHRYYKMKAKWLGMEQMNFWDRNA 325

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP +   IIP++ AR  VL +Y  F+P M+ IA +FF   WIDAP   GK  GAFAH T
Sbjct: 326 PLPDSIDRIIPWDEARQTVLSAYGGFAPDMAEIAGRFFDGGWIDAPARPGKAPGAFAHPT 385

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +PS HPY+L+NYLGKP+DVMTLAHELGHG+H VL+ E QG L   + LTLAETAS+FGE 
Sbjct: 386 VPSAHPYVLVNYLGKPRDVMTLAHELGHGVHQVLAGE-QGALMCQTPLTLAETASVFGEM 444

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF +LL+ A+   ERK +LA K+EDM+N++VRQI+FY+FE KLHT  R  G++   +I 
Sbjct: 445 LTFRALLEKATDARERKAMLAQKVEDMINTVVRQIAFYEFERKLHTA-RKEGELTAEKIG 503

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
           E+WL  Q+ESLGPA  +S+  Y ++W  +PHFI S FYVYAYAFG+CLVNSLY +Y+ N 
Sbjct: 504 ELWLSVQEESLGPAIKVSE-GYETWWAYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQ-NA 561

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              F++KY ++L+AG SKH+SELL P  ++ +DP+FW +GL  +E +ID++E +
Sbjct: 562 EQGFQQKYFDLLKAGGSKHHSELLAPFGLDATDPSFWAKGLSMIEGLIDELEAL 615


>gi|86137864|ref|ZP_01056440.1| oligoendopeptidase F [Roseobacter sp. MED193]
 gi|85825456|gb|EAQ45655.1| oligoendopeptidase F [Roseobacter sp. MED193]
          Length = 607

 Score =  493 bits (1269), Expect = e-137,   Method: Composition-based stats.
 Identities = 269/613 (43%), Positives = 381/613 (62%), Gaps = 9/613 (1%)

Query: 14  FFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEG 73
             +      D       + LGNLP W+L DLY + D+ E++ D++ +  E  AF + +EG
Sbjct: 1   MLQLPFPVRDANASSGSDELGNLPEWDLTDLYAADDAPELTRDLDWLAQECSAFASDYEG 60

Query: 74  NLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA 133
            LA      +   L   +   E+I  + GR+ SYA L Y    +     KF +D   K+ 
Sbjct: 61  KLADL----DAEGLLNCVLRNEKINAIAGRVMSYAGLRYYQLTTDAERAKFMSDCQEKIT 116

Query: 134 DFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDT 193
            F   L+FF LEIN +++  L   +A +    +Y      IR +K + LS+++E  L D 
Sbjct: 117 IFTTPLVFFTLEINRIEDETLAAHFATNSDLARYKPVFDRIRAMKPYQLSDELERFLHDL 176

Query: 194 SQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSS 253
             VG +A +R F E I  L F ++  ++ +        + DR  R++A++ L+  F  + 
Sbjct: 177 GVVG-DAWERLFDETIAGLTFTVDGLELNIEGTLNLLTEQDRNKREAASRELARVFQDNV 235

Query: 254 HIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY 313
             F+ + NT AK++EI DRWR        RHLSN+VEP V+EAL ++V   YPK SHRYY
Sbjct: 236 KTFARVHNTQAKEKEILDRWRGMPTPQTGRHLSNDVEPEVVEALREAVVAAYPKLSHRYY 295

Query: 314 ELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHN 373
           ELK+KWL LD M  WDR APLP     ++ +  A   V+++Y  F P+M  +A  FF+  
Sbjct: 296 ELKRKWLGLDRMQVWDRNAPLPMEDTRVVDWAQAEKTVMEAYEAFDPRMGELAAPFFSKG 355

Query: 374 WIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGI 433
           WIDA    GK  GAFAH T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL++E QG 
Sbjct: 356 WIDAGVKPGKAPGAFAHPTVTDVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAE-QGE 414

Query: 434 LTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFE 493
           + +++ LTLAETAS+FGE LTF  +L+ A +KE+RKILLA K+EDM+N++VRQI+FYDFE
Sbjct: 415 MLSSTPLTLAETASVFGEMLTFRKMLEGAETKEQRKILLAGKVEDMINTVVRQIAFYDFE 474

Query: 494 LKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYA 553
            KLH   R+ G++    IN +W+  Q ESLG AFD  +  Y +FW  VPHF+ S FYVYA
Sbjct: 475 CKLHAA-RAEGELTPDDINALWMSVQAESLGEAFDFME-GYETFWCYVPHFVHSPFYVYA 532

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YAFG+ LVN+LY +Y +   + F++KY ++L+AG SKH+ ELL P  ++ SDP FW++GL
Sbjct: 533 YAFGDGLVNALYSVY-AEGGEGFEDKYFDMLKAGGSKHHKELLAPFGLDASDPKFWDKGL 591

Query: 614 QTVEKMIDDVEKM 626
             + +MID++E M
Sbjct: 592 SMISEMIDELEAM 604


>gi|330993414|ref|ZP_08317349.1| Oligoendopeptidase F-like protein [Gluconacetobacter sp. SXCC-1]
 gi|329759444|gb|EGG75953.1| Oligoendopeptidase F-like protein [Gluconacetobacter sp. SXCC-1]
          Length = 614

 Score =  493 bits (1269), Expect = e-137,   Method: Composition-based stats.
 Identities = 265/626 (42%), Positives = 387/626 (61%), Gaps = 23/626 (3%)

Query: 10  FSNAFFRKALRSSDMTTMDSQENLGN----------LPRWNLEDLYPSHDSQEISNDMEC 59
            S A+F   + +        +E  G           LPRW+L DLY    + +++ D++ 
Sbjct: 1   MSKAYFSAPVSALS----PVREEAGQPSGGAPGLSGLPRWDLSDLYEGPQAPQLATDLDQ 56

Query: 60  IEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSP 119
            + +S  F   W+G LA     +    L  AIAEY+RI E++GR  SYA L +  N S  
Sbjct: 57  ADADSQDFARVWQGRLASVPGGE----LAQAIAEYQRIDEVLGRAGSYAQLLFAANTSDS 112

Query: 120 TIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKK 179
            + +F   +N +L      L+FF LEIN + + +L    + DP    ++ +++++R  + 
Sbjct: 113 EVARFAQSVNERLTAISTHLLFFTLEINRIPDDVLAAQMS-DPALAHWAPFLRDLRVFRP 171

Query: 180 HLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRK 239
           + L +++E +L + S  G  A  R F E +  LR ++  + + L  A  +    DR VR 
Sbjct: 172 YQLPDEVEAVLHEKSVTGPAAWNRLFDETMAGLRVRVGGESLTLGNALDTMSSPDRSVRA 231

Query: 240 SAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQ 299
           SAA+A+     ++  +FS ITNTLAKD+ I D  R Y +   +R+ +N VE  V++AL+Q
Sbjct: 232 SAARAIGDELGRNVKLFSLITNTLAKDKAIMDGLRHYPRPTSARNCANMVEDEVVDALVQ 291

Query: 300 SVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFS 359
           +V   YP+ SHRYY LK KWL L+ + +WDR APL    + +I ++ A   VL +Y  F 
Sbjct: 292 AVTEAYPRLSHRYYALKAKWLGLEKLEYWDRNAPLTTQDEPLIGWKEATGQVLGAYEGFD 351

Query: 360 PQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELG 419
           P+M  +A++FF H WIDAP   GK SGAFAH T+PSVHPY+LLNY G+ +DVMTLAHELG
Sbjct: 352 PRMGKVAKEFFDHAWIDAPPVPGKASGAFAHPTVPSVHPYLLLNYRGRTRDVMTLAHELG 411

Query: 420 HGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDM 479
           HG+H VL+   QG L +++ LTLAETAS+FGE LTF +LL A +    R+++LA K+EDM
Sbjct: 412 HGVHQVLAGR-QGYLMSSTPLTLAETASVFGEMLTFRALLDAQTDPTRRRLMLAAKVEDM 470

Query: 480 LNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWM 539
           LN++VRQ++FY FE  +H ERR    +   RI EIW +TQ ESLGPAF+ +  +Y  +W 
Sbjct: 471 LNTVVRQVAFYRFETLVHEERRKGELL-PARIGEIWRQTQAESLGPAFNFT-PDYDVYWT 528

Query: 540 MVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPL 599
            VPHFI S FYVYAYAFG+CLVN+LY +++S     F++KYL++L AG +K + ELL P 
Sbjct: 529 YVPHFIHSPFYVYAYAFGDCLVNALYGVFRS-GHPGFQDKYLDMLAAGGTKRHRELLAPF 587

Query: 600 NINLSDPNFWERGLQTVEKMIDDVEK 625
            ++ +DP FW++GL  +   ID++E+
Sbjct: 588 GLDAADPGFWQKGLDVIAGFIDELER 613


>gi|85704963|ref|ZP_01036063.1| oligoendopeptidase F [Roseovarius sp. 217]
 gi|85670285|gb|EAQ25146.1| oligoendopeptidase F [Roseovarius sp. 217]
          Length = 606

 Score =  493 bits (1269), Expect = e-137,   Method: Composition-based stats.
 Identities = 273/613 (44%), Positives = 379/613 (61%), Gaps = 9/613 (1%)

Query: 14  FFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEG 73
                    D        NLGNLP W+L DLY S  + E+  D+E ++     F   +EG
Sbjct: 1   MLNLPFPVRDANATSGNRNLGNLPEWDLSDLYTSETAPELKRDLEWLQSACAEFAADYEG 60

Query: 74  NLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA 133
            LA      +   L   I   E I  + GRI SYA L Y    +     KF +D   K+ 
Sbjct: 61  KLATL----DAKGLVDCIQRDEAISNIAGRIMSYAGLRYYQLTTDGGRAKFMSDCQEKVT 116

Query: 134 DFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDT 193
           +    L+FF+LE+N LDE  L   Y+++    +Y   +  IR +K + LS+++E  L D 
Sbjct: 117 NSTTPLVFFSLELNRLDETALTAMYSENNDLARYKPVLDRIRAMKPYQLSDELEKFLHDL 176

Query: 194 SQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSS 253
             VG +A +R F E I  L F ++   + +        + DR  R++AA+ L+  F ++ 
Sbjct: 177 GVVG-DAWERLFDETIAGLTFTVDGDDLSIEGTLNLLTEQDRSKREAAARELARVFGENI 235

Query: 254 HIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY 313
             F+ + NT AK++E+ DRWRK       RHLSN+VEP V+EAL  +V   YPK SHRYY
Sbjct: 236 RTFARVHNTQAKEKEVIDRWRKMPSAQTGRHLSNDVEPEVVEALRNAVVAAYPKLSHRYY 295

Query: 314 ELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHN 373
           ELK+KWL LD M  WDR APLP  +  I+ ++ AR+ V+ +Y  F P+M+ +A+ FF   
Sbjct: 296 ELKRKWLGLDRMQVWDRNAPLPMDATRIVDWDEARETVMTAYGAFDPRMADLAQPFFEQG 355

Query: 374 WIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGI 433
           WIDA    GK  GAFAH T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H  L+++ QG 
Sbjct: 356 WIDAGVKPGKAPGAFAHPTVTNVHPYVMLNYLGKPRDVMTLAHELGHGVHQRLAAD-QGE 414

Query: 434 LTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFE 493
           L +++ LTLAETAS+FGE LTF  +L  A ++ ERK+LLA K+EDM+N++VRQI+FYDFE
Sbjct: 415 LLSSTPLTLAETASVFGEMLTFQRMLDGAKTQAERKVLLAGKVEDMINTVVRQIAFYDFE 474

Query: 494 LKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYA 553
            KLH  RR  G++    IN +W+  Q +SLG AFD  D  Y +FW  +PHFI S FYVYA
Sbjct: 475 CKLHAARR-DGELTPDDINLLWMSVQAQSLGEAFDFMD-GYETFWAYIPHFIHSPFYVYA 532

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YAFG+ LVN+LY +Y+ N  + F++KY  +L+AG SKH+ +LL P  ++ SDP FW++GL
Sbjct: 533 YAFGDGLVNALYAVYEENP-EGFQDKYFEMLKAGGSKHHKDLLAPFGLDASDPAFWDKGL 591

Query: 614 QTVEKMIDDVEKM 626
             +  MID++E M
Sbjct: 592 SMISGMIDELEAM 604


>gi|15615419|ref|NP_243722.1| peptidase [Bacillus halodurans C-125]
 gi|10175477|dbj|BAB06575.1| peptidase [Bacillus halodurans C-125]
          Length = 598

 Score =  492 bits (1267), Expect = e-137,   Method: Composition-based stats.
 Identities = 138/609 (22%), Positives = 278/609 (45%), Gaps = 19/609 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
             T+  +  +     W+LE ++ + +  E   +   ++    +   +++G L+     ++
Sbjct: 2   AKTLPKRSEIPVDLTWDLEAIFSTDEEWE--KEFNEVKGLIPSLV-QFKGKLS-----QS 53

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
              L AA+ + + I E +GR+ +YA + Y+ + ++   +          +   +   F  
Sbjct: 54  AEILYAALQQQDEITERLGRLYTYAHMRYDQDTTNSFYQGLNDRAQTLASQVGQAASFVV 113

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            E+ ++++  ++    +      Y   +  + K + H+LS   E +L+  S+V       
Sbjct: 114 PELMSIEKEKIDTFLNEHEPLTLYRHMLDELNKQRPHVLSEAEESILAQASEVTSAPSNT 173

Query: 204 FFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           F   N   + F     +      +   +  +     DR VRK A +A+  T+ K  + F+
Sbjct: 174 FGMLNNADMTFPTIVNENGEEVEVTHGRYLQFLESGDRRVRKDAFQAVYSTYEKYKNTFA 233

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
              ++  K +      RKY+   ++    N +   V + L+ +  N      HRY +L+K
Sbjct: 234 STLSSQVKRDLFYANVRKYKSAREAALSRNFIPEVVYDQLVST-VNDNLHLLHRYVKLRK 292

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           + L +D ++ +D   PL    +  I ++ A++LVL+ +A          ++ +   WID 
Sbjct: 293 RILGVDELHMYDLYTPLVKDVEMKISYDEAKELVLKGFAPLGESYIDEIKQGYEKRWIDV 352

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK SGA++ G      PYIL+N+     +V TLAHELGH +H   S + Q     +
Sbjct: 353 VENKGKRSGAYSSG-AYGTMPYILMNWQDNIDNVFTLAHELGHSMHSFYSRKHQPYPYGD 411

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
            ++ +AE AS   E L  D L++  ++++E+  LL + +E    ++ RQ  F +FE  +H
Sbjct: 412 YTIFVAEVASTLNEALLNDYLVKNTNNEQEKIYLLNHFLEGFRGTVFRQTMFAEFEQLIH 471

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
            +      +    +++++ +   +  G    + D E G  W  +PHF   +FYVY YA G
Sbjct: 472 EQSADGIPLTPELLSKLYYDLNVKYFGDEIVI-DKEIGLEWARIPHFY-YNFYVYQYATG 529

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                +L      +      E+YL+ L+AG+S++  ++L    ++++     +  L   E
Sbjct: 530 YSAAAALAKQILEDGAP-VVERYLDFLKAGSSQYPIDILKHAGVDMTSKKPIQEALSLFE 588

Query: 618 KMIDDVEKM 626
           K +D++E +
Sbjct: 589 KTLDEIEAL 597


>gi|298292669|ref|YP_003694608.1| oligoendopeptidase, pepF/M3 family [Starkeya novella DSM 506]
 gi|296929180|gb|ADH89989.1| oligoendopeptidase, pepF/M3 family [Starkeya novella DSM 506]
          Length = 614

 Score =  492 bits (1267), Expect = e-137,   Method: Composition-based stats.
 Identities = 284/595 (47%), Positives = 387/595 (65%), Gaps = 6/595 (1%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           L NLP+W+L DLYP+ DS E+  D+  +  +   F+  ++G LA   +  +  S  A I 
Sbjct: 22  LDNLPQWDLSDLYPAIDSPELQADLAEVASDCATFEEAYKGKLAGILDAADAGSQMALIV 81

Query: 93  -EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDE 151
             YE+I + +GR+ SYA L Y+ + + P   KFY D+  KL D    L+FF LE+N LD+
Sbjct: 82  SRYEKIEDRLGRLYSYAGLVYSGDTTDPVRAKFYGDVQEKLTDASTHLLFFTLELNRLDD 141

Query: 152 ALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIES 211
           A +E + A  P   KY  WI ++R  K + L + +E L  +     R A  R F E I  
Sbjct: 142 AKMEAALAA-PEFGKYRPWIDDVRAEKPYQLEDRIEQLFHEKGVTSRSAWNRLFDETIAG 200

Query: 212 LRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
           LRF I+ Q +PL +A     +   E R++AA+AL+  F ++  +F+ +TNTLAKD+EI D
Sbjct: 201 LRFDIDGQNLPLEQALNLLQEPQEEKRRAAAEALAKVFGENLRLFTLVTNTLAKDKEISD 260

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRL 331
           RWR ++ IADSRHL+N VE  V++AL+ SV   YP+ +HRYY+LK KW   D + +WDR 
Sbjct: 261 RWRGFDDIADSRHLANRVEREVVDALVSSVHAAYPRLAHRYYKLKAKWFGKDKLEYWDRN 320

Query: 332 APLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHG 391
           APLP      I ++ ARD VL +Y+ FSP+M+ IA  FF  +WIDA    GK +GAFAH 
Sbjct: 321 APLPKVETRTIGWDEARDTVLGAYSTFSPRMADIARTFFDKSWIDAGVRPGKATGAFAHP 380

Query: 392 TIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE 451
           T+PS HPY+LLNYLGKP+DVMTLAHELGHG+H VL++   G L   + LTLAETAS+FGE
Sbjct: 381 TVPSAHPYVLLNYLGKPRDVMTLAHELGHGVHQVLAAPN-GALMAPTPLTLAETASVFGE 439

Query: 452 TLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRI 511
            LTF  LL  A     RK +LA K+EDM+N++VRQI+FY FE ++HTE R  G++   +I
Sbjct: 440 MLTFRRLLATAPDARTRKAMLAAKVEDMINTVVRQIAFYTFERRIHTE-RKNGELTAEQI 498

Query: 512 NEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSN 571
            +IW+E Q ESLG A  L    Y ++W+ + HFI S FYVYAYAFG+CLVNSLY +Y  N
Sbjct: 499 CKIWMEVQAESLGEAIHL-GPGYEAYWVYIGHFIHSPFYVYAYAFGDCLVNSLYAVY-EN 556

Query: 572 TVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
             + F E+YL +L AG +KH+SELL P  ++  DP FW+ GL  +E+MI ++E M
Sbjct: 557 ASEGFAERYLAMLAAGGTKHHSELLKPFGLDARDPAFWQTGLNLIERMIAELEAM 611


>gi|146338288|ref|YP_001203336.1| putative oligoendopeptidase F [Bradyrhizobium sp. ORS278]
 gi|146191094|emb|CAL75099.1| putative oligoendopeptidase F [Bradyrhizobium sp. ORS278]
          Length = 655

 Score =  492 bits (1267), Expect = e-137,   Method: Composition-based stats.
 Identities = 274/595 (46%), Positives = 390/595 (65%), Gaps = 6/595 (1%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC-HSLGAAI 91
           +G LP WNL DLY   D+ EI++D+  ++ E +AF+T ++G +A    +++    L AA+
Sbjct: 65  IGTLPEWNLGDLYSGIDAPEIAHDLAKMDAECVAFETDYKGKIAEHVAREDGGEWLAAAV 124

Query: 92  AEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDE 151
             YE I +L GR+ S+A L++  +   P I KFY DI+ +L      L+FF LE+N +D+
Sbjct: 125 RRYEAIDDLAGRLGSFAGLAHAGDSVDPAISKFYGDISERLTTASTHLLFFPLELNRIDD 184

Query: 152 ALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIES 211
           +++ ++    P    Y  WI+++RK K + L + +E L  + SQ G  A  R F + I  
Sbjct: 185 SVIARAMET-PALGHYRPWIEDLRKDKPYQLEDRVEQLFHEKSQTGYSAWNRLFDQTIAG 243

Query: 212 LRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
           LRF+++ +++ +        D D   RK+AA+AL+ TF  +   F+ ITNTLAKD++I D
Sbjct: 244 LRFQVDGKELAIEPTLNFLQDRDGGKRKAAAEALAKTFKANERTFALITNTLAKDKDISD 303

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRL 331
           RWR ++ +ADSRHL+N VE  V++AL+ SV+  YPK SHRYY LK +W K   +  WDR 
Sbjct: 304 RWRGFQDVADSRHLNNRVEREVVDALVASVRAAYPKLSHRYYRLKARWFKKKKLAHWDRN 363

Query: 332 APLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHG 391
           APLP  +   I +  A+++VL +Y  FSP+M+ IA++FF  +WIDAP   GK  GAF+H 
Sbjct: 364 APLPFAANATIAWPEAKNMVLTAYRGFSPEMADIAQRFFDQSWIDAPVRPGKAPGAFSHP 423

Query: 392 TIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE 451
           T PS HPY+L+NY GKP+DVMTLAHELGHG+H VL+++  G L   + LTLAETAS+FGE
Sbjct: 424 TTPSAHPYVLMNYQGKPRDVMTLAHELGHGVHQVLAAKN-GALMAPTPLTLAETASVFGE 482

Query: 452 TLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRI 511
            LTF  LL      ++R+ LLA K+EDM+N++VRQI+FY FE  +HTER+    +   R+
Sbjct: 483 MLTFKRLLSQTKDAKQRQALLAGKVEDMINTVVRQIAFYSFERAVHTERKHGE-LTAERL 541

Query: 512 NEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSN 571
            ++WL  Q ESLG A ++    Y +FW  +PHFI S FYVYAYAFG+CLVNSLY +Y  +
Sbjct: 542 GQLWLSVQTESLGEAIEIK-PGYENFWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVY-EH 599

Query: 572 TVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
             D F E+YL +L AG +KHYSELL P  ++  DP FW+ GL  +  MID++E M
Sbjct: 600 AADGFAERYLAMLAAGGTKHYSELLKPFGLDAKDPRFWDGGLSVIAGMIDELEAM 654


>gi|209550872|ref|YP_002282789.1| oligoendopeptidase, pepF/M3 family [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536628|gb|ACI56563.1| oligoendopeptidase, pepF/M3 family [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 617

 Score =  492 bits (1266), Expect = e-137,   Method: Composition-based stats.
 Identities = 288/593 (48%), Positives = 401/593 (67%), Gaps = 4/593 (0%)

Query: 34  GNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAE 93
           G+LP W L+DLYPS  S     DME     ++AF+ +W+G LA A  +     +GAA+ E
Sbjct: 26  GDLPVWKLQDLYPSATSTAFVADMEKAGKAAIAFEEKWKGKLADAATKTGTEGIGAALKE 85

Query: 94  YERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEAL 153
           YE + +++GR+ S+A L+Y  + + P   K Y D+  K+ +F   L+FFALE+N +D+A+
Sbjct: 86  YEALDDIMGRLGSFAGLTYFSDTTDPANGKLYGDVQTKITEFSGHLLFFALELNRIDDAV 145

Query: 154 LEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLR 213
           ++ S   DP    Y  W+ ++RK K + L + +E L  + S     A  R F E +  LR
Sbjct: 146 IDASMVNDPAAGHYRPWLVDLRKDKPYQLDDRLEQLFLEKSMTSAAAFNRLFDETMAELR 205

Query: 214 FKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRW 273
           ++I+ +K+PL  A     + D +VR+ AA AL+ TF  +  IF+ ITNTLAKD++I DRW
Sbjct: 206 YEIDGEKVPLEVALNMLQEKDPDVRRKAAMALAATFKANIRIFTLITNTLAKDKDIADRW 265

Query: 274 RKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAP 333
           R +E IADSRHL+N VE  V++AL  +V+  YP+ SHRYY++K KWL ++ M FWDR AP
Sbjct: 266 RGFEDIADSRHLANRVEREVVDALAAAVREAYPRLSHRYYKMKAKWLGMEQMNFWDRNAP 325

Query: 334 LPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTI 393
           LP TS  +I +  A+D VL +Y  F+P+M+ IA +FF   WIDAP   GK  GAFAH T+
Sbjct: 326 LPETSSAVISWPEAKDTVLSAYGNFAPEMADIARRFFDEQWIDAPVRPGKAPGAFAHPTV 385

Query: 394 PSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETL 453
           PS HPY+L+NY+GKP+DVMTLAHELGHG+H VL+   QG L   + LTLAETAS+FGE L
Sbjct: 386 PSAHPYVLVNYMGKPRDVMTLAHELGHGVHQVLAGA-QGALMCQTPLTLAETASVFGEML 444

Query: 454 TFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINE 513
           TF +LL+  S K ERK +LA K+EDM+N++VRQI+FY+FE KLHT  R  G++    I E
Sbjct: 445 TFRALLEKTSDKRERKAMLAQKVEDMINTVVRQIAFYEFERKLHTA-RKAGELTADDIGE 503

Query: 514 IWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTV 573
           +WL  Q ESLGPA  +S+  Y ++W  +PHFI S FYVYAYAFG+CLVNSLY +Y+    
Sbjct: 504 LWLSVQSESLGPAISISE-GYETYWAYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQKA-E 561

Query: 574 DCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
             F+ KY  +L+AG +KH+SELL P  ++ +DP+FW +GL  +E +ID++E +
Sbjct: 562 TGFQAKYFELLKAGGTKHHSELLKPFGLDATDPSFWSQGLSMIEGLIDELEAL 614


>gi|99080410|ref|YP_612564.1| peptidase M3B, oligoendopeptidase-related clade 3 [Ruegeria sp.
           TM1040]
 gi|99036690|gb|ABF63302.1| Peptidase M3B oligoendopeptidase-related clade 3 [Ruegeria sp.
           TM1040]
          Length = 606

 Score =  492 bits (1266), Expect = e-137,   Method: Composition-based stats.
 Identities = 270/613 (44%), Positives = 387/613 (63%), Gaps = 9/613 (1%)

Query: 14  FFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEG 73
            F+      D        +LG LP W+L DLY   D+ E+S D++ ++ E  AF   +EG
Sbjct: 1   MFQLPFPVRDANASSGAGDLGKLPEWDLSDLYAGEDAAELSRDLDWLQGECAAFAADYEG 60

Query: 74  NLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA 133
            LA      +   L   +   E+I  + GRI SYA L Y    +     KF +D+  K+ 
Sbjct: 61  KLAEL----DAEGLLTCVHRNEKINNIAGRIMSYAGLRYYQLTTDADRAKFLSDVQEKVT 116

Query: 134 DFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDT 193
            F   L+FF LEIN +++A L+  +  +    +Y      IR +K + LS+++E  + D 
Sbjct: 117 VFTTPLVFFTLEINRIEDAKLDALFEANADLARYKPVFDRIRAMKPYQLSDELERFMHDL 176

Query: 194 SQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSS 253
             VG +A ++ F E I  L F+I  +++ +        + DR  R++AA+ L+  F  + 
Sbjct: 177 GIVG-DAWEKLFDETIAGLTFEIEGEELGIEATLNFLTEQDRSKREAAARELARVFADNI 235

Query: 254 HIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY 313
            IF+ + NT AK++EI DRWR        RHLSN+VEP V+EAL ++V   YPK SHRYY
Sbjct: 236 KIFARVHNTQAKEKEIIDRWRGMPSPQMGRHLSNDVEPEVVEALREAVVAAYPKLSHRYY 295

Query: 314 ELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHN 373
           ELK+KWL LD M  WDR APLP  +  ++ +E AR  V+++Y  F P+M  +A+ FF   
Sbjct: 296 ELKRKWLGLDRMQVWDRNAPLPMETTRVVDWEEARATVMEAYEAFDPRMGELAQPFFDKG 355

Query: 374 WIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGI 433
           WIDA    GK  GAFAH T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H VL+++ QG 
Sbjct: 356 WIDAGVKPGKAPGAFAHPTVTNVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAD-QGE 414

Query: 434 LTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFE 493
           + +++ LTLAETAS+FGE LTF  +L+ A +KEERK+LLA K+EDM+N++VRQI+FYDFE
Sbjct: 415 MLSSTPLTLAETASVFGEMLTFRKMLEKAQTKEERKVLLAGKVEDMINTVVRQIAFYDFE 474

Query: 494 LKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYA 553
            KLH   R+ G++    IN +W+  Q ESLG +FD  +  Y +FW  +PHF+ S FYVYA
Sbjct: 475 CKLHAA-RAEGELTPEDINALWMSVQAESLGESFDFME-GYETFWAYIPHFVHSPFYVYA 532

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YAFG+ LVN+LY +Y +   + F++KY ++L+AG SKH+ ELL P  ++ SDP FW++GL
Sbjct: 533 YAFGDGLVNALYSVY-AEGAEGFEDKYFDMLKAGGSKHHKELLAPFGLDASDPKFWDKGL 591

Query: 614 QTVEKMIDDVEKM 626
             +  +ID++E M
Sbjct: 592 SMISGLIDELEAM 604


>gi|27382240|ref|NP_773769.1| oligoendopeptidase F [Bradyrhizobium japonicum USDA 110]
 gi|27355411|dbj|BAC52394.1| oligoendopeptidase F [Bradyrhizobium japonicum USDA 110]
          Length = 655

 Score =  492 bits (1266), Expect = e-137,   Method: Composition-based stats.
 Identities = 286/597 (47%), Positives = 393/597 (65%), Gaps = 6/597 (1%)

Query: 31  ENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS-LGA 89
              G LP WNL DLY   D+ E++ D+E ++ + +AF+T ++G LA  T  ++    L  
Sbjct: 63  SKTGRLPEWNLADLYSGIDAPEVARDLERMDADCVAFETDYKGKLATGTANEDGGKWLAE 122

Query: 90  AIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTL 149
           A+  YE I +L GR+ SYA L +  +   P I KFY D++ +L      L+FFALE+N +
Sbjct: 123 AVRRYEAIDDLAGRLGSYAGLVHAGDSVDPKISKFYGDVSERLTAASTHLLFFALELNRV 182

Query: 150 DEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENI 209
           D+ +L ++  Q P    Y  WI+++RK K + L + +E L  + +Q G  A  R F + I
Sbjct: 183 DDDILTRAM-QAPELAHYRPWIEDLRKEKPYQLDDKLEQLFLEKAQTGYSAFNRLFDQTI 241

Query: 210 ESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEI 269
             LRFK+  +++ +        D D   RK+AA+AL+ TF  +   F+ ITNTLAKD++I
Sbjct: 242 SGLRFKVGPKELAIEPTLNLLQDRDGAKRKTAAEALAKTFKANERTFALITNTLAKDKDI 301

Query: 270 QDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWD 329
            DRWR ++ +ADSRHL+N VE  V++AL+ SV+  YPK SHRYY LK KW     + +WD
Sbjct: 302 SDRWRGFKDVADSRHLNNRVEREVVDALVASVRAAYPKLSHRYYALKAKWFGKKRLAYWD 361

Query: 330 RLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFA 389
           R APLP  + D+I +  AR++VL +Y  FSP+M+ IAE+FFT  WIDAP   GK  GAF+
Sbjct: 362 RNAPLPFAATDVIGWPDARNMVLTAYRGFSPKMADIAERFFTDRWIDAPVRPGKAPGAFS 421

Query: 390 HGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIF 449
           H T PS HPY+L+NY GKP+DVMTLAHELGHG+H VL+++  G L   + LTLAETAS+F
Sbjct: 422 HPTTPSAHPYVLMNYQGKPRDVMTLAHELGHGVHQVLAAKN-GALMAPTPLTLAETASVF 480

Query: 450 GETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTH 509
           GE LTF  LL    S  +R+ LLA K+EDM+N++VRQI+FY FE  +HTE R  G++   
Sbjct: 481 GEMLTFRRLLAQTKSARQRQALLAGKVEDMINTVVRQIAFYSFERAVHTE-RKNGELTAT 539

Query: 510 RINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYK 569
           R+ EIWL  Q ESLGPA ++    Y ++WM +PHFI S FYVYAYAFG+CLVNSLY +Y 
Sbjct: 540 RLGEIWLSVQGESLGPAIEIK-AGYENYWMYIPHFIHSPFYVYAYAFGDCLVNSLYAVY- 597

Query: 570 SNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            N  + F E+YL++L AG +KHYSELL P  ++  DP FW+ GL  +  MID++E M
Sbjct: 598 ENAAEGFAERYLDMLAAGGTKHYSELLRPFGLDAKDPKFWDGGLSVIAGMIDELEAM 654


>gi|260434071|ref|ZP_05788042.1| putative oligoendopeptidase F [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417899|gb|EEX11158.1| putative oligoendopeptidase F [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 606

 Score =  492 bits (1266), Expect = e-137,   Method: Composition-based stats.
 Identities = 277/613 (45%), Positives = 382/613 (62%), Gaps = 9/613 (1%)

Query: 14  FFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEG 73
                    D       +NLGNLP WNL+DLY   D+ E++ D+E +E E   F   +EG
Sbjct: 1   MHELPFPVRDANAGGGADNLGNLPEWNLDDLYTGQDAPELTRDLEWLEQECAGFAADYEG 60

Query: 74  NLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA 133
            LA      +   L   +   E+I  + GRI S+A L Y    +     KF +D+  K+ 
Sbjct: 61  KLADL----DAQGLLTCVQRNEKINAVAGRIMSFAGLRYYQLTTDAERAKFLSDMQEKVT 116

Query: 134 DFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDT 193
            F   L+FF LEIN +D+ +L   +  +    +Y    + IR +K + LS+++E  L D 
Sbjct: 117 LFTTPLVFFTLEINRIDDDVLAAHFKANADLARYEPVFRRIRAMKPYQLSDELEKFLHDL 176

Query: 194 SQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSS 253
             VG +A +R F E I  L F +N +++ +        + DR  R++AA+ L+  F  + 
Sbjct: 177 GVVG-DAWERLFDETIAGLTFTVNGEELNIEGTLNLLTEQDRSKREAAARELARVFQDNI 235

Query: 254 HIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY 313
            IF+ + NT AK++EI DRWRK      +RHL+N+VEP V+EAL ++V   YPK SHRYY
Sbjct: 236 KIFARVHNTQAKEKEIIDRWRKMPTPQTARHLANDVEPEVVEALREAVVAAYPKLSHRYY 295

Query: 314 ELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHN 373
           ELK+KWL LD M  WDR APLP      +P+E A   V+++YA F P+M+ IA  FF+  
Sbjct: 296 ELKRKWLGLDVMQVWDRNAPLPMEDTRTVPWEDAEKTVMEAYAAFDPRMAEIAAPFFSKG 355

Query: 374 WIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGI 433
           WIDA    GK  GAFAH T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG 
Sbjct: 356 WIDAAVKPGKAPGAFAHPTVTDVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGE 414

Query: 434 LTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFE 493
           + +++ LTLAETAS+FGE LTF  +L  A + E+RK+LLA K+EDM+N++VRQI+FYDFE
Sbjct: 415 MLSSTPLTLAETASVFGEMLTFRKMLDQAETPEQRKVLLAGKVEDMINTVVRQIAFYDFE 474

Query: 494 LKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYA 553
            KLH  RR    +    IN +W+  Q ESLGPAF+  D  Y +FW  +PHF+ S FYVYA
Sbjct: 475 CKLHAARREGE-LTPDDINALWMSVQAESLGPAFEFMD-GYETFWAYIPHFVHSPFYVYA 532

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YAFG+ LVN+LY +Y  +  D F++KY  +LRAG SKH+ ELL P  ++ SDP FW++GL
Sbjct: 533 YAFGDGLVNALYSVY-ESGADGFEDKYFEMLRAGGSKHHKELLEPFGLDASDPKFWDKGL 591

Query: 614 QTVEKMIDDVEKM 626
             +   ID++E M
Sbjct: 592 SMISGFIDELEAM 604


>gi|190893376|ref|YP_001979918.1| oligoendopeptidase F protein [Rhizobium etli CIAT 652]
 gi|190698655|gb|ACE92740.1| oligoendopeptidase F protein [Rhizobium etli CIAT 652]
          Length = 617

 Score =  491 bits (1265), Expect = e-136,   Method: Composition-based stats.
 Identities = 292/594 (49%), Positives = 405/594 (68%), Gaps = 4/594 (0%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           LG+LP W L+DLYPS  S     DME     ++AF+ RW+G LA A  +     +GAA+ 
Sbjct: 25  LGDLPVWKLQDLYPSATSTAFVADMEKAGKAAIAFEQRWKGKLADAATKAGAEGIGAALK 84

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
           EYE + +++GR+ S+A L+Y  + ++PT  K Y D+ AK+ +F   L+FFALE+N +D+A
Sbjct: 85  EYEALDDIMGRLGSFAGLTYFSDTTNPTNGKLYGDVQAKITEFSGHLLFFALELNRIDDA 144

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
           +++   A DP    Y  W+ ++RK K + L + +E L  + S     A  R F E +  L
Sbjct: 145 VIDACIANDPDAGHYRPWLIDLRKDKPYQLDDRLEQLFLEKSMTSAAAFNRLFDETMAEL 204

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           R++I+  K+PL  A     + D EVR+ AA AL+ TF  +  IF+ ITNTLAKD++I DR
Sbjct: 205 RYEIDGAKVPLEVALNMLQEKDPEVRRKAAMALAETFKANIRIFTLITNTLAKDKDISDR 264

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR +E IADSRHL+N VE  V++AL  +V+  YP+ SHRYY++K KWL ++ M FWDR A
Sbjct: 265 WRGFEDIADSRHLANRVERVVVDALAAAVREAYPRLSHRYYKMKAKWLGMEQMNFWDRNA 324

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP TS  +I +  A+D VL +Y  F+P+M+ IA +FF   WIDAP   GK  GAFAH T
Sbjct: 325 PLPETSSAVISWSDAKDTVLSAYGNFAPEMADIARRFFDEQWIDAPVRPGKAPGAFAHPT 384

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +PS HPY+L+NY+GKP+DVMTLAHELGHG+H VL+   QG L   + LTLAETAS+FGE 
Sbjct: 385 VPSAHPYVLVNYMGKPRDVMTLAHELGHGVHQVLAGA-QGALMCQTPLTLAETASVFGEM 443

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF +LL+  + + ERK +LA K+EDM+N++VRQI+FY+FE KLHT  R +G++    I 
Sbjct: 444 LTFRALLEKTTDRRERKAMLAQKVEDMINTVVRQIAFYEFERKLHTA-RKSGELTADDIG 502

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
           E+WL  Q ESLGPA  +S+  Y ++W  +PHFI S FYVYAYAFG+CLVNSLY +Y+   
Sbjct: 503 ELWLSVQSESLGPAISISE-GYETYWAYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQKA- 560

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              F+EKY  +L+AG +KH+SELL P  ++ +DP+FW  GL  +E +ID++E +
Sbjct: 561 EKGFQEKYFELLKAGGTKHHSELLKPFGLDATDPSFWSHGLSMIEGLIDELEAL 614


>gi|90418903|ref|ZP_01226814.1| oligoendopeptidase F [Aurantimonas manganoxydans SI85-9A1]
 gi|90336983|gb|EAS50688.1| oligoendopeptidase F [Aurantimonas manganoxydans SI85-9A1]
          Length = 643

 Score =  491 bits (1265), Expect = e-136,   Method: Composition-based stats.
 Identities = 300/596 (50%), Positives = 404/596 (67%), Gaps = 5/596 (0%)

Query: 31  ENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAA 90
           +  G LP WNL DLYP+ DS E++ D+E    ++ AF+ RW G L  A   ++   L AA
Sbjct: 52  DETGALPEWNLSDLYPAMDSPELTRDVERARADAEAFQERWRGRLEEAAKAEDG-DLAAA 110

Query: 91  IAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLD 150
           +A +E + EL+GRI SYA L Y+ + S P   KFY DI + + D    L+FF LE+N + 
Sbjct: 111 VASFEALEELLGRIISYAGLVYSGDTSDPARAKFYGDIQSVVTDISSRLLFFPLELNRIA 170

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIE 210
           +A ++ +  +DP    Y  W+ ++R  K + L + +E L  + +  GR A  R F E + 
Sbjct: 171 DADMDAAMDRDPALAHYRPWLVDLRLDKPYQLEDRVEELFHEKAITGRGAFNRLFDETLT 230

Query: 211 SLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
           SLRF ++   + L        D DRE R+ AA AL++ F+++   F+ ITNTLAKD+EI 
Sbjct: 231 SLRFTVDGDDLALEATLNILQDPDREKRRKAASALTNVFSENLRTFTLITNTLAKDKEIS 290

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
           DRWR +E +ADSRHL+N VE  V++AL Q+V + YP  SHRYY +K KWL  D + +WDR
Sbjct: 291 DRWRGFEDVADSRHLANRVERDVVDALSQAVTDAYPSISHRYYAMKAKWLGQDVLDYWDR 350

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
            APLP +++  I ++ AR  VL +Y+ F+P+M+ IAE+FFT++WIDA    GK  GAFAH
Sbjct: 351 NAPLPDSTRRDISWDEARHTVLSAYSGFAPEMASIAERFFTNDWIDAAIRPGKSPGAFAH 410

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
            T+PSVHPY+LLNY+GKP+DVMTLAHELGHG+H VL+   QG L   + LTLAETAS+FG
Sbjct: 411 PTVPSVHPYVLLNYMGKPRDVMTLAHELGHGVHQVLAGR-QGALMAATPLTLAETASVFG 469

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E LTF SLL  A++K ERK LLA+K+EDM+N++VRQI+FY FE  LH ERR  G++ T R
Sbjct: 470 EMLTFRSLLDQATTKAERKTLLASKVEDMINTVVRQIAFYQFERALHEERR-GGELTTER 528

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
           I EIW++ QK SLGPA  L D  Y ++W  VPHFI S FYVYAYAFG+CLVNSLY +Y  
Sbjct: 529 IGEIWMDIQKRSLGPALRLGD-GYETYWTYVPHFIHSPFYVYAYAFGDCLVNSLYAVY-E 586

Query: 571 NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           N+   F+EKY  +L+AG +KH+SELL P  ++ SDP FW RGL  +   ID++E M
Sbjct: 587 NSEAGFQEKYFEMLKAGGTKHHSELLQPFGLDASDPAFWSRGLAMISGFIDELEAM 642


>gi|84500888|ref|ZP_00999123.1| oligoendopeptidase F [Oceanicola batsensis HTCC2597]
 gi|84390955|gb|EAQ03373.1| oligoendopeptidase F [Oceanicola batsensis HTCC2597]
          Length = 606

 Score =  491 bits (1263), Expect = e-136,   Method: Composition-based stats.
 Identities = 267/609 (43%), Positives = 371/609 (60%), Gaps = 9/609 (1%)

Query: 18  ALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAH 77
                D        +LG LP W+L DLY S +   I  D++ +     +F   +EG L  
Sbjct: 5   PAPLFDANATSGGRDLGKLPEWDLTDLYASPEDPAIERDLDWLREACASFAADYEGKLDQ 64

Query: 78  ATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEK 137
                +   +   I   E +  + GR+ SYA L Y    +     KF +D+  ++  +  
Sbjct: 65  L----DAEGMLTCIRRDEELTTVSGRLMSYAGLRYYQVTTDGARAKFMSDMQDRITTYTT 120

Query: 138 VLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVG 197
            L+FF LE+N L +  L+  +A      +Y      IR +K + LS++ME  L D   VG
Sbjct: 121 PLVFFTLELNRLPDDRLDSLFAASDDLARYKPIFDRIRAMKPYQLSDEMEKFLHDMGVVG 180

Query: 198 REALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
            +A ++ F E +  L F I+ +++ L        + DR+ R++AA+ ++     +   F+
Sbjct: 181 -DAWEKLFDETVAGLTFTIDGEELGLEATTTLLTEPDRDKREAAAREIARVLGANIRTFA 239

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
            + NT AK++E+ DRWR       +RHLSN+VEP V+EAL  +V   YP+ SHRYYELK+
Sbjct: 240 RVHNTQAKEKEVMDRWRGMPSAQTARHLSNHVEPEVVEALRNAVVAAYPRLSHRYYELKR 299

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           KWL LD M  WDR APLP      + ++ A+++V+ +YA F P+M+ +AE FFT  WIDA
Sbjct: 300 KWLGLDRMQVWDRNAPLPIEPPRTVDWDTAQEMVMSAYAGFDPRMANLAEPFFTRGWIDA 359

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
               GK  GAFAH T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H VL+++ QG L ++
Sbjct: 360 GVKPGKAPGAFAHPTVTTVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAD-QGELLSS 418

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
           + LTLAETAS+FGE LTF  LL  A S  ERK LLA K+EDM+N++VRQI+FYDFE KLH
Sbjct: 419 TPLTLAETASVFGEMLTFRKLLDEAKSDAERKTLLAGKVEDMINTVVRQIAFYDFECKLH 478

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
             RR    +    IN IW+  Q ESLGPAFD  D  Y  FW  +PHFI S FYVYAYAFG
Sbjct: 479 AARREGE-LTPEDINAIWMSVQAESLGPAFDFMD-GYEVFWSYIPHFIHSPFYVYAYAFG 536

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
           + LVN+LY  Y+    + F++KY ++LRAG SKH+ ELL P  ++ SDP FW++GL  +E
Sbjct: 537 DGLVNALYAAYQEAP-EGFQDKYFDMLRAGGSKHHKELLAPFGLDASDPKFWDKGLSMIE 595

Query: 618 KMIDDVEKM 626
             ID++E M
Sbjct: 596 GFIDELEAM 604


>gi|114706840|ref|ZP_01439740.1| Peptidase M3:Neutral zinc metallopeptidases, zinc-binding region
           [Fulvimarina pelagi HTCC2506]
 gi|114537788|gb|EAU40912.1| Peptidase M3:Neutral zinc metallopeptidases, zinc-binding region
           [Fulvimarina pelagi HTCC2506]
          Length = 609

 Score =  491 bits (1263), Expect = e-136,   Method: Composition-based stats.
 Identities = 294/594 (49%), Positives = 394/594 (66%), Gaps = 5/594 (0%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           +  LP W+L+DLYPS DS E+ +D++    ++  FK  W+G LA   N  +   L  +++
Sbjct: 20  ISELPEWSLDDLYPSMDSPELQSDLDKARQDATRFKENWKGKLADLANA-DPAGLARSVS 78

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
           EYE++ EL+GRI SYA L Y  + S P   KFY DI   + D    L+FF LE+N +++A
Sbjct: 79  EYEKLEELLGRIISYAGLVYAGDTSDPVRAKFYGDIQGSVTDIATNLLFFTLELNRIEDA 138

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
           +++ +   +P    +  W+ ++RK K   L + +E L  +    G  A  R F E + SL
Sbjct: 139 VMDSAMEAEPALAHFRPWLVDLRKDKPFQLEDRVEELFHEKGITGAGAWNRLFDETLTSL 198

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           RF ++   + L        D DR+ R+ AA AL++ F+++   F+ ITNTLAKD+EI DR
Sbjct: 199 RFTVDGDDLALEATLNLLQDDDRDKRRKAAAALANVFSRNLRTFTLITNTLAKDKEISDR 258

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR +E +ADSRHL+N VE  V++AL  +V   YP  SHRYY +K KWL LD + FWDR A
Sbjct: 259 WRGFEDVADSRHLANRVEREVVDALNTAVIQAYPSISHRYYAMKAKWLGLDALEFWDRNA 318

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP   +  I ++ AR+ VL +Y+ FSP M+ IA++FF  +WIDA    GK  GAFAH T
Sbjct: 319 PLPNAKRRDISWDDARETVLSAYSGFSPDMAEIAKRFFDRSWIDASLRPGKSPGAFAHPT 378

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +PSVHPY+LLNY+GKP+DVMTLAHELGHG+H VL+ + QG L   + LTLAETAS+FGE 
Sbjct: 379 VPSVHPYVLLNYMGKPRDVMTLAHELGHGVHQVLAGD-QGALMAATPLTLAETASVFGEM 437

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF SLL  A + EERK LLA+K+EDM+N++VRQI+FY FE  LH ERRS   + + RI 
Sbjct: 438 LTFRSLLAQAKTPEERKTLLASKVEDMINTVVRQIAFYQFERALHEERRSGE-LTSERIG 496

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
           EIWL  Q  SLGPA  L D  Y ++W  VPHFI S FYVYAYAFG+CLVNSLY +Y  N 
Sbjct: 497 EIWLSVQSRSLGPAVRLGD-GYETYWTYVPHFIHSPFYVYAYAFGDCLVNSLYSVY-ENA 554

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              F++KY  +L+AG +KH+SELL P  ++ SDP FW RGLQ +   ID++EKM
Sbjct: 555 QAGFQDKYFEMLKAGGTKHHSELLAPFGLDASDPAFWSRGLQMISGFIDELEKM 608


>gi|307944488|ref|ZP_07659828.1| oligoendopeptidase F [Roseibium sp. TrichSKD4]
 gi|307772237|gb|EFO31458.1| oligoendopeptidase F [Roseibium sp. TrichSKD4]
          Length = 590

 Score =  491 bits (1263), Expect = e-136,   Method: Composition-based stats.
 Identities = 280/594 (47%), Positives = 393/594 (66%), Gaps = 6/594 (1%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           +G LP W+L DLYP+ DS E+ +D++  E ++  F+T ++G L       N   L  AI 
Sbjct: 1   MGELPNWDLTDLYPALDSPEVKDDLKGAEEKAKTFETAYKGRLEELATS-NVEGLVTAIR 59

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
            YE + + +GR+ SYA L Y  + + P ++KFY D+  ++      L+FF LE N + + 
Sbjct: 60  AYEALEDGLGRLISYAGLVYAGSTTDPQVQKFYGDVQERITAASTHLLFFTLEFNRISDE 119

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
            L+Q+   +     Y  WI+++RK K + L + +E L  + S  GR A  R F E + SL
Sbjct: 120 TLDQAMKNE-GLAHYRPWIEDLRKDKPYQLEDRVEQLFHEKSITGRGAWNRLFDETMASL 178

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
            F++   +  L         S+ E R++A KAL+ TF ++   FS ITNTLAKD+EI DR
Sbjct: 179 SFEVEGNEQTLEPTLNLLQSSEPEKREAAFKALTTTFGENLRTFSLITNTLAKDKEISDR 238

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR +E IADSRHL+N VE  V++AL+ SV + YP+ SHRYY++K +WL  +T+  WDR A
Sbjct: 239 WRGFEDIADSRHLANRVERDVVDALVSSVHDAYPRLSHRYYKMKARWLGFETLNAWDRNA 298

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP +   II +E A+  VL++Y  FS  M+ IA +FF  NWIDAP   GK  GAFAH T
Sbjct: 299 PLPKSDNRIISWEDAKTTVLEAYGGFSGDMAEIAGRFFDKNWIDAPARPGKAPGAFAHPT 358

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +PS HPY+LLNY GK +DVMTLAHELGHG+H VL++E   ++   + LTLAETAS+FGE 
Sbjct: 359 VPSAHPYVLLNYQGKTRDVMTLAHELGHGVHQVLAAENGPLM-APTPLTLAETASVFGEM 417

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF +LL  A +   RKILLA+K EDM+N++VRQI+FY FE KLH ER+    + +++I 
Sbjct: 418 LTFKALLAKADTVNARKILLASKAEDMINTVVRQIAFYSFERKLHEERQKGE-LTSNQIG 476

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
           ++W+  Q +SLGPA  L++  Y +FW  +PHFI S FYVYAYAFG+CLVNSLY +Y+   
Sbjct: 477 DLWMSVQADSLGPAIRLNE-GYETFWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVYEEA- 534

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              F+EKY ++LRAG +KH+SELL P  +N SDP FW++GL  +E++ID++E +
Sbjct: 535 ESGFQEKYFDLLRAGGTKHHSELLAPFGLNASDPAFWKKGLSVIERIIDELEDL 588


>gi|116253806|ref|YP_769644.1| peptidase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115258454|emb|CAK09557.1| putative peptidase [Rhizobium leguminosarum bv. viciae 3841]
          Length = 618

 Score =  491 bits (1263), Expect = e-136,   Method: Composition-based stats.
 Identities = 290/590 (49%), Positives = 397/590 (67%), Gaps = 4/590 (0%)

Query: 37  PRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYER 96
           P W L+DLYPS  S     DME     ++AF+ +W+G L  A  +     +G+A+ EYE 
Sbjct: 29  PVWKLQDLYPSATSTAFVADMEKAGKAAIAFEEKWKGTLTEAAAKTGAEGIGSALKEYEA 88

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQ 156
           + ++IGR+ S+A L+Y  + ++PT  K Y D+ AK+ +F   L+FFALE+N +D+A+++ 
Sbjct: 89  LDDIIGRLGSFAGLTYFSDTTNPTNGKLYGDVQAKITEFSGHLLFFALELNRIDDAVIDA 148

Query: 157 SYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI 216
             A DP    Y  W+ ++RK K + L + +E L  + S     A  R F E +  LR+ I
Sbjct: 149 CMANDPAAGHYRPWLLDLRKDKPYQLDDRLEQLFLEKSMTSAAAFNRLFDETMAELRYDI 208

Query: 217 NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKY 276
           +  K+PL  A     + D EVR+ AA AL+ TF  +   F+ ITNTLAKD+EI DRWR +
Sbjct: 209 DGAKVPLEVALNKLQEKDPEVRRKAAMALAETFKANIRTFTLITNTLAKDKEIADRWRGF 268

Query: 277 EKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPG 336
           E IADSRHL+N VE  V++AL  +V+  YP+ SHRYY++K KWL ++ M FWDR APLP 
Sbjct: 269 EDIADSRHLANRVEREVVDALAAAVREAYPRLSHRYYKMKAKWLGMEQMNFWDRNAPLPE 328

Query: 337 TSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSV 396
           TS  II +  A+D VL +Y  F+P+M+ IA +FF   WIDAP   GK  GAFAH T+PS 
Sbjct: 329 TSSAIISWPEAKDTVLSAYGNFAPEMADIARRFFDEQWIDAPVRAGKAPGAFAHPTVPSA 388

Query: 397 HPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFD 456
           HPY+L+NY+GKP+DVMTLAHELGHG+H VL+   QG L   + LTLAETAS+FGE LTF 
Sbjct: 389 HPYVLVNYMGKPRDVMTLAHELGHGVHQVLAGA-QGALMCQTPLTLAETASVFGEMLTFR 447

Query: 457 SLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWL 516
           +LLQ  +   ERK +LA K+EDM+N++VRQI+FY+FE KLHT  R  G++    I E+WL
Sbjct: 448 ALLQKTTDTRERKAMLAQKVEDMINTVVRQIAFYEFERKLHTA-RKAGELTADDIGELWL 506

Query: 517 ETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCF 576
             Q ESLGPA  +S+  Y ++W  +PHFI S FYVYAYAFG+CLVNSLY +Y+      F
Sbjct: 507 SVQSESLGPAISISE-GYETYWAYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQKA-EKGF 564

Query: 577 KEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           +EKY  +LRAG +KH+SELL P  ++ +DP+FW +GL  +E +ID++E +
Sbjct: 565 QEKYFELLRAGGTKHHSELLKPFGLDATDPSFWSQGLSMIEGLIDELEAL 614


>gi|89070420|ref|ZP_01157722.1| Oligoendopeptidase F [Oceanicola granulosus HTCC2516]
 gi|89043986|gb|EAR50163.1| Oligoendopeptidase F [Oceanicola granulosus HTCC2516]
          Length = 604

 Score =  490 bits (1262), Expect = e-136,   Method: Composition-based stats.
 Identities = 264/595 (44%), Positives = 378/595 (63%), Gaps = 8/595 (1%)

Query: 32  NLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAI 91
           +LG+LP W+L DLY + D+ E+  D++ +E     F   +EG LA      + H +  A+
Sbjct: 16  DLGDLPEWDLSDLYEAADAPELKRDLDWLEQACADFARDYEGKLADL----SAHQMLEAV 71

Query: 92  AEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDE 151
             YE+I  + GRI S+A L Y    +     KF +D   +L  +   L+F++LE N L +
Sbjct: 72  TRYEKIDVVSGRIMSFAGLRYYQQTTDAERAKFLSDCQDRLTTYTTPLVFWSLEFNRLSD 131

Query: 152 ALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIES 211
             +EQ  ++     +Y   I+ +R ++ + LS+++E  L D S VG  A  + F E I  
Sbjct: 132 ERVEQLLSESAELDRYRPVIERMRAMRPYQLSDELEKFLHDQSVVGASAWNKLFDETIAG 191

Query: 212 LRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
           L F+++ + + +        + DR  R++  +ALS  F  +   F+ + NTL K++EI+D
Sbjct: 192 LTFEVDGETLGIEATLNLLTEQDRAKREAGFRALSEVFGANVRTFARVHNTLTKEKEIED 251

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRL 331
           RWR        RHL+N+VEP V+EAL  +V   YP+ SHRYY LK KWL L+ +  WDR 
Sbjct: 252 RWRGMPTPQTGRHLANHVEPEVVEALRDAVVAAYPRLSHRYYALKAKWLGLERLQVWDRN 311

Query: 332 APLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHG 391
           APLP  S  I+ ++ AR  V  +YA F P+M+ +A  FF   WIDA    GK  GAFAH 
Sbjct: 312 APLPMESDRIVGWDEARATVSDAYADFDPRMADLARPFFDKGWIDAGVKPGKAPGAFAHP 371

Query: 392 TIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE 451
           T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL+++ QG L +++ LTLAETAS+FGE
Sbjct: 372 TVTEVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAD-QGELLSSTPLTLAETASVFGE 430

Query: 452 TLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRI 511
            LTF  LL+ A S  ERK+LLA K+EDM+N++VRQI+FYDFE KLH  RR  G++    I
Sbjct: 431 MLTFRKLLREAPSDAERKVLLAGKVEDMINTVVRQIAFYDFECKLHEARR-GGELTPDDI 489

Query: 512 NEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSN 571
           N +W+  Q ESLGP FD ++  Y +FW  +PHF+ S FYVYAYAFG+ LVN+LY +Y+ +
Sbjct: 490 NALWMSVQAESLGPVFDFAE-GYETFWAYIPHFVHSPFYVYAYAFGDGLVNALYAVYEES 548

Query: 572 TVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
             + F +KY  +L+AG SKH+ +LL P  ++ SDP FW +GL  +E +ID++E+M
Sbjct: 549 G-ESFNDKYFAMLKAGGSKHHKDLLAPFGLDASDPAFWNKGLAMIEGLIDELERM 602


>gi|255262015|ref|ZP_05341357.1| oligoendopeptidase, PepF/M3 family [Thalassiobium sp. R2A62]
 gi|255104350|gb|EET47024.1| oligoendopeptidase, PepF/M3 family [Thalassiobium sp. R2A62]
          Length = 603

 Score =  490 bits (1262), Expect = e-136,   Method: Composition-based stats.
 Identities = 274/608 (45%), Positives = 383/608 (62%), Gaps = 8/608 (1%)

Query: 19  LRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHA 78
            R+ D+   +  +NLGNLP W+L  LYPS DS E++ D+  +E     F + +EG LA  
Sbjct: 2   TRTFDINASNGTDNLGNLPEWDLTHLYPSQDSPELTRDLGWLEEACTNFASDYEGKLADL 61

Query: 79  TNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKV 138
               +   L   +  YE+I  + GRI SYA L Y    +     KF  D+  K+  F   
Sbjct: 62  ----DAAGLLDCVLRYEKIDIIAGRIMSYAGLRYYQITTDDDRAKFMADMQDKITTFTTP 117

Query: 139 LIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGR 198
           L+F+ LE+N L++A L     ++    +Y      +R  K + LS+++E  L D S VG 
Sbjct: 118 LVFYTLELNRLEDASLAAMLTENANLARYKPVFDRLRASKPYQLSDELEKFLHDQSTVGA 177

Query: 199 EALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSF 258
            A  R F E I  L F +N  ++ +        +  R++R++AA+ L+  F  +  +F+ 
Sbjct: 178 SAWNRLFDETIAGLTFFVNGDELNIEGTLNLLTEQSRDMREAAARELASVFEDNVKLFAR 237

Query: 259 ITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKK 318
           + NTLAK++EI+DRWR        RHLSN+VEP V+EAL  +V   YPK SHRYY LK K
Sbjct: 238 VHNTLAKEKEIEDRWRGMPTPQTGRHLSNHVEPEVVEALRNAVVAAYPKLSHRYYALKAK 297

Query: 319 WLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAP 378
           WL LDTM  WDR APLP     I+ ++ A   V+ +YA+F P+M+ IA+ FF   WIDA 
Sbjct: 298 WLGLDTMQVWDRNAPLPMEDSKIVDWDQAEKTVMDAYAEFDPRMAEIAKPFFKDGWIDAA 357

Query: 379 QYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNS 438
              GK  GAFAH T+   HPY++LNYLGKP+DVMTLAHELGHG+H VL+++ QG L +++
Sbjct: 358 VKPGKAPGAFAHPTVTEAHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAD-QGELLSST 416

Query: 439 SLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHT 498
            LTLAETAS+FGE LTF  +L  A ++ ERK++LA K+EDM+N++VRQI+FYDFE KLH 
Sbjct: 417 PLTLAETASVFGEMLTFRKMLSGAKTQAERKVMLAGKVEDMINTVVRQIAFYDFECKLHA 476

Query: 499 ERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGN 558
             R+ G++    IN +W+  Q ESLGP F+     Y +FW  VPHF+ S FYVYAYAFG+
Sbjct: 477 A-RANGELTPDDINALWMSVQAESLGPVFEFM-PGYKTFWAYVPHFVHSPFYVYAYAFGD 534

Query: 559 CLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
            LVN+LY +++ +  D F++KY ++LRAG SKH+ ELL P  ++ SDP FW++GL  +  
Sbjct: 535 GLVNALYAVFEEDGDD-FQDKYFDMLRAGGSKHHKELLAPFGLDASDPKFWDKGLSLIAS 593

Query: 619 MIDDVEKM 626
           MID++E M
Sbjct: 594 MIDELEAM 601


>gi|182677367|ref|YP_001831513.1| pepF/M3 family oligoendopeptidase [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182633250|gb|ACB94024.1| oligoendopeptidase, pepF/M3 family [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 622

 Score =  490 bits (1262), Expect = e-136,   Method: Composition-based stats.
 Identities = 285/594 (47%), Positives = 382/594 (64%), Gaps = 5/594 (0%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           LG LP WNL DLYP+ DS   + D+     E+ AF   ++G L       +   L  A+ 
Sbjct: 31  LGTLPEWNLADLYPAPDSPLFARDLAHAVAEAKAFAEAYKGRLETLAMDPSSTGLIEAVR 90

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
            YE + EL+GR+ SYA L Y  + S     KFY D + ++      L+FF LE+N LD+A
Sbjct: 91  RYETVEELLGRLMSYAGLHYYGDTSDAARAKFYGDTHEEITKASSDLLFFELELNRLDDA 150

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
           L+E++    P    Y  WI++IRK K H L + +E L  D S   R A  R F E I +L
Sbjct: 151 LIEKALKGTP-LEHYRPWIEDIRKEKPHQLDDRLEQLFLDKSVTCRSAWNRLFDETISAL 209

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           RFK++DQ++ L  A     D D +VR+  A A++ T   +   F+ I+NTLAKD+EI DR
Sbjct: 210 RFKVDDQELTLELALNLMQDEDTKVREKGANAIAETLKANLRTFTLISNTLAKDKEISDR 269

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR ++ IADSRHLSN VE  V++AL+ +V   YP+ SHRYY+LK KW  LD +  WDR A
Sbjct: 270 WRGFQDIADSRHLSNRVEREVVDALVAAVHAAYPRLSHRYYKLKAKWFGLDQLNHWDRNA 329

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP  +    P+  ARD VL +Y  FS  M+ IA++FF + WIDAP   GK  GAFAH T
Sbjct: 330 PLPNIAAKTYPWAEARDTVLDAYGAFSADMAGIAKRFFDNGWIDAPARPGKAPGAFAHPT 389

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +PS HPY+LLNYLGKP+DVMTLAHELGHG+H VL+    G L   + LTLAETAS+FGE 
Sbjct: 390 VPSAHPYVLLNYLGKPRDVMTLAHELGHGVHQVLAGPN-GALMAPTPLTLAETASVFGEM 448

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF +LL   ++  ER+ +LA K+EDM+N++VRQI+FY FE KLHT RR    +   ++ 
Sbjct: 449 LTFRTLLARTTNVTERRAMLAAKVEDMINTVVRQIAFYTFERKLHTARREGE-LTAEQVC 507

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
           E+W+  Q ESLGP+  L    Y +FW  +PHFI S FYVYAYAFG+CLVNSLY +Y+ + 
Sbjct: 508 ELWMSVQAESLGPSIKL-GPGYETFWAYIPHFIHSPFYVYAYAFGDCLVNSLYGVYEKS- 565

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + F E+YL +L AG +KH++ELL P  ++  DP+FW+ GL  +E MI ++E +
Sbjct: 566 REGFAERYLAMLSAGGTKHHAELLAPFGLDARDPSFWQIGLSMIEGMIGELESL 619


>gi|126729314|ref|ZP_01745128.1| oligoendopeptidase F [Sagittula stellata E-37]
 gi|126710304|gb|EBA09356.1| oligoendopeptidase F [Sagittula stellata E-37]
          Length = 607

 Score =  490 bits (1262), Expect = e-136,   Method: Composition-based stats.
 Identities = 268/610 (43%), Positives = 378/610 (61%), Gaps = 9/610 (1%)

Query: 17  KALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLA 76
                 D       ++LG LP W+L DLYP+ D+ E+  D++ +E    +F T +EG L 
Sbjct: 5   APRPVFDANASAGGKDLGPLPEWDLTDLYPAPDAPELKRDLDWLEDACRSFATDYEGKLD 64

Query: 77  HATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFE 136
                 +      AI  +E+I  + GRI S+A L Y      P   KF +D+  K+  + 
Sbjct: 65  SL----DAKGFLDAIHRHEKIEGIAGRIMSFAGLRYYQMTVDPERAKFLSDMQEKITVYT 120

Query: 137 KVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQV 196
             L+FF LE+N L++   +  YA++    +Y   I+ IR +K + LS++ME  L D   V
Sbjct: 121 TPLVFFTLELNRLEDDFFDSRYAENADLARYKPAIRRIRAMKPYQLSDEMEKFLHDLGVV 180

Query: 197 GREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIF 256
           G +A +R F E I  L F I+ ++  +        D DR  R++AA+ L+  F  +   F
Sbjct: 181 G-DAWERLFDETIAGLTFTIDGEEQNIESTLNHLTDQDRSKREAAARELARVFAANIKTF 239

Query: 257 SFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELK 316
           + + NT  K++E+ DRWR        RHLSN+VEP V+EAL  +V   YP+ SHRYYELK
Sbjct: 240 ARVHNTQTKEKEVMDRWRGMPTAQTGRHLSNDVEPEVVEALRNAVVAAYPRLSHRYYELK 299

Query: 317 KKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWID 376
           +KWL +D M  WDR APLP  +  I+ +  AR +V+ +Y  F P+M  IA  FF   WID
Sbjct: 300 RKWLGVDRMQVWDRNAPLPMETDRIVKWPEARGMVMDAYTAFDPRMGEIATPFFDKGWID 359

Query: 377 APQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTN 436
           A    GK  GAFAH T+   HPY+LLNYLGKP+DVMTLAHELGHG+H VL+++ QG +  
Sbjct: 360 AAVKPGKAPGAFAHPTVTDAHPYVLLNYLGKPRDVMTLAHELGHGVHQVLAAD-QGEMLA 418

Query: 437 NSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKL 496
           ++ LTLAETAS+FGE LTF  +L+ A  ++ERK+LLA K+EDM+N++VRQI+FYDFE KL
Sbjct: 419 STPLTLAETASVFGEMLTFRKMLENAKDQKERKVLLAGKVEDMINTVVRQIAFYDFECKL 478

Query: 497 HTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAF 556
           H  RR  G++    IN +W+  Q ESLG +FD  +  Y +FW  +PHF+ S FYVYAYAF
Sbjct: 479 HEARR-GGELTPDDINALWMSVQAESLGESFDFME-GYETFWAYIPHFVHSPFYVYAYAF 536

Query: 557 GNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTV 616
           G+ LVN+LY  Y+    + F++KY ++L+AG SKH+ ELL P  ++ +DP FW++GL  +
Sbjct: 537 GDGLVNALYAAYEEQP-EGFQDKYFDMLKAGGSKHHKELLAPFGLDATDPAFWDKGLSMI 595

Query: 617 EKMIDDVEKM 626
           E  ID++E M
Sbjct: 596 EGFIDELEAM 605


>gi|332557845|ref|ZP_08412167.1| oligoendopeptidase F [Rhodobacter sphaeroides WS8N]
 gi|332275557|gb|EGJ20872.1| oligoendopeptidase F [Rhodobacter sphaeroides WS8N]
          Length = 606

 Score =  490 bits (1261), Expect = e-136,   Method: Composition-based stats.
 Identities = 274/613 (44%), Positives = 372/613 (60%), Gaps = 10/613 (1%)

Query: 14  FFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEG 73
                    D         LGNLP W+L DLYP+ D  E  +DM  ++     F   +EG
Sbjct: 2   TLPLPRPVFDANASAGG--LGNLPDWDLRDLYPTPDGPEFRDDMAWLKEACAGFAASYEG 59

Query: 74  NLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA 133
            LA      +   L A I  YE+I  + GR+ SYA L Y  N       KF  D   K+ 
Sbjct: 60  KLASL----DAAGLLACIEAYEKIDIVAGRLMSYAGLRYYQNTMDSERAKFMADAQDKVT 115

Query: 134 DFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDT 193
           D+   L+FF+LE N L++A LE    +     +Y      +R ++ H LS+++E  L D 
Sbjct: 116 DYTTALVFFSLEFNRLEDAHLEARLTESAALARYKPVFDRMRAMRPHQLSDELERFLHDE 175

Query: 194 SQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSS 253
           S VG  A  R F E +  L F +  +++ L        D +R  R++AA AL+  F ++ 
Sbjct: 176 STVGAAAWNRLFDETMAGLTFTLEGEELNLESTLNLLTDPERPRREAAAHALAEVFGRNI 235

Query: 254 HIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY 313
            +F+ + NTLAK++EI DRWRK       RHL+N+VEP V+EAL  +V   YPK SHRYY
Sbjct: 236 KLFARVHNTLAKEKEIHDRWRKMPTPQYGRHLANHVEPEVVEALRNAVVAAYPKLSHRYY 295

Query: 314 ELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHN 373
            LK KWL L+ +  WDR APLP  +  ++ ++ A+  V+++Y+ F P+M+ IA+ FF   
Sbjct: 296 RLKAKWLGLEKLQVWDRNAPLPTETPRLVGWDEAQSTVMEAYSAFDPRMAEIAKPFFEKG 355

Query: 374 WIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGI 433
           WIDA    GK  GAFAH T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG 
Sbjct: 356 WIDAGVKPGKAPGAFAHPTVTTVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGE 414

Query: 434 LTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFE 493
           L +++ LTLAETAS+FGE LTF  LL AA +  ERK LLA K+EDM+N++VRQI+FYDFE
Sbjct: 415 LLSSTPLTLAETASVFGEMLTFRKLLDAARTPAERKTLLAGKVEDMINTVVRQIAFYDFE 474

Query: 494 LKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYA 553
            KLH  RR    +    IN +W+  Q ESLG AF+  +  Y +FW  VPHF+ S FYVYA
Sbjct: 475 CKLHEARRQGE-LTPEDINALWMSVQAESLGDAFEFME-GYETFWSYVPHFVHSPFYVYA 532

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YAFG+ LVN+LY +Y +     F+EKY  +L AG SKH+ ELL P  ++ SDP FW++GL
Sbjct: 533 YAFGDGLVNALYAVY-AEGTPGFQEKYFEMLSAGGSKHHKELLAPFGLDASDPTFWDKGL 591

Query: 614 QTVEKMIDDVEKM 626
             +   ID++E M
Sbjct: 592 SMIAGFIDELEAM 604


>gi|254452846|ref|ZP_05066283.1| oligoendopeptidase F [Octadecabacter antarcticus 238]
 gi|198267252|gb|EDY91522.1| oligoendopeptidase F [Octadecabacter antarcticus 238]
          Length = 611

 Score =  490 bits (1260), Expect = e-136,   Method: Composition-based stats.
 Identities = 273/593 (46%), Positives = 386/593 (65%), Gaps = 8/593 (1%)

Query: 34  GNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAE 93
           G+LP W+L DLYPS D++E+  DM+ +E+   +F    EG LA      +   L  A+  
Sbjct: 25  GDLPEWDLTDLYPSPDAKELKRDMDWLENACRSFAADHEGKLADL----DAEELLDAVKR 80

Query: 94  YERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEAL 153
           +E+I  + GRI S+A L Y  + + P   KF + +  K+  +   L+F+ LE N +D+A 
Sbjct: 81  FEQIDIIAGRIMSFAGLRYYQHTTDPERGKFMSVMQDKITTYTTPLVFYGLEFNRMDDAH 140

Query: 154 LEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLR 213
           ++   A +    +Y      +R +K H LS++ME  L D S VG  A  + F E I +L+
Sbjct: 141 VDGLLAANADLARYKPIFDRMRAMKPHQLSDEMEKFLHDQSVVGATAWNKLFHETIAALK 200

Query: 214 FKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRW 273
           F ++ +++ +        D DR  R+  ++ L+  F  +  +F+ + NTLAK++EI+DRW
Sbjct: 201 FTVDGKEMNIEGTLNLLSDQDRATREKGSRELARVFGANVGLFARVHNTLAKEKEIEDRW 260

Query: 274 RKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAP 333
           R        RHL+N+VEP V+EAL  +V + YP+ SHRYY LK KW+ L+TM  WDR AP
Sbjct: 261 RGMPSPQAGRHLANHVEPEVVEALRNAVVDAYPRLSHRYYALKAKWMGLETMEVWDRNAP 320

Query: 334 LPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTI 393
           LP  S   + +  A   V+ +YA F P+M+ IA+ FFT  WIDA   DGK  GAFAH T+
Sbjct: 321 LPMESNRTVSWAEAEKTVMDAYAAFDPRMADIAKPFFTDGWIDAGVKDGKAPGAFAHPTV 380

Query: 394 PSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETL 453
            +VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG L +++ LTLAETAS+FGE L
Sbjct: 381 TTVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGELLSSTPLTLAETASVFGEML 439

Query: 454 TFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINE 513
           TF  LL+ A ++EERK+LLA K+EDM+N++VRQI+FYDFE KLH   RS G++    IN 
Sbjct: 440 TFRKLLEQAITQEERKVLLAGKVEDMINTVVRQIAFYDFECKLHDA-RSNGELTPDDINA 498

Query: 514 IWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTV 573
           +W+  Q ESLGP F+  D  Y +FW  +PHF+ S FYVYAYAFG+ LVN+LY +Y  +  
Sbjct: 499 LWMSVQGESLGPVFNFID-GYETFWAYIPHFVHSPFYVYAYAFGDGLVNALYAVY-EDMG 556

Query: 574 DCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           + FK+KY ++L+AG SKH+SELL P  ++ SDP FW +GL  +E MID++E M
Sbjct: 557 EDFKDKYFDMLKAGGSKHHSELLAPFGLDASDPAFWAKGLGMIESMIDELEAM 609


>gi|159185890|ref|NP_356857.2| oligoendopeptidase F [Agrobacterium tumefaciens str. C58]
 gi|159141024|gb|AAK89642.2| oligoendopeptidase F [Agrobacterium tumefaciens str. C58]
          Length = 616

 Score =  490 bits (1260), Expect = e-136,   Method: Composition-based stats.
 Identities = 291/594 (48%), Positives = 396/594 (66%), Gaps = 4/594 (0%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           LG+LP W L DLYPS DS E   D+E     + AF+ +W+  L  A   K    +GAA+ 
Sbjct: 22  LGDLPGWKLSDLYPSGDSPEYKRDLEKAASMAAAFEAKWKDKLESAAKAKGEDGIGAALK 81

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
           +YE + +LIGRI S+A L+Y  + S+P   K Y D  AKL +    L+FF LE+N +D+A
Sbjct: 82  DYEALDDLIGRIGSFAGLTYFSDTSNPANGKLYGDAQAKLTEISAHLLFFTLELNRIDDA 141

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
           +++   A D     Y  W+ ++RK K H L + +E L  + S     A  R F E +  L
Sbjct: 142 VMDACMANDAAAGHYRPWLVDLRKDKPHQLDDQLEQLFLEKSMTSAAAFNRLFDETMADL 201

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           RF I+   + L        + + E R+ AA+ALS TF  +  +F+ ITNTLAKD++I DR
Sbjct: 202 RFDIDGASLSLEVTLNMLQEPEPETRRKAAEALSATFKDNLRVFTLITNTLAKDKDISDR 261

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR +E IADSRHL+N VE  V++AL  +VK  YP+ SHRYY +K KWL ++ M +WDR A
Sbjct: 262 WRNFEDIADSRHLANRVERDVVDALAAAVKKAYPRLSHRYYAMKAKWLGMEQMNYWDRNA 321

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP TS  IIP++ A+D VL +Y  F+P+M+ IA +FF   WIDAP   GK  GAFAH T
Sbjct: 322 PLPDTSNTIIPWDEAKDTVLSAYGNFAPEMADIARRFFDEEWIDAPARPGKAPGAFAHPT 381

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +PS HPY+L+NYLGKP+DVMTLAHELGHG+H VL+ + QG L   + LTLAETAS+FGE 
Sbjct: 382 VPSAHPYVLVNYLGKPRDVMTLAHELGHGVHQVLAGQ-QGALMCATPLTLAETASVFGEM 440

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF  LL       ERK +LA K+EDM+N++VRQI+FY+FE KLHT  R  G++ + +I 
Sbjct: 441 LTFRKLLDDTKDIRERKAMLARKVEDMINTVVRQIAFYEFERKLHTA-RKEGELTSEQIG 499

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
           E+WL  Q ESLGPA  +S+  Y ++W  +PHFI S FYVYAYAFG+CLVNSLY +Y+   
Sbjct: 500 ELWLSVQAESLGPAIRISE-GYETWWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQKA- 557

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              F+EKY  +L+AG +KH+SELL P  ++ +DP+FW++GL  +E +ID++E++
Sbjct: 558 EAGFQEKYFELLKAGGTKHHSELLKPFGLDATDPSFWDKGLSMIEGLIDELEEL 611


>gi|148258070|ref|YP_001242655.1| putative oligoendopeptidase F [Bradyrhizobium sp. BTAi1]
 gi|146410243|gb|ABQ38749.1| putative oligoendopeptidase F [Bradyrhizobium sp. BTAi1]
          Length = 664

 Score =  490 bits (1260), Expect = e-136,   Method: Composition-based stats.
 Identities = 280/595 (47%), Positives = 393/595 (66%), Gaps = 6/595 (1%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC-HSLGAAI 91
           +G LP WNL DLY   D+ EI++D+  ++ E +AF+T ++G LA    + +    L AA+
Sbjct: 74  IGTLPEWNLGDLYMGIDAPEIAHDLAKMDAECVAFETDYKGKLAEHVARDDGGEWLAAAV 133

Query: 92  AEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDE 151
             YE I +L GR+ S+A L++  +   P I KFY DI+ +L      L+FF LE+N +D+
Sbjct: 134 RRYEAIDDLAGRLGSFAGLAHAGDSVDPAISKFYGDISERLTAASTHLLFFPLELNRIDD 193

Query: 152 ALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIES 211
           A++E++    P    Y  WI+++RK K + L + +E L  + SQ G  A  R F + I  
Sbjct: 194 AVIERAMET-PALGHYRPWIEDLRKDKPYQLEDRVEQLFHEKSQTGYSAWNRLFDQTIAG 252

Query: 212 LRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
           LRF++  +++ +        D D   RK+AA+AL+ TF  +   F+ ITNTLAKD++I D
Sbjct: 253 LRFQVGGKELAIEPTLNFLQDRDGAKRKAAAEALAKTFKANERTFALITNTLAKDKDISD 312

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRL 331
           RWR ++ +ADSRHL+N VE  V++AL+ SV+  YPK SHRYY+LK +W K   +  WDR 
Sbjct: 313 RWRGFQDVADSRHLNNRVEREVVDALVASVRAAYPKLSHRYYQLKARWFKKKKLAHWDRN 372

Query: 332 APLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHG 391
           APLP  +   I +  A+++VL +Y  FSP+M+ IA++FF  +WIDAP   GK  GAF+H 
Sbjct: 373 APLPFAANATIAWPDAKNMVLTAYRGFSPEMADIAQRFFDQSWIDAPVRPGKAPGAFSHP 432

Query: 392 TIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE 451
           T PS HPY+L+NY GKP+DVMTLAHELGHG+H VL++  QG L   + LTLAETAS+FGE
Sbjct: 433 TTPSAHPYVLMNYQGKPRDVMTLAHELGHGVHQVLAAR-QGALMAPTPLTLAETASVFGE 491

Query: 452 TLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRI 511
            LTF  LL      ++R+ LLA K+EDM+N++VRQI+FY FE  +HTE R  G++   R+
Sbjct: 492 MLTFKRLLSETRDAKQRQALLAGKVEDMINTVVRQIAFYSFERAVHTE-RKNGELTAERL 550

Query: 512 NEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSN 571
            +IWL  Q ESLG A ++    Y +FWM +PHFI S FYVYAYAFG+CLVNSLY +Y  +
Sbjct: 551 GQIWLSVQTESLGEAIEIK-PGYENFWMYIPHFIHSPFYVYAYAFGDCLVNSLYAVY-EH 608

Query: 572 TVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
             + F E+YL +L AG +KHYSELL P  ++  DP FW+ GL  +  MID++E+M
Sbjct: 609 AAEGFAERYLAMLAAGGTKHYSELLAPFGLDAKDPKFWDGGLSVIAGMIDELERM 663


>gi|254441015|ref|ZP_05054508.1| oligoendopeptidase, pepF/M3 family [Octadecabacter antarcticus 307]
 gi|198251093|gb|EDY75408.1| oligoendopeptidase, pepF/M3 family [Octadecabacter antarcticus 307]
          Length = 612

 Score =  490 bits (1260), Expect = e-136,   Method: Composition-based stats.
 Identities = 277/611 (45%), Positives = 392/611 (64%), Gaps = 8/611 (1%)

Query: 16  RKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNL 75
            +   ++  T        GNLP W+L DLYPS D++E+  D++ +E+   +F    EG L
Sbjct: 8   PRTFDANPSTAASGSTPFGNLPEWDLTDLYPSPDAKELKRDLDWLENACRSFAADHEGKL 67

Query: 76  AHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADF 135
           A   +      L  A+  YE+I  + GRI S+A L Y  + + P   KF +D+  K+  +
Sbjct: 68  ADLND----EDLLDAVKRYEQIDIIAGRIMSFAGLRYYQHTTDPERSKFMSDMQDKITTY 123

Query: 136 EKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQ 195
              L+F+ LE N +D+A ++   A +    +Y      +R +K + LS++ME  L D S 
Sbjct: 124 TTPLVFYGLEFNRMDDAHVDGLLAANADLARYKPIFDRMRAMKPYQLSDEMEKFLHDQSV 183

Query: 196 VGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
           VG  A  + F E I +L+F ++ Q++ +        D DR  R+  ++ L+  F  +  +
Sbjct: 184 VGATAWNKLFDETIAALKFTVDGQEMNIEGTLNLLSDQDRATREKGSRELARVFGANVGL 243

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+ + NTLAK++EI+DRWR        RHLSN+VEP V+EAL  +V + YP+ SHRYY L
Sbjct: 244 FARVHNTLAKEKEIEDRWRGMPSAQAGRHLSNHVEPEVVEALRNAVVDAYPRLSHRYYAL 303

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           K KW+ LDTM  WDR APLP  +   + +  A   V+ +YA F P+M+ IA+ FFT  WI
Sbjct: 304 KAKWMGLDTMEVWDRNAPLPMETDRTVSWAEAEQTVMDAYAAFDPRMADIAKPFFTEGWI 363

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           DA   DGK  GAFAH T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG L 
Sbjct: 364 DAGVKDGKAPGAFAHPTVTTVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGELL 422

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
           +++ LTLAETAS+FGE LTF  LL+ A++++ERKILLA K+EDM+N++VRQI+FYDFE K
Sbjct: 423 SSTPLTLAETASVFGEMLTFRKLLEQATTQQERKILLAGKVEDMINTVVRQIAFYDFECK 482

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           LH   RS G++    IN +W+  Q ESLGP F+  D  Y +FW  +PHF+ S FYVYAYA
Sbjct: 483 LHDA-RSNGELTPDDINALWMSVQGESLGPVFNFMD-GYETFWAYIPHFVHSPFYVYAYA 540

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
           FG+ LVN+LY +Y  +  + FK+KY ++L+AG SKH+SELL P  ++ SDP FW +GL  
Sbjct: 541 FGDGLVNALYAVY-EDMGEDFKDKYFDMLKAGGSKHHSELLAPFGLDASDPAFWAKGLGM 599

Query: 616 VEKMIDDVEKM 626
           +E MID++E M
Sbjct: 600 IESMIDELEAM 610


>gi|254464700|ref|ZP_05078111.1| oligoendopeptidase F [Rhodobacterales bacterium Y4I]
 gi|206685608|gb|EDZ46090.1| oligoendopeptidase F [Rhodobacterales bacterium Y4I]
          Length = 606

 Score =  489 bits (1259), Expect = e-136,   Method: Composition-based stats.
 Identities = 265/613 (43%), Positives = 383/613 (62%), Gaps = 9/613 (1%)

Query: 14  FFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEG 73
            F+      D         LGNLP W+L DLY S D+ E++ D++ ++ E  AF   +EG
Sbjct: 1   MFQLPFPVRDANATAGSGGLGNLPVWDLSDLYASEDAPELARDLDWLQKECAAFAADYEG 60

Query: 74  NLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA 133
            LA      +   L   +   E+I  + GRI S+A L Y    +      F +D   K+ 
Sbjct: 61  KLADL----DADGLLECVQRNEKINNIAGRIMSFAGLRYYQLTTDADRAAFLSDCQEKVT 116

Query: 134 DFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDT 193
                L+FF LE+N +++  ++     +    +Y++  + IR +K + LS+++E  + D 
Sbjct: 117 IATTPLVFFTLELNRIEDDAMQAHLNANEDLARYASVFRRIRAMKPYQLSDELEKFMHDL 176

Query: 194 SQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSS 253
             VG +A ++ F E I  L F ++ +++ +        + DR  R++AA+ L+  F ++ 
Sbjct: 177 GIVG-DAWEKLFDETIAGLTFTVDGEELNIEGTLNLLTEQDRSKREAAARELARVFGENI 235

Query: 254 HIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY 313
             F+ + NT AK++EI DRWR        RHLSN+VEP V+EAL ++V   YPK SHRYY
Sbjct: 236 KTFARVHNTQAKEKEIIDRWRGMPSPQTGRHLSNDVEPEVVEALREAVVAAYPKLSHRYY 295

Query: 314 ELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHN 373
           ELK+KWL LD M  WDR APLP     II ++ A + V+++Y  F P+M  IA  FF+  
Sbjct: 296 ELKRKWLGLDVMQVWDRNAPLPLEDSRIIGWDEAENTVMEAYEAFDPRMGEIAAPFFSDG 355

Query: 374 WIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGI 433
           WIDA    GK  GAFAH T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H VL++E QG 
Sbjct: 356 WIDAGVKPGKAPGAFAHPTVTNVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAE-QGE 414

Query: 434 LTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFE 493
           + +++ LTLAETAS+FGE LTF  +L  A +KE+RK+LLA K+EDM+N++VRQI+FYDFE
Sbjct: 415 MLSSTPLTLAETASVFGEMLTFRKMLDKAETKEQRKVLLAGKVEDMINTVVRQIAFYDFE 474

Query: 494 LKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYA 553
            KLH   R+ G++    IN IW+  Q ESLG AF+  D  Y +FW  +PHF+ S FYVYA
Sbjct: 475 CKLHAA-RAEGELTPDDINAIWMSVQAESLGEAFEYMD-GYETFWAYIPHFVHSPFYVYA 532

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YAFG+ LVN+LY +Y ++  + F++KY  +L+AG SKH+ ELL P  ++ +DP FW++GL
Sbjct: 533 YAFGDGLVNALYSVY-ASGAEGFEDKYFEMLKAGGSKHHKELLAPFGLDATDPKFWDKGL 591

Query: 614 QTVEKMIDDVEKM 626
             +   ID++E M
Sbjct: 592 SMISGFIDELEAM 604


>gi|92116784|ref|YP_576513.1| peptidase M3B, oligoendopeptidase-related clade 3 [Nitrobacter
           hamburgensis X14]
 gi|91799678|gb|ABE62053.1| Peptidase M3B, oligoendopeptidase-related clade 3 [Nitrobacter
           hamburgensis X14]
          Length = 626

 Score =  489 bits (1258), Expect = e-136,   Method: Composition-based stats.
 Identities = 278/596 (46%), Positives = 391/596 (65%), Gaps = 6/596 (1%)

Query: 32  NLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS-LGAA 90
           + G LP WNL DLY   D+ E++ D++ ++ +  AF+  ++G LA  T + +  + L  A
Sbjct: 35  DAGRLPEWNLADLYAGIDAPEVTRDLDKVDADCEAFEADYKGKLAEETAKPDGGAWLADA 94

Query: 91  IAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLD 150
           +  YE I +L GR+ SYA L +  +   P I KFY D++ +L      L+FFALE+N +D
Sbjct: 95  VRRYEAIDDLAGRLGSYAGLIHAGDSVDPAISKFYGDVSERLTTASVHLLFFALELNRID 154

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIE 210
           + ++E++  Q P    Y  WI++ RK K + L + +E L  + SQ G  A  R F + I 
Sbjct: 155 DDVIERAM-QTPELGHYRPWIEDSRKDKPYQLEDRVERLFHEKSQTGYSAWNRLFDQTIA 213

Query: 211 SLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
            LRF++  +++ +        D   E RK+A +AL+ TF  +   F+ ITNTLAKD++I 
Sbjct: 214 GLRFRVGTRELAIEPTLNLLQDRSPERRKAAGQALAKTFKANERTFALITNTLAKDKDIS 273

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
           DRWR ++ +ADSRHL+N VE  V++AL+ SV+  YP+ SHRYY LK +W K   +  WDR
Sbjct: 274 DRWRGFQDVADSRHLNNRVEREVVDALVASVRAAYPRLSHRYYALKARWFKKKKLAHWDR 333

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
            APLP  +  +IP+  AR +VL +Y  FSP+M+ IAE+FFT  WIDAP   GK  GAF+H
Sbjct: 334 NAPLPFAATGVIPWTDARKMVLTAYGDFSPKMAGIAEQFFTDRWIDAPVRPGKAPGAFSH 393

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
            T PS HPY+L+NY GKP+DVMTLAHELGHG+H VL+++  G L   + LTLAETAS+FG
Sbjct: 394 PTTPSAHPYVLMNYQGKPRDVMTLAHELGHGVHQVLAAKN-GALMAPTPLTLAETASVFG 452

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E LTF  LL    + ++R+ LLA K+EDM+N++VRQI+FY FE  +HTE R  G++   R
Sbjct: 453 EMLTFKRLLAQTKNAKQRQALLAGKVEDMINTVVRQIAFYTFERAVHTE-RKNGELTAER 511

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
           I ++WL  Q ESLGPA ++    Y +FWM +PHFI S FYVYAYAFG+CLVNSLY +Y  
Sbjct: 512 IGQLWLSVQGESLGPAIEIR-PGYETFWMYIPHFIHSPFYVYAYAFGDCLVNSLYAVY-E 569

Query: 571 NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           +  + F ++YL +L AG ++HYSELL P  ++  DP FW+ GL  +  MID++E M
Sbjct: 570 HASEGFADRYLAMLAAGGTRHYSELLRPFGLDARDPKFWDGGLSVIAGMIDELETM 625


>gi|254462329|ref|ZP_05075745.1| oligoendopeptidase F [Rhodobacterales bacterium HTCC2083]
 gi|206678918|gb|EDZ43405.1| oligoendopeptidase F [Rhodobacteraceae bacterium HTCC2083]
          Length = 609

 Score =  488 bits (1257), Expect = e-136,   Method: Composition-based stats.
 Identities = 267/614 (43%), Positives = 383/614 (62%), Gaps = 9/614 (1%)

Query: 13  AFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWE 72
           + F+      D       + LGNLP W+L DLY   ++ E+  D++ +E    +F   +E
Sbjct: 4   SMFQLPFPVRDANAGGGPDPLGNLPEWDLSDLYSDENAPELKRDLDWLEEACASFARDFE 63

Query: 73  GNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKL 132
           G LA+     +   L   +   ERI  + GRI S+A L Y    +     KF +D+  K+
Sbjct: 64  GKLANL----DAAELLDCVLRNERINSIAGRIMSFAGLRYYQLTTDADRAKFMSDMQEKI 119

Query: 133 ADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSD 192
            +F   L+FF LE+N L++  L+  +A +    +Y      IR +K + LS+++E  L D
Sbjct: 120 TNFTTPLVFFTLELNRLEDTQLDAHFAANTDLARYKPVFDRIRAMKPYQLSDELEKFLHD 179

Query: 193 TSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKS 252
              VG +A +R F E I  L F+++ + + +        + DR  R++A++ ++    ++
Sbjct: 180 LGVVG-DAWERLFDETIAGLSFEVDGKTLNIEGTLNLLTEHDRSKREAASREVARVLGEN 238

Query: 253 SHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRY 312
              F+ + NT AK++EI DRWR  E     RHLSN+VEP V+EAL  +V   YPK SHRY
Sbjct: 239 VKTFARVHNTQAKEKEIIDRWRGMETPQTGRHLSNHVEPEVVEALRTAVVEAYPKLSHRY 298

Query: 313 YELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTH 372
           YE+K+ WL L+ M  WDR APLP  +  I+ ++ A   V+ +Y  F P+M  IA+ FF  
Sbjct: 299 YEMKRGWLGLERMEVWDRNAPLPMENTAIVGWDAAEATVMDAYNAFDPRMGEIAKPFFRK 358

Query: 373 NWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQG 432
            WIDA    GK  GAFAH T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG
Sbjct: 359 GWIDAGVKPGKAPGAFAHPTVTDVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQG 417

Query: 433 ILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDF 492
            + +++ LTLAETAS+FGE LTF  +L+ A ++ ERKILLA K+EDM+N++VRQI+FYDF
Sbjct: 418 EMLSSTPLTLAETASVFGEMLTFQKMLEKAETQAERKILLAGKVEDMINTVVRQIAFYDF 477

Query: 493 ELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVY 552
           E KLH  RR  G++    IN +W+  Q ESLGPAFD  D  Y +FW  +PHF+ S FYVY
Sbjct: 478 ECKLHDARR-GGELTPEDINALWMSVQAESLGPAFDFVD-GYETFWAYIPHFVHSPFYVY 535

Query: 553 AYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERG 612
           AYAFG+ LVN+LY +Y+    + F+EKY ++L+AG SKH+ +LL P  ++ SDP FW++G
Sbjct: 536 AYAFGDGLVNALYAVYRE-GDEGFEEKYFDMLKAGGSKHHKDLLAPFGLDASDPKFWDKG 594

Query: 613 LQTVEKMIDDVEKM 626
           L  +  MID++E M
Sbjct: 595 LSMISGMIDELEAM 608


>gi|90425449|ref|YP_533819.1| peptidase M3B, oligoendopeptidase-like clade 3 [Rhodopseudomonas
           palustris BisB18]
 gi|90107463|gb|ABD89500.1| Peptidase M3B, oligoendopeptidase-related clade 3 [Rhodopseudomonas
           palustris BisB18]
          Length = 626

 Score =  488 bits (1255), Expect = e-135,   Method: Composition-based stats.
 Identities = 292/615 (47%), Positives = 396/615 (64%), Gaps = 9/615 (1%)

Query: 16  RKALRSSDMTTMDSQE---NLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWE 72
                 +   T  S++       LP W+L DLY S DS E++ D++ I+ + +AF+  ++
Sbjct: 16  PAPRTGAAKKTPPSRKPQAKAAQLPEWDLADLYTSIDSPEVARDLDKIDADCIAFEHDYK 75

Query: 73  GNLAHATNQKNCHS-LGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAK 131
           G LA  T +      L  A+A YE I +L GR+ASYA L +  +   P + KFY D++ +
Sbjct: 76  GKLAEETAKGGGGVWLAEAVARYEAIDDLAGRLASYAGLIHAGDSVDPKLSKFYGDVSER 135

Query: 132 LADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLS 191
           L      L+FFALE+N +D+A++E +  Q P    Y  WI++ RK K + L + +E L  
Sbjct: 136 LTAASVHLLFFALELNRVDDAVMEMAM-QAPELGHYRPWIEDSRKDKPYQLEDRIEQLFH 194

Query: 192 DTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNK 251
           + SQ G  A  R F + I +LRFK+  +++ +        D D + RK+A +AL+ TF  
Sbjct: 195 EKSQTGYGAFNRLFDQTISALRFKLGAKELAIEPTLTLLQDRDPQKRKAAGQALAKTFKA 254

Query: 252 SSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHR 311
           +   F+ ITNTLAKD+EI DRWR +E +ADSRHL+N VE  V++AL+ SV+  YPK SHR
Sbjct: 255 NERTFALITNTLAKDKEISDRWRGFEDVADSRHLANRVEREVVDALVASVRAAYPKLSHR 314

Query: 312 YYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFT 371
           YY LK +W     +  WDR APLP  +   I +  A+D+VL +Y  FSP+M+ IAE+FFT
Sbjct: 315 YYALKARWFGKKQLAHWDRNAPLPFAATGTIGWPEAKDMVLTAYTAFSPEMAKIAERFFT 374

Query: 372 HNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQ 431
             WIDAP   GK  GAF+H T PS HPY+L+NY GKP+DVMTLAHELGHG+H VL+++  
Sbjct: 375 DRWIDAPVRPGKAPGAFSHPTTPSAHPYVLMNYQGKPRDVMTLAHELGHGVHQVLAAKN- 433

Query: 432 GILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYD 491
           G L   + LTLAETAS+FGE LTF  LL    S ++R+ LLA K+EDM+N++VRQI+FY 
Sbjct: 434 GALMAPTPLTLAETASVFGEMLTFKRLLGQTKSLKQRQALLAGKVEDMINTVVRQIAFYS 493

Query: 492 FELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYV 551
           FE  +HTERR+   +   RI EIWL  Q ESLGPA D+    Y +FWM +PHFI S FYV
Sbjct: 494 FERAIHTERRNGE-LTAQRIGEIWLSVQGESLGPAIDIK-PGYENFWMYIPHFIHSPFYV 551

Query: 552 YAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWER 611
           YAYAFG+CLVNSLY +Y  N  + F E+YL +L AG +KHYSELL P  ++  DP FW+ 
Sbjct: 552 YAYAFGDCLVNSLYAVY-ENAQEGFAERYLAMLSAGGTKHYSELLQPFGLDARDPTFWDG 610

Query: 612 GLQTVEKMIDDVEKM 626
           GL  +  MID++E M
Sbjct: 611 GLSVIAGMIDELEAM 625


>gi|114771662|ref|ZP_01449066.1| Oligoendopeptidase F [alpha proteobacterium HTCC2255]
 gi|114547734|gb|EAU50624.1| Oligoendopeptidase F [alpha proteobacterium HTCC2255]
          Length = 609

 Score =  487 bits (1253), Expect = e-135,   Method: Composition-based stats.
 Identities = 285/618 (46%), Positives = 393/618 (63%), Gaps = 12/618 (1%)

Query: 9   FFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFK 68
           F S    +    S D  T     + G+LP W+L DLYPS D +EI+ D++ +E    +F 
Sbjct: 2   FKSFQLPQINFDSHDTVTG----DFGDLPNWDLNDLYPSPDGEEITKDLKALESNCSSFA 57

Query: 69  TRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDI 128
           + ++G L   T       L   I  YE I  + GR+ S+A LSY  N S     KF  D+
Sbjct: 58  SEYQGQLDGLT----AEGLLNCIERYEDIQNVAGRVMSFAGLSYYQNTSDANRSKFMADM 113

Query: 129 NAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMEC 188
            +K+ DF   L+FF+LEIN +D+  ++     +    +Y   I N+RK+K H LS+++E 
Sbjct: 114 QSKITDFTTPLVFFSLEINNIDDEHIQNLLNSNHKLSRYKPIIDNLRKMKPHQLSDELEQ 173

Query: 189 LLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHT 248
            L D S VG  A  R F E + SL+F ++D+ + L        D +RE R+   +AL   
Sbjct: 174 FLHDQSVVGTAAWNRLFDETMASLKFNVDDELLSLEATLNLLSDKNRETREKGTRALIKV 233

Query: 249 FNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKT 308
           F ++  +FS ITNTLAK++E++DRWRK      SRHL+N VEP V+EAL  +V   YPK 
Sbjct: 234 FGENISLFSRITNTLAKEKEVEDRWRKMPTPQFSRHLANQVEPEVVEALRNAVVTAYPKL 293

Query: 309 SHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEK 368
           SHRYY LK KW+ LD++  WDR APL   +   I +E A+ +VL +Y+ FSP+M+ IAE 
Sbjct: 294 SHRYYALKAKWMNLDSLEVWDRNAPLDSDNSSDIQWEDAKKIVLDAYSDFSPKMANIAEP 353

Query: 369 FFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSS 428
           FFT  WIDA    GK  GAFAH T+ +VHPY++LNY+GK +DVMTLAHELGHG+H VL++
Sbjct: 354 FFTKGWIDAGVKPGKAPGAFAHPTVTNVHPYVMLNYMGKQRDVMTLAHELGHGVHQVLAA 413

Query: 429 ETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQIS 488
            +QG L +++ LTLAETAS+FGE LTF  +L   +   +RK LLANK+EDM+N++VRQI+
Sbjct: 414 -SQGELLSSTPLTLAETASVFGEMLTFRKMLDKTTDPVKRKHLLANKVEDMINTVVRQIA 472

Query: 489 FYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESS 548
           FYDFE KLH   R+ G++   +INEIW+  Q ESLGP F+  +  Y +FW  +PHFI S 
Sbjct: 473 FYDFECKLHAA-RANGELTPDQINEIWMSIQAESLGPIFNFVE-GYETFWTYIPHFIHSP 530

Query: 549 FYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNF 608
           FYVYAYAFG+ LVN+LY +Y       F++KY ++L AG S H+ ELL P  ++ SDP F
Sbjct: 531 FYVYAYAFGDGLVNALYAVY-EEGNIDFQDKYFDMLSAGGSMHHKELLAPFGLDASDPKF 589

Query: 609 WERGLQTVEKMIDDVEKM 626
           W++GL  +  MID++E M
Sbjct: 590 WDKGLSLISSMIDELEAM 607


>gi|260460647|ref|ZP_05808898.1| oligoendopeptidase, pepF/M3 family [Mesorhizobium opportunistum
           WSM2075]
 gi|259033752|gb|EEW35012.1| oligoendopeptidase, pepF/M3 family [Mesorhizobium opportunistum
           WSM2075]
          Length = 612

 Score =  487 bits (1253), Expect = e-135,   Method: Composition-based stats.
 Identities = 296/594 (49%), Positives = 402/594 (67%), Gaps = 4/594 (0%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           LG+LP WNL DLY   D+ E+  D+     +++AF+ RW+G LA    + +   LG A+ 
Sbjct: 21  LGDLPEWNLADLYTGMDAPELKRDIARAAADAIAFEARWKGTLAAEAERGSAGRLGEALV 80

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
            YE + ELIGRI SYA L Y  N + P   K Y DI  K+ D    L+FFALE+N +D+A
Sbjct: 81  AYEALEELIGRIVSYAGLVYAGNTADPQRAKLYGDIQEKMTDASAHLLFFALELNLIDDA 140

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
            +E + A DP    Y  W+ ++R  K + L + +E L  + S  GR A  R F E +  L
Sbjct: 141 AIEGALAGDPAFGHYRPWVLDLRMDKPYQLEDRVEQLFHEKSITGRGAWNRLFDETMTDL 200

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           RF ++ +++ L  A     D+D EVR+ A++AL+ TF K+   F+ ITNTLAKD+EI DR
Sbjct: 201 RFDVDGEELTLEPALNRLQDADGEVRRRASEALAATFRKNLRTFTLITNTLAKDKEISDR 260

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR +E IADSRHL+N VE  V++AL  +V+  YP+ SHRYY++K +WL ++ M  WDR A
Sbjct: 261 WRGFEDIADSRHLANRVERSVVDALATAVREAYPRLSHRYYQMKARWLGMEVMNHWDRNA 320

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP T Q +I ++ AR+ VL +Y +FSP M+ IA  FF  NWIDAP   GK  GAFAH T
Sbjct: 321 PLPETPQAVIGWDEARNTVLSAYQRFSPDMAEIARTFFDRNWIDAPVRPGKSPGAFAHPT 380

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +PS HPY+LLNY+GKP+DVMTLAHELGHG+H VL++  QG L  ++ LTLAETAS+FGE 
Sbjct: 381 VPSAHPYVLLNYMGKPRDVMTLAHELGHGVHQVLAA-GQGALMASTPLTLAETASVFGEM 439

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF SLL+  + + ERK +LA K+EDM+N++VRQI+FY+FE K+H ERR+   + + R+ 
Sbjct: 440 LTFRSLLEQTTDRRERKAMLAQKVEDMINTVVRQIAFYEFERKVHAERRNGE-LTSDRLG 498

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
           + WLE Q ESLGPA  L +  Y  FW  +PHFI S FYVYAYAFG+CLVNSLY +Y+ N 
Sbjct: 499 QFWLEVQAESLGPAIKLRE-GYEVFWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQ-NA 556

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              F++KY  +LRAG +KH+SELL P  ++ +DP FW+ GL  +  +ID++E +
Sbjct: 557 ERGFQDKYFEMLRAGGTKHHSELLAPFGLDATDPAFWQIGLGVIGGLIDELEAL 610


>gi|310815302|ref|YP_003963266.1| Oligoendopeptidase F [Ketogulonicigenium vulgare Y25]
 gi|308754037|gb|ADO41966.1| Oligoendopeptidase F [Ketogulonicigenium vulgare Y25]
          Length = 603

 Score =  487 bits (1253), Expect = e-135,   Method: Composition-based stats.
 Identities = 265/594 (44%), Positives = 377/594 (63%), Gaps = 8/594 (1%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           +G LP W+L DLYP  DS E++ D++ +  E  AF+  +EG L+      +   + AA+ 
Sbjct: 16  IGPLPEWDLTDLYPGEDSPELARDLDWLAGECTAFQADYEGKLSSL----SAGDMLAAVK 71

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
            YE I  + GRI S+A LSY    +     KF +D+  ++ +    L+F+ LE N LD+A
Sbjct: 72  RYEEIDIIAGRIMSFAGLSYYQMTTDSERAKFLSDMQDEITNDTTALVFWGLEFNRLDDA 131

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
            L+   AQ+    +Y    + +R ++ + LS+++E  L D S VG  A  R F E +  L
Sbjct: 132 HLDGLIAQNADLARYQPIFERMRAMRPYQLSDELEKFLHDQSVVGASAWNRLFDETMAGL 191

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
            F++N + + +        D +R  R++A  AL+  F ++   F+ I NTLAK++E++DR
Sbjct: 192 SFEVNGETLNIEATLNLLTDDNRPTREAAHVALAKVFRENVKTFARIHNTLAKEKEVEDR 251

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR +     +RHL+N+VEP V+EAL  +V   YP+ SHRYY LK KW+ LD +  WDR A
Sbjct: 252 WRGFPTPQTARHLANHVEPEVVEALRNAVVAAYPRLSHRYYRLKAKWMGLDVLQVWDRNA 311

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP   Q  I +E A+D VL +Y  F P+++ +A  FFT  WIDA    GK  GAFAH T
Sbjct: 312 PLPRNPQRPISWEEAKDTVLAAYGDFDPRLADLAAPFFTDGWIDAAVKPGKAQGAFAHPT 371

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           + +VHPY+L+NYLGK +DVMTLAHELGHGIH  L++  QG L +++ LTLAETAS+FGE 
Sbjct: 372 VSTVHPYVLVNYLGKTRDVMTLAHELGHGIHQRLAA-GQGELLSSTPLTLAETASVFGEM 430

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF  +L   + K  RK LLA+K+EDM+N++VRQI+FYDFE KLH   R+ G++    I 
Sbjct: 431 LTFRKVLDQTTDKAARKALLASKVEDMINTVVRQIAFYDFECKLHAA-RAEGELTPDDIA 489

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
            +W+  Q +SLG AF+ +D  Y +FW  V HF+ S FYVYAYAFG+ LVN+LY  Y    
Sbjct: 490 VLWMSVQAQSLGDAFEFAD-GYENFWTYVSHFVHSPFYVYAYAFGDGLVNALYAAYTEGD 548

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            D F++KY ++L AG SKH+SELL P  ++ +DP FW++GL  +E  ID++E M
Sbjct: 549 PD-FQQKYFDLLSAGGSKHHSELLKPFGLDATDPKFWDKGLSMIEGFIDELESM 601


>gi|149916585|ref|ZP_01905099.1| hypothetical protein RAZWK3B_08211 [Roseobacter sp. AzwK-3b]
 gi|149809512|gb|EDM69372.1| hypothetical protein RAZWK3B_08211 [Roseobacter sp. AzwK-3b]
          Length = 606

 Score =  486 bits (1252), Expect = e-135,   Method: Composition-based stats.
 Identities = 273/613 (44%), Positives = 385/613 (62%), Gaps = 9/613 (1%)

Query: 14  FFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEG 73
            F   L + D       +NLG LP W+L DLY S D+  +  D++ +E     F   +EG
Sbjct: 1   MFHLPLPAHDANAGSGDKNLGRLPEWDLTDLYESPDAPALKRDLDWLEKACADFAADYEG 60

Query: 74  NLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA 133
            LA      +   +   +   E+I  + GRI S+A+L Y    +     KF +D   K+ 
Sbjct: 61  KLADL----DAAGMLDCLKRDEKISNIAGRIMSFAVLRYQQQTTDGDRAKFLSDCQEKVT 116

Query: 134 DFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDT 193
            +   L+FF LE+N L+E  L   Y       +Y   +  IR +K + LS+++E  L D 
Sbjct: 117 TYTTPLVFFTLELNRLEEDALNALYDASAELARYKPVLDRIRAMKPYQLSDELEKFLHDM 176

Query: 194 SQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSS 253
             VG +A +R F E I  L F ++ +++ +        D DR  R++AA+ L+  F  + 
Sbjct: 177 GVVG-DAWERLFDETISGLSFIVDGEELGIESTLNLLTDQDRSQREAAARELARVFGANI 235

Query: 254 HIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY 313
             F+ + NT AK++E+ DRWR       SRHLSN+VEP V+EAL  +V N YPK SHRYY
Sbjct: 236 RTFARVHNTSAKEKEVIDRWRGMPTPQTSRHLSNDVEPEVVEALRNAVVNAYPKLSHRYY 295

Query: 314 ELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHN 373
           ELK+KWL LD M  WDR APLP   + I+ +  ARD+V+++Y+ F P+M  +AE FF+  
Sbjct: 296 ELKRKWLGLDVMQVWDRNAPLPIEDKKIMDWTSARDIVMEAYSAFDPRMGELAEPFFSKG 355

Query: 374 WIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGI 433
           WIDA    GK  GAFAH T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG 
Sbjct: 356 WIDAGVKPGKAPGAFAHPTVTDVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGE 414

Query: 434 LTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFE 493
           L  N+ LTLAETAS+FGE LTF  +L+ A++  ERK+LLA K+EDM+N+++RQI+FYDFE
Sbjct: 415 LLANTPLTLAETASVFGEMLTFRKMLEKAATDTERKVLLAGKVEDMINTVMRQIAFYDFE 474

Query: 494 LKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYA 553
            KLH  RR  G++  + IN +W+  Q ESLGPAF+  D  Y +FW  +PHF+ S FYVYA
Sbjct: 475 CKLHDARR-GGELTPNDINALWMSVQAESLGPAFEFMD-GYETFWAYIPHFVHSPFYVYA 532

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YAFG+ LVN+LY +Y+ +  + F++KY  +L+AG SKH+  LL P  ++ SDP FW++GL
Sbjct: 533 YAFGDGLVNALYAVYEESP-EGFEDKYFEMLKAGGSKHHKALLEPFGLDASDPAFWDKGL 591

Query: 614 QTVEKMIDDVEKM 626
             + ++ID++E M
Sbjct: 592 SMISRLIDELEAM 604


>gi|91975890|ref|YP_568549.1| peptidase M3B, oligoendopeptidase-like clade 3 [Rhodopseudomonas
           palustris BisB5]
 gi|91682346|gb|ABE38648.1| Peptidase M3B, oligoendopeptidase-related clade 3 [Rhodopseudomonas
           palustris BisB5]
          Length = 632

 Score =  486 bits (1250), Expect = e-135,   Method: Composition-based stats.
 Identities = 284/594 (47%), Positives = 386/594 (64%), Gaps = 6/594 (1%)

Query: 34  GNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGA-AIA 92
             LP WNL DLYP+ D+ +++ D++ ++ +  +F+  ++G LA    +    +  A A+ 
Sbjct: 43  AKLPEWNLADLYPAIDAPQVAADLDRLDADCASFEADFKGKLAEEAVKDGGGAWLASAVR 102

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
            YE I +L GR+ SYA L +  +   P   KFY D++ +L      L+FFALE+N +D+ 
Sbjct: 103 RYEAIEDLAGRLGSYAGLVHAGDSVDPVKSKFYGDVSERLTAASVHLLFFALELNRVDDE 162

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
           +LE++  Q P    Y  WI+++RK K + L + +E L  + SQ G  A  R F + I SL
Sbjct: 163 VLERAM-QTPELGHYRPWIEDLRKDKPYQLEDRVEQLFHEKSQTGYGAFNRLFDQTISSL 221

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           RFK+  ++  +        D     RK+AA AL+ TF  +   F+ ITNTLAKD+EI DR
Sbjct: 222 RFKVGGKEQAIEPTLNLLQDRTPAKRKAAADALAKTFKANERTFALITNTLAKDKEISDR 281

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR +E +ADSRHL+N VE  V++AL+ SV+  YP+ SHRYY+LK  W     +  WDR A
Sbjct: 282 WRGFEDVADSRHLNNRVEREVVDALVASVRGAYPRLSHRYYKLKAGWFGKKKLPHWDRNA 341

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP  +   I +  AR++VL +Y  FSP+M+ IAE+FFT  WIDAP   GK  GAF+H T
Sbjct: 342 PLPFAATGSIAWPEARNMVLTAYNAFSPEMARIAERFFTDRWIDAPVRPGKAPGAFSHPT 401

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
            PS HPY+L+NY GKP+DVMTLAHELGHG+H VL++   G L   + LTLAETAS+FGE 
Sbjct: 402 TPSAHPYVLMNYQGKPRDVMTLAHELGHGVHQVLAAGN-GALMAPTPLTLAETASVFGEM 460

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF  LL    S ++R+ LLA K+EDM+N++VRQI+FY FE  +HTERR  G++   RI 
Sbjct: 461 LTFRRLLAQTKSAKQRQALLAGKVEDMINTVVRQIAFYSFERAIHTERR-GGELTAQRIG 519

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
           EIWL  Q ESLGPA D+    Y  FWM +PHFI S FYVYAYAFG+CLVNSLY +Y  N 
Sbjct: 520 EIWLSVQGESLGPAIDIR-PGYEHFWMYIPHFIHSPFYVYAYAFGDCLVNSLYAVY-ENA 577

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + F ++YL +L AG +KHYSELL P  ++  DP FW+ GL  +  MID++E+M
Sbjct: 578 QEGFADRYLAMLSAGGTKHYSELLAPFGLDAKDPTFWDGGLSVIAGMIDELEEM 631


>gi|254511925|ref|ZP_05123992.1| oligoendopeptidase F [Rhodobacteraceae bacterium KLH11]
 gi|221535636|gb|EEE38624.1| oligoendopeptidase F [Rhodobacteraceae bacterium KLH11]
          Length = 643

 Score =  485 bits (1248), Expect = e-134,   Method: Composition-based stats.
 Identities = 268/604 (44%), Positives = 372/604 (61%), Gaps = 9/604 (1%)

Query: 14  FFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEG 73
                    D       ++LGNLP W+L DLY S D+ E+S D++ +E E  +F   +EG
Sbjct: 1   MRDLPFPVRDANAGGGADDLGNLPEWDLTDLYASEDAPELSRDLDWLEQECASFAADYEG 60

Query: 74  NLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA 133
            LA      +  +L   +   E+I  + GRI S+A L Y    +     KF +D+  K+ 
Sbjct: 61  KLAEL----DAATLLTCVLRNEKINAIAGRIMSFAGLRYYQITTDADRAKFLSDMQEKIT 116

Query: 134 DFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDT 193
            F   L+FF LEIN +D+ +L   +A      +Y    + IR +K + LS+++E  L D 
Sbjct: 117 VFTTPLVFFTLEINRIDDDVLAAHFAASADLARYEPVFRRIRAMKPYQLSDELEKFLHDL 176

Query: 194 SQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSS 253
             VG +A +R F E I  L F ++ +++ +        + DR  R++AA+ L+  F  + 
Sbjct: 177 GVVG-DAWERLFDETIAGLTFTVDGEELNIEGTLNLLTEQDRTKREAAARELATVFQSNI 235

Query: 254 HIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY 313
             F+ + NT AK++EI DRWR        RHLSN+VEP V+EAL ++V   YPK SHRYY
Sbjct: 236 KTFARVHNTQAKEKEIVDRWRNMPTAQTGRHLSNDVEPEVVEALREAVVAAYPKLSHRYY 295

Query: 314 ELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHN 373
           ELK+KWL LD M  WDR APLP     I+ +  A   V+ +Y  F P+M  IA  FF+  
Sbjct: 296 ELKRKWLGLDVMQVWDRNAPLPMEDTRIVDWAEAEATVMGAYNAFDPRMGEIASPFFSKG 355

Query: 374 WIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGI 433
           WIDA    GK  GAFAH T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL+++ QG 
Sbjct: 356 WIDAAVKPGKAPGAFAHPTVTEVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAD-QGE 414

Query: 434 LTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFE 493
           + +++ LTLAETAS+FGE LTF  +L  A + E+RK+LLA K+EDM+N++VRQI+FYDFE
Sbjct: 415 MLSSTPLTLAETASVFGEMLTFRKMLDQAETPEQRKVLLAGKVEDMINTVVRQIAFYDFE 474

Query: 494 LKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYA 553
            KLH  RR    +    IN +W+  Q ESLGPAF+  +  Y +FW  +PHF+ S FYVYA
Sbjct: 475 CKLHAARREGE-LTPDDINALWMSVQAESLGPAFEFME-GYETFWAYIPHFVHSPFYVYA 532

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YAFG+ LVN+LY +Y  +  D F++KY ++LRAG SKH+ ELL P  ++ SDP FW +GL
Sbjct: 533 YAFGDGLVNALYSVY-ESGADGFEDKYFDMLRAGGSKHHKELLAPFGLDASDPAFWGKGL 591

Query: 614 QTVE 617
             + 
Sbjct: 592 SMIS 595


>gi|294678322|ref|YP_003578937.1| oligoendopeptidase F [Rhodobacter capsulatus SB 1003]
 gi|294477142|gb|ADE86530.1| oligoendopeptidase F [Rhodobacter capsulatus SB 1003]
          Length = 608

 Score =  485 bits (1248), Expect = e-134,   Method: Composition-based stats.
 Identities = 270/595 (45%), Positives = 375/595 (63%), Gaps = 9/595 (1%)

Query: 32  NLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAI 91
             G LP W+L DLY + D+ E  +DM  +E    +F   +EG LA      +   +   I
Sbjct: 21  EFGALPDWDLSDLYTAPDAPEFLHDMAWLEAACASFAKDYEGQLADL----DAAGMADCI 76

Query: 92  AEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDE 151
           A +E I  + GRI SYA L Y  N +     KF +D   K+  F   L+FF+LE N +D+
Sbjct: 77  ARHEAIETVAGRIMSYAGLRYYQNTTDAERAKFMSDAGDKITSFTTPLVFFSLEFNRIDD 136

Query: 152 ALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIES 211
           A  E  +A DPL  ++      +R +K + LS+++E  L D S VG  A  R F E   +
Sbjct: 137 ARYEAVFA-DPLVARFKPVFDRMRAMKPYQLSDELEKFLHDQSVVGASAWNRLFDETTAA 195

Query: 212 LRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
           L+F +  + + L        D DR  R++AA+ L+  F ++  +F+ + NTLAK++E++D
Sbjct: 196 LQFTVQGETLNLEATTTLMSDHDRGKREAAARELARVFGQNVKLFARVHNTLAKEKEVED 255

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRL 331
           RWRK       RHLSN+VEP V+EAL  +V   YP+ SHRYY LK KWL L+ +  WDR 
Sbjct: 256 RWRKMPTPQLGRHLSNHVEPEVVEALRNAVVAAYPRLSHRYYALKAKWLGLEKLQVWDRN 315

Query: 332 APLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHG 391
           APLP  +   I ++ A+  VL +Y  FSP+M+ IA+ FF   WIDA    GK  GAFAH 
Sbjct: 316 APLPSETPRKILWDEAKATVLGAYGAFSPRMAEIAQPFFDKGWIDAGVKPGKAPGAFAHP 375

Query: 392 TIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE 451
           T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H VL+++ QG + +++ LTLAETAS+FGE
Sbjct: 376 TVTTVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAK-QGPMLSDTPLTLAETASVFGE 434

Query: 452 TLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRI 511
            LTF +LL AA +  ERK LLA K+EDM+N++VRQI+FYDFE KLH   R+ G++    I
Sbjct: 435 MLTFRALLDAAKTPAERKQLLAGKVEDMINTVVRQIAFYDFECKLHAA-RAQGELTPEDI 493

Query: 512 NEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSN 571
           N +W+  Q ESLGP F+     Y +FW  +PHF+ S FYVYAYAFG+ LVN+LY  Y + 
Sbjct: 494 NALWMSVQAESLGPVFEFM-PGYETFWTYIPHFVHSPFYVYAYAFGDGLVNALYATY-AA 551

Query: 572 TVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            +  F+ KY  +L AG SKH+ +LL P  ++ SDP FW++GL  +  +ID++E M
Sbjct: 552 GLPDFQTKYFEMLEAGGSKHHKDLLAPFGLDASDPAFWDKGLSMIAGLIDELEAM 606


>gi|84688082|ref|ZP_01015940.1| Oligoendopeptidase F [Maritimibacter alkaliphilus HTCC2654]
 gi|84663910|gb|EAQ10416.1| Oligoendopeptidase F [Rhodobacterales bacterium HTCC2654]
          Length = 614

 Score =  485 bits (1248), Expect = e-134,   Method: Composition-based stats.
 Identities = 272/619 (43%), Positives = 382/619 (61%), Gaps = 11/619 (1%)

Query: 12  NAFFRKALRSSDMTTMDSQE--NLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKT 69
                K     D  T  +    +LGNLP W+L DLY + D+ E++ D++ ++     F  
Sbjct: 1   MRIPTKPSPVFDAATDPAGSGKDLGNLPDWDLSDLYAAPDAPEVTRDLDRLKTLCADFAE 60

Query: 70  RWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDIN 129
           R+EG LA      +   +   +  +E I  + GR+ SYA L Y    +     +F  +  
Sbjct: 61  RYEGKLADL----DAQGMLTCVTAHEEIDRIAGRLMSYAGLRYYQVTTDGERAQFLQNCQ 116

Query: 130 AKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECL 189
            KL D+   L+FF+LEIN + +  L+  +  +    +Y      +R ++ + LS+++E  
Sbjct: 117 EKLTDYTTPLVFFSLEINRIPDDKLDALFEANADLARYKPIFDRLRAMRPYQLSDELEKF 176

Query: 190 LSDTSQVGREALKRFFCENIESLRF--KINDQKIPLTKAYKSFFDSDREVRKSAAKALSH 247
           L D S VG  A  + F E +  L F  +  D+ + L        +  R  R++ A+ L+ 
Sbjct: 177 LHDQSAVGSAAWNKLFDETMARLTFSPEGEDEDLSLEATLNLLSEQKRSRREAGARELAR 236

Query: 248 TFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPK 307
            F ++  +F+ + NTLAK++EI+DRWRK      +RHLSN+VEP V+EAL  +V + YPK
Sbjct: 237 VFGENLPLFARVHNTLAKEKEIEDRWRKMPSAQTARHLSNHVEPEVVEALRNAVVDAYPK 296

Query: 308 TSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAE 367
            SHRYY LK KWL L+TM  WDR APLP   + +I +  AR++VL +YA F P+M+ IAE
Sbjct: 297 LSHRYYALKAKWLGLETMEVWDRNAPLPMEEERVIDWPKAREMVLSAYAGFDPEMAAIAE 356

Query: 368 KFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLS 427
            FF   WIDA    GK  GAFAH T+   HPY+LLNYLGKP+DVMTLAHELGHG+H VL+
Sbjct: 357 PFFDRGWIDAGVKPGKAPGAFAHPTVTDAHPYVLLNYLGKPRDVMTLAHELGHGVHQVLA 416

Query: 428 SETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQI 487
           +  QG L  ++ LTLAETAS+FGE LTF  LL  A    ++K+LLA K+EDM+N++VRQI
Sbjct: 417 A-GQGELLADTPLTLAETASVFGEMLTFRKLLAEAPDAAQKKVLLAGKVEDMINTVVRQI 475

Query: 488 SFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIES 547
           +FYDFE KLH  RR+ G++ T +INE+W+  Q ESLGPAF   D  Y +FW  +PHF+ S
Sbjct: 476 AFYDFECKLHEARRTRGELTTSQINELWMSVQGESLGPAFTFMD-GYETFWSYIPHFVHS 534

Query: 548 SFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPN 607
            FYVYAYAFG+ LVN+LY +Y       F++KY  +L+AG SKH+SELL P  ++ SDP 
Sbjct: 535 PFYVYAYAFGDGLVNALYAVY-EEGDPDFQKKYFEMLKAGGSKHHSELLKPFGLDASDPK 593

Query: 608 FWERGLQTVEKMIDDVEKM 626
           FW++GL  +   ID++E M
Sbjct: 594 FWDKGLSMISGFIDELEAM 612


>gi|159045143|ref|YP_001533937.1| oligoendopeptidase [Dinoroseobacter shibae DFL 12]
 gi|157912903|gb|ABV94336.1| oligoendopeptidase [Dinoroseobacter shibae DFL 12]
          Length = 611

 Score =  484 bits (1245), Expect = e-134,   Method: Composition-based stats.
 Identities = 272/612 (44%), Positives = 373/612 (60%), Gaps = 8/612 (1%)

Query: 15  FRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGN 74
           F       D  T    +NLG LP W+L DLYP+ D+ EI  DM+ +E     F   +EG 
Sbjct: 6   FPAPTPLRDAATDTGGKNLGALPDWDLSDLYPAPDAPEIKRDMDWLEAACRDFAADYEGK 65

Query: 75  LAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLAD 134
           LA      +   +   +  YERI  + GR+ SY  L Y  N +     K   D   K+  
Sbjct: 66  LADL----DAAGMLDCVLRYERIDTVSGRLMSYMGLRYYQNTTDAERAKAMADAQDKITT 121

Query: 135 FEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTS 194
           +   L+F+ LEIN L +  L+  +A +    +Y      +R +K + LS+++E  L D+S
Sbjct: 122 YTTPLVFYTLEINRLPDDHLDGLFAANADLARYKPIFDRLRAMKPYQLSDELEKFLHDSS 181

Query: 195 QVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
            VG  A  R F E I  + F+++ +   +        + +R+ R++AA+ L+  F     
Sbjct: 182 TVGAAAWNRLFDETIAGMMFEVDGEAYNIEGTLNFLSEPERDKREAAARELAAQFGSQIK 241

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
           +F+ + NTLAK++EI DRWR        RHL+N+VEP V+EAL  +V   YPK SHRYY 
Sbjct: 242 LFARVHNTLAKEKEITDRWRGLPTPQAGRHLANHVEPEVVEALRNAVVAAYPKLSHRYYA 301

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           LK KW+ LD M  WDR APLP     I+ ++ A+  VL++YA F P+M+ IAE FF   W
Sbjct: 302 LKAKWMGLDKMQVWDRNAPLPREDNRIVDWDEAKATVLEAYADFDPEMARIAEPFFDRGW 361

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           IDA    GK  GAFAH T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG L
Sbjct: 362 IDAGVKPGKAPGAFAHPTVAEVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGEL 420

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
            +++ LTLAETAS+FGE LTF  LL AA  K  RKILLA K+EDM+N++VRQI+FYDFE 
Sbjct: 421 LSSTPLTLAETASVFGEMLTFRKLLDAAPDKATRKILLAGKVEDMINTVVRQIAFYDFEC 480

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
           KLH   R  G++    I ++W+  Q ESLGP F+  D  Y +FW  +PHF+ S FYVYAY
Sbjct: 481 KLHDA-RKAGELTPDEIGDLWMSVQGESLGPVFEFMD-GYETFWAYIPHFVHSPFYVYAY 538

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           AFG+ LVN+LY +Y       F+ KY ++L+AG SKH+ +LL P  ++ SDP FW++GL 
Sbjct: 539 AFGDGLVNALYAVY-EEGDPDFRTKYFDMLKAGGSKHHKDLLEPFGLDASDPAFWDKGLS 597

Query: 615 TVEKMIDDVEKM 626
            +  MID++E M
Sbjct: 598 MISGMIDELEAM 609


>gi|146277609|ref|YP_001167768.1| pepF/M3 family oligoendopeptidase [Rhodobacter sphaeroides ATCC
           17025]
 gi|145555850|gb|ABP70463.1| oligoendopeptidase, pepF/M3 family [Rhodobacter sphaeroides ATCC
           17025]
          Length = 606

 Score =  484 bits (1245), Expect = e-134,   Method: Composition-based stats.
 Identities = 274/613 (44%), Positives = 372/613 (60%), Gaps = 10/613 (1%)

Query: 14  FFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEG 73
                    D         LGNLP W+L DLYP+ D+ E+  DM  ++     F   +EG
Sbjct: 2   TLPLPRPVHDANASAGG--LGNLPEWDLRDLYPAPDAAEVGQDMAWLKSACADFAATYEG 59

Query: 74  NLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA 133
            LA      +   L   +  YE+I    GR+ SYA L Y  N       KF  D   K+ 
Sbjct: 60  KLASL----DAAGLLTCVETYEKIDITAGRLMSYAGLRYYQNTMDSERAKFMADAQDKVT 115

Query: 134 DFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDT 193
           D+   L+FF+LE N LD+A LE   A+ P   +Y      +R ++ H LS+++E  L D 
Sbjct: 116 DYTTALVFFSLEFNRLDDAHLESRLAESPALARYRPVFDRMRAMRPHQLSDELERFLHDQ 175

Query: 194 SQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSS 253
           S VG  A  R F E +  L F I  +++ L        D +R  R++AA+AL+  F    
Sbjct: 176 STVGAAAWNRLFDETMAGLTFTIEGEELNLESTLNLLTDPERSRREAAARALADVFGGHI 235

Query: 254 HIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY 313
            +F+ + NTLAK++EI DRWRK       RHL+N+VEP V+EAL  +V   YPK SHRYY
Sbjct: 236 KLFARVHNTLAKEKEIHDRWRKMPTPQYGRHLANHVEPEVVEALRNAVVAAYPKLSHRYY 295

Query: 314 ELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHN 373
            LK KW+ LD +  WDR APLP  +  ++ +  A+  VL++Y+ F P+M+ IA+ FF   
Sbjct: 296 RLKAKWMGLDKLQVWDRNAPLPIETPRLVDWTEAQATVLEAYSAFDPRMAEIAQPFFDKG 355

Query: 374 WIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGI 433
           WIDA    GK  GAFAH T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG 
Sbjct: 356 WIDAGVKPGKAPGAFAHPTVTTVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGE 414

Query: 434 LTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFE 493
           L +++ LTLAETAS+FGE LTF  LL AA +  ERK LLA K+EDM+N++VRQI+FYDFE
Sbjct: 415 LLSSTPLTLAETASVFGEMLTFRKLLDAARTPAERKTLLAGKVEDMINTVVRQIAFYDFE 474

Query: 494 LKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYA 553
            KLH  RR    +    IN +W+  Q +SLG AF+  +  Y +FW  +PHF+ S FYVYA
Sbjct: 475 CKLHEARRQGE-LTPEDINALWMSVQAQSLGDAFEFME-GYETFWSYIPHFVHSPFYVYA 532

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YAFG+ LVN+LY +Y +   + F++KY  +L AG SKH+ ELL P  ++ SDP FW++GL
Sbjct: 533 YAFGDGLVNALYAVY-AEGGEGFEDKYFEMLAAGGSKHHKELLAPFGLDASDPTFWDKGL 591

Query: 614 QTVEKMIDDVEKM 626
             +   ID++E M
Sbjct: 592 SMIAGFIDELEAM 604


>gi|328542492|ref|YP_004302601.1| Oligoendopeptidase, pepF/M3 family [polymorphum gilvum SL003B-26A1]
 gi|326412238|gb|ADZ69301.1| Oligoendopeptidase, pepF/M3 family [Polymorphum gilvum SL003B-26A1]
          Length = 604

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 290/601 (48%), Positives = 409/601 (68%), Gaps = 7/601 (1%)

Query: 28  DSQEN--LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCH 85
            ++    LG+LP W+L DLYP+ D+ E+  D+      S AF+T ++G LA   +  +  
Sbjct: 6   PARSAAALGSLPEWDLTDLYPAPDAPEVKADLAAALDRSKAFETAYKGTLADLASG-DRA 64

Query: 86  SLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALE 145
            L AA+  YE + +L+GR+ S+A L Y+   + P  +KFY D+  ++      L+FF LE
Sbjct: 65  GLLAAVKAYEALEDLLGRLISFAGLVYSGQTTDPARQKFYGDVQERITTAGSHLLFFTLE 124

Query: 146 INTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFF 205
           +N++D+A+LE + A D     Y  W +++RK K + L + +E L  + S  GR A  R F
Sbjct: 125 LNSIDDAVLEAALAADAGLAHYRPWFEDLRKEKPYQLEDRVEQLFHEKSVTGRGAWNRLF 184

Query: 206 CENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAK 265
            E I SLRF ++ +++ +        D+D   RK+AA+AL+ TF  +  +F+ ITNTLAK
Sbjct: 185 DETIASLRFSVDGRELAVEPTLNLLQDADPATRKAAAEALAATFRDNLRLFTLITNTLAK 244

Query: 266 DEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTM 325
           D+EI DRWRK+E IADSRHL+N VE  V++A++ +V+  YP+ SHRYY LK +WL ++ +
Sbjct: 245 DKEISDRWRKFEDIADSRHLANRVEREVVDAMVAAVREAYPRLSHRYYRLKARWLGMERL 304

Query: 326 YFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGS 385
             WDR APLP     +IP+E ARD VL +YA FSP+MS IA +FF  NWIDAP  DGK  
Sbjct: 305 NHWDRNAPLPKADTRVIPWEEARDTVLAAYAGFSPEMSEIAGRFFVRNWIDAPARDGKAP 364

Query: 386 GAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAET 445
           GAFAH T+PS HPY+L+NYLGK +DVMTLAHELGHG+H VL++    ++   + LTLAET
Sbjct: 365 GAFAHPTVPSAHPYVLVNYLGKTRDVMTLAHELGHGVHQVLAAPNGPLM-APTPLTLAET 423

Query: 446 ASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGD 505
           AS+FGE LTF +LL  A++   RK++LA K EDM+N++VRQI+FY FE K+H ERR  G+
Sbjct: 424 ASVFGEMLTFRALLDKATTPAARKVMLAAKAEDMINTVVRQIAFYTFERKVHAERR-DGE 482

Query: 506 IPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLY 565
           + + RI EIWLE Q ESLGPA  L +  Y +FW  +PHFI S FYVYAYAFG+CLVNSLY
Sbjct: 483 LTSERIGEIWLEVQAESLGPAIRLGE-GYETFWTYIPHFIHSPFYVYAYAFGDCLVNSLY 541

Query: 566 DIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEK 625
            +Y+    + F +KY  +L+AG ++H+SELL P  ++ +DP+FW++GL  +E++ID++E 
Sbjct: 542 AVYQEA-EEGFAKKYFALLKAGGTRHHSELLAPFGLDAADPDFWKKGLSVIERIIDELEA 600

Query: 626 M 626
           M
Sbjct: 601 M 601


>gi|126733176|ref|ZP_01748923.1| Oligoendopeptidase F [Roseobacter sp. CCS2]
 gi|126716042|gb|EBA12906.1| Oligoendopeptidase F [Roseobacter sp. CCS2]
          Length = 605

 Score =  483 bits (1243), Expect = e-134,   Method: Composition-based stats.
 Identities = 284/596 (47%), Positives = 377/596 (63%), Gaps = 8/596 (1%)

Query: 31  ENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAA 90
           ++LGNLP W+L DLYP  DS E+  DM  +E E  AF   +EG LA      +   L  A
Sbjct: 16  KDLGNLPEWDLSDLYPGTDSPELERDMAWLEKECAAFAVDFEGKLADL----DAPGLLGA 71

Query: 91  IAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLD 150
           +  YE+I  + GRI S+A L Y    +     KF  D   K+  +   L+F+ LE N LD
Sbjct: 72  VQRYEQIDVIAGRIMSFAGLRYYQCTTDSDRAKFMADCQDKITTYTTPLVFYGLEFNRLD 131

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIE 210
           +  L    A +    +Y      +R +K H LS+++E  L D S VG  A  R F E + 
Sbjct: 132 DDHLADLLAANADLARYRPVFDRMRAMKPHQLSDELEKFLHDQSTVGAAAWNRLFDETMA 191

Query: 211 SLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
            L+F ++ + + L        + DR  R +A  AL+  F  +  IFS + NTLAK++EI 
Sbjct: 192 GLKFTVDGETLSLEATLNLLTEQDRNKRAAATHALAEVFQDNIKIFSRVHNTLAKEKEID 251

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
           DRWRK       RHLSN+VE  V+EAL  +V   YP+ SHRYY LK KWL LD M  WDR
Sbjct: 252 DRWRKMPTPQTGRHLSNHVEAEVVEALRNAVVAAYPRLSHRYYALKAKWLGLDRMQVWDR 311

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
            APLP  S  I+ ++ A + V+ +YA F P+M+ IA+ FFT  WIDA    GK  GAFAH
Sbjct: 312 NAPLPMESDKIVDWDEATNTVMDAYAGFDPKMAEIAKPFFTDGWIDAAVKPGKAPGAFAH 371

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
            T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL++E QG L +++ LTLAETAS+FG
Sbjct: 372 PTVTPVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAE-QGELLSSTPLTLAETASVFG 430

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E LTF  +L  A +KEERKILLA K+EDM+N++VRQI+FYDFE KLH   R+ G++    
Sbjct: 431 EMLTFQKMLDGAQTKEERKILLAGKVEDMINTVVRQIAFYDFECKLHAA-RAEGELTPDD 489

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
           IN +W+  Q ESLGP FD ++  Y +FW  +PHF+ S FYVYAYAFG+ LVN+LY +Y +
Sbjct: 490 INALWMSVQAESLGPVFDFAE-GYETFWAYIPHFVHSPFYVYAYAFGDGLVNALYAVY-A 547

Query: 571 NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
                F+EKY ++LRAG SKH+ ELL P  ++ SDP FW++GL  +  MID++E M
Sbjct: 548 EGDPDFREKYFDMLRAGGSKHHKELLAPFGLDASDPKFWDKGLAMISGMIDELEAM 603


>gi|85716087|ref|ZP_01047063.1| peptidase M3B, oligoendopeptidase-related clade 3 [Nitrobacter sp.
           Nb-311A]
 gi|85697086|gb|EAQ34968.1| peptidase M3B, oligoendopeptidase-related clade 3 [Nitrobacter sp.
           Nb-311A]
          Length = 625

 Score =  483 bits (1243), Expect = e-134,   Method: Composition-based stats.
 Identities = 279/592 (47%), Positives = 385/592 (65%), Gaps = 6/592 (1%)

Query: 36  LPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS-LGAAIAEY 94
           LP WNL DLY    + E+  D++ I+ E  AF+  ++G LA  T+     + L  A+  Y
Sbjct: 38  LPEWNLADLYAGIGAPEVVRDLDRIDAECKAFEADYKGKLATETSNPEGGTWLAEAVRRY 97

Query: 95  ERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALL 154
           E I +L GR+ SYA L++  +   P I KFY D++ +L      L+FF LE+N +D+ ++
Sbjct: 98  EAIDDLAGRLGSYAGLAHAGDSVDPAISKFYGDVSERLTAASLHLLFFPLELNRIDDEVI 157

Query: 155 EQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF 214
           E++    P    Y  WI++ RK K + L + +E L  + SQ G  A  R F + I  LRF
Sbjct: 158 ERAMHA-PELAHYRPWIEDSRKDKPYQLEDRLEQLFHEKSQTGYSAWNRLFDQTIAGLRF 216

Query: 215 KINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWR 274
           K+  +++ +        D   E RK+A +AL+ TF  +   F+ ITNTLAKD++I DRWR
Sbjct: 217 KVGAKELAIEPTLNLLQDRSPEKRKAAGQALAKTFKANERTFALITNTLAKDKDISDRWR 276

Query: 275 KYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPL 334
            ++ +ADSRHL+N VE  V++AL+ SV+  YP+ SHRYY LK +W K   +  WDR APL
Sbjct: 277 GFQDVADSRHLNNRVEREVVDALVASVRAAYPRLSHRYYALKARWFKKKKLAHWDRNAPL 336

Query: 335 PGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIP 394
           P  +   I +  AR +VL +Y +FSP M+ IAE+FFT  WIDAP   GK  GAF+H T P
Sbjct: 337 PFAATGAISWNDARKMVLTAYDEFSPVMAGIAERFFTDRWIDAPVRPGKAPGAFSHPTTP 396

Query: 395 SVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLT 454
           S HPY+L+NY GKP+DVMTLAHELGHG+H VL+++ QG L   + LTLAETAS+FGE LT
Sbjct: 397 SAHPYVLMNYQGKPRDVMTLAHELGHGVHQVLAAK-QGALMAPTPLTLAETASVFGEMLT 455

Query: 455 FDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEI 514
           F  LL    S ++R+ LLA K+EDM+N++VRQI+FY FE  +HTE R  G++   R+ ++
Sbjct: 456 FKRLLAQTKSAKQRQALLAGKVEDMINTVVRQIAFYTFERAVHTE-RKNGELTAERLGQL 514

Query: 515 WLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVD 574
           WL  Q ESLGPA ++    Y +FWM +PHFI S FYVYAYAFG+CLVNSLY +Y  +  +
Sbjct: 515 WLSVQGESLGPAIEIK-PGYETFWMYIPHFIHSPFYVYAYAFGDCLVNSLYAVY-EHAAE 572

Query: 575 CFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            F E+YL +L AG +KHYSELL P  ++  DP FW+ GL  +  MID++E+M
Sbjct: 573 GFAERYLAMLAAGGTKHYSELLSPFGLDARDPKFWDGGLSVIAGMIDELERM 624


>gi|209884233|ref|YP_002288090.1| oligoendopeptidase, PepF/M3 family [Oligotropha carboxidovorans
           OM5]
 gi|209872429|gb|ACI92225.1| oligoendopeptidase, PepF/M3 family [Oligotropha carboxidovorans
           OM5]
          Length = 630

 Score =  483 bits (1242), Expect = e-134,   Method: Composition-based stats.
 Identities = 280/612 (45%), Positives = 388/612 (63%), Gaps = 7/612 (1%)

Query: 16  RKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNL 75
             + +S       S +    LP WNL DLY S  + EI+ D++ ++ + + F+  ++G +
Sbjct: 24  SMSAKSVAAKKSPSAK-TPKLPEWNLGDLYASITAPEIARDLDKLDADCVEFEAAYKGKI 82

Query: 76  AHATNQKNC-HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLAD 134
           A   +Q      L  A+  YE I +L GR+ SYA L +  +   P I KFY D++ +L +
Sbjct: 83  AARLSQPGAGEWLAEAVKAYEAIDDLAGRLISYAGLVHAGDTVDPAISKFYGDVSERLTN 142

Query: 135 FEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTS 194
               L+FF LE+N +D+ L+EQ+  Q P    Y  W+++IRK K + L + +E L  + S
Sbjct: 143 ASTHLLFFTLELNRIDDDLIEQAM-QVPALGYYRPWLEDIRKDKPYQLEDRIEQLFHEKS 201

Query: 195 QVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
                A  R F + I  LRFK+  +++ +        D     RK+AA+AL+ TF  +  
Sbjct: 202 TTSYGAWNRQFDQTIAGLRFKVGAKELAIEPTLNFLQDRAPAKRKTAAQALAKTFKANER 261

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
            F+ ITNTLAKD+EI DRWR ++ +ADSRHL+N VE  V++AL+ SV+  YP+ SHRYY 
Sbjct: 262 TFALITNTLAKDKEISDRWRGFQDVADSRHLANRVEREVVDALVASVRAAYPRISHRYYA 321

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           LK  W K   +  WDR APLP  +   I +  AR  VL++Y +FSP+M+ IA++FF   W
Sbjct: 322 LKASWFKKKKLPHWDRNAPLPFAAAGNIAWGDARATVLKAYGEFSPEMASIAKRFFDDRW 381

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           IDAP   GK  GAF+H T PS HPY+L+NY GKP+DVMTLAHELGHG+H VL+++  G L
Sbjct: 382 IDAPVRAGKAPGAFSHPTTPSAHPYVLMNYQGKPRDVMTLAHELGHGVHQVLAAKN-GAL 440

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
              + LTLAETAS+FGE LTF  LL    + ++R+ LLA K+EDM+N++VRQI+FY FE 
Sbjct: 441 MAPTPLTLAETASVFGEMLTFKRLLAQTKNAKQRQALLAGKVEDMINTVVRQIAFYTFER 500

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
            +HTERR    +   R+ EIWL  Q ESLGPA ++    Y +FWM +PHFI S FYVYAY
Sbjct: 501 MVHTERREGE-LTAERLGEIWLSVQGESLGPAIEIK-PGYETFWMYIPHFIHSPFYVYAY 558

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           AFG+CLVNSLY +Y+    + F E+YL +L AG +KHYSELL P  ++  DP FW+ GL 
Sbjct: 559 AFGDCLVNSLYAVYERA-AEGFAERYLAMLAAGGTKHYSELLAPFGLDAKDPTFWDGGLS 617

Query: 615 TVEKMIDDVEKM 626
            +E MID++E M
Sbjct: 618 VIEGMIDELETM 629


>gi|312880956|ref|ZP_07740756.1| oligopeptidase F [Aminomonas paucivorans DSM 12260]
 gi|310784247|gb|EFQ24645.1| oligopeptidase F [Aminomonas paucivorans DSM 12260]
          Length = 626

 Score =  482 bits (1241), Expect = e-134,   Method: Composition-based stats.
 Identities = 146/623 (23%), Positives = 261/623 (41%), Gaps = 19/623 (3%)

Query: 10  FSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKT 69
            S      +  +    ++  +  +    RW LED+YP+ ++ E   D    +      ++
Sbjct: 13  LSLWMAAASQPALASGSVPKRSEIPEPLRWKLEDIYPTDEAWE--ADYAAAKEALPRMQS 70

Query: 70  RWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDIN 129
            + G L       +   L A +   + +   +G++  YA +  + + ++P  +      +
Sbjct: 71  -FRGTLGR-----SPRDLLACLVARDDLGIRVGKLVVYATMRSHEDTANPVYQALADRAS 124

Query: 130 AKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECL 189
                  +   F   EI ++ E  L+    ++P    Y   +  + + K H+LS   E L
Sbjct: 125 TLSVQVSEAGSFVVPEILSVPEKTLQDFQTREPGLAPYRFTLSELLRQKAHVLSQPEEAL 184

Query: 190 LSDTSQVGREALKRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAK 243
           L+   +V +     F       L+F     +      +   +  K     DR+VR++A +
Sbjct: 185 LAGMGEVLQAPEGAFSMLTNADLKFPQITDEKGKTVELSEERYAKFLRSPDRKVREAAFR 244

Query: 244 ALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKN 303
            L  T+ K  +      +   K      R RKY     +    + +   V   ++ +++ 
Sbjct: 245 GLFETYGKLRNTLGATFSGAVKGSAFVARARKYPSSLAAALDGDAIPESVYHNVVDTIEK 304

Query: 304 YYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMS 363
                 HRY  L+++ L L  +  WD   PL       IP+E A + V        P   
Sbjct: 305 NLAPL-HRYMALRRRILGLAKLAPWDLYVPLVADPDREIPWERAVEQVTAGLTPLGPDYL 363

Query: 364 IIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIH 423
              +   +  W+D  +  GK SGA++ G+    HPYIL+NY G   DV TLAHELGH +H
Sbjct: 364 GDLKAGLSSQWVDVLENQGKRSGAYSWGS-YGTHPYILMNYNGTLHDVFTLAHELGHSLH 422

Query: 424 FVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSI 483
              S+ +Q       +  +AE AS   E L  D LL+ A  +  +  LL  ++E +  ++
Sbjct: 423 SFYSNRSQPYADAGYTTFVAEVASTTNEALLLDHLLREARDQNTKLFLLNQRLEQIRTTV 482

Query: 484 VRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPH 543
            RQ  F  FE  +H    +   +    + ++W +  +   GP  ++  L  G  W  +PH
Sbjct: 483 YRQALFASFERTVHRRVEAGEALTPEDLGKLWHQLNERYYGPDLEVDPLLDG-EWSRIPH 541

Query: 544 FIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINL 603
           F  S FYV+ YA G     SL    +       +++YL++L  G S H  +LL    +++
Sbjct: 542 FY-SPFYVFQYATGYAAATSLSRQIQKGGEPA-RKRYLHMLTRGGSAHPIDLLRDAGVDM 599

Query: 604 SDPNFWERGLQTVEKMIDDVEKM 626
           + P      L+  E+ +D  E++
Sbjct: 600 ATPQPLLDTLRVFEETLDAFEEL 622


>gi|154252499|ref|YP_001413323.1| pepF/M3 family oligoendopeptidase [Parvibaculum lavamentivorans
           DS-1]
 gi|154156449|gb|ABS63666.1| oligoendopeptidase, pepF/M3 family [Parvibaculum lavamentivorans
           DS-1]
          Length = 614

 Score =  482 bits (1241), Expect = e-134,   Method: Composition-based stats.
 Identities = 269/613 (43%), Positives = 392/613 (63%), Gaps = 7/613 (1%)

Query: 16  RKALRSSDMTTMDSQENL-GNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGN 74
             +  +S ++    Q+ L G LP WNL DLY + D+ E+  D+      + AF   ++G 
Sbjct: 6   PVSAPASSVSNAKDQQELLGELPVWNLGDLYSAPDAPEVKADLRWAAEAAAAFNKLYKGR 65

Query: 75  LAHATNQ-KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA 133
           +       +    + AA+  YE I + +GR+ S+A L Y  +  +P   KFY D+  ++ 
Sbjct: 66  IGALAAAPEGGKEIAAALKAYEEIEDKLGRLISFAGLLYAQDSVNPAYAKFYGDMQGQIT 125

Query: 134 DFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDT 193
                L+FFALE+N +++ +L ++  +DP    Y+ W++++R ++ + LS+++E LL + 
Sbjct: 126 TISTDLLFFALELNRVEDDVLAKAL-EDPALGHYAPWLRDLRAMRPYQLSDELETLLHEK 184

Query: 194 SQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSS 253
           S  G  A  R F E +  L F+++ + + +  A     D D   R+ AA AL+ TF  ++
Sbjct: 185 SLTGHAAWNRLFDETMARLTFEVDSETLTVEGALHLLSDHDAAKREVAAHALAKTFKANT 244

Query: 254 HIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY 313
            +F+ ITNTLAKD+EI+DR R ++ IA SRH++N VEP V+EAL+ +V+  YP  SHRYY
Sbjct: 245 PLFTLITNTLAKDKEIEDRLRGFDDIAQSRHIANRVEPEVVEALVDAVRRAYPDLSHRYY 304

Query: 314 ELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHN 373
            +K KWL LD + +WDR APLP +   +IP+  ARD VL +Y  F+P M+ IA +FF   
Sbjct: 305 AMKAKWLGLDRLEYWDRNAPLPHSDDAVIPWNQARDTVLDAYRGFTPDMAKIAGQFFDKG 364

Query: 374 WIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGI 433
           WIDAP   GK +GAFAH T+PS HPY+L+NY GK +DVMTLAHELGHG+H VL+++ QG 
Sbjct: 365 WIDAPMRAGKATGAFAHPTVPSAHPYVLVNYQGKTRDVMTLAHELGHGVHQVLAAK-QGP 423

Query: 434 LTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFE 493
           L  ++ LTLAETAS+FGE LTF  LL  A +KE RK +LA+K+EDMLN++VRQ +FY FE
Sbjct: 424 LMADTPLTLAETASVFGEMLTFRKLLAGAQTKERRKAMLASKVEDMLNTVVRQTAFYTFE 483

Query: 494 LKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYA 553
            ++HT RR    + +  I  IWL+ Q ESLGPA  L +  Y ++W  + HFI + FYVYA
Sbjct: 484 RRVHTARREGE-LTSEDIGRIWLDVQGESLGPAIHLGE-GYETYWCYISHFIHAPFYVYA 541

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YAFG+CLVNSLY +Y+    + F E+Y  +L AG +  + ELL P  ++ SDP FW++GL
Sbjct: 542 YAFGDCLVNSLYAVYEQA-QEGFAERYFEMLSAGGTLRHKELLAPFGLDASDPAFWDKGL 600

Query: 614 QTVEKMIDDVEKM 626
             +   ID++E M
Sbjct: 601 SMIRGFIDELEAM 613


>gi|304393276|ref|ZP_07375204.1| PepF/M3 family oligoendopeptidase [Ahrensia sp. R2A130]
 gi|303294283|gb|EFL88655.1| PepF/M3 family oligoendopeptidase [Ahrensia sp. R2A130]
          Length = 602

 Score =  482 bits (1241), Expect = e-134,   Method: Composition-based stats.
 Identities = 280/606 (46%), Positives = 390/606 (64%), Gaps = 10/606 (1%)

Query: 21  SSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
           ++  +++ +   LGNLP WNL DLYP   S E   D +    ++  F+ +++  LA    
Sbjct: 4   ANTASSVKT--ELGNLPEWNLNDLYPGMQSVEFKLDFDAAVPDAQGFEAQYKDKLAAL-- 59

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
             +   L  A+A YE++ E +GR+ SYA L Y  + S P   KFY D+  +L      L+
Sbjct: 60  --SGDELAEALAAYEQLEERLGRVISYAGLIYAGDSSDPANAKFYGDVQERLTMAGGHLL 117

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           FF LE+N + EA +E++ A       Y  W+ ++R  K + L   +E L  + S  G  A
Sbjct: 118 FFGLELNAIKEAHMEKALAGSAALAHYRPWLTDLRLDKPYQLDAKLEQLFLEKSSTGAGA 177

Query: 201 LKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFIT 260
             R F E + +LRF +  +++ +        D D  +RK+A+ AL+ TF  +  +F+ IT
Sbjct: 178 FNRLFDETMSALRFDVKGEELAIEPTLNLLQDKDGTMRKAASDALAKTFGDNIRLFTLIT 237

Query: 261 NTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWL 320
           NTLAKD++I D WR +E +AD RHL+N VE  V+ AL+ +V++ +P+ SHRYY +K KW+
Sbjct: 238 NTLAKDKQIGDTWRGFEDVADGRHLANRVERQVVGALVDAVEDAFPRISHRYYAMKAKWM 297

Query: 321 KLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQY 380
            +D +  WDR APLP  S   I ++ ARD VL +Y  F+P+M+ IA  FF HNWIDAP  
Sbjct: 298 GMDQLNHWDRNAPLPIASTRSIKWDEARDTVLDAYRGFAPEMATIAADFFDHNWIDAPVR 357

Query: 381 DGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSL 440
            GK  GAFAH T+PS HPY+LLNY GKP+DVMTLAHELGHG+H VL+   QG L  ++ L
Sbjct: 358 PGKSPGAFAHPTVPSAHPYVLLNYQGKPRDVMTLAHELGHGVHQVLAGR-QGALMASTPL 416

Query: 441 TLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTER 500
           TLAETAS+FGE LTF SLL+ A S  ERK +LA K+EDM+N++VRQI+FY FE K+H ER
Sbjct: 417 TLAETASVFGEMLTFRSLLEQAKSPTERKAMLAAKVEDMINTVVRQIAFYMFERKVHEER 476

Query: 501 RSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCL 560
           R+   + T +IN  W+  Q+ SLGP+  L +  Y  FW  VPHFI S FYVYAYAFG+CL
Sbjct: 477 RNGE-LTTDQINAAWMSVQESSLGPSVKLGE-GYERFWTYVPHFIHSPFYVYAYAFGDCL 534

Query: 561 VNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMI 620
           VNSLY +Y+ N  D F++KY  +L+AG +KH+SELL P  ++ SDP FW +GL  +E +I
Sbjct: 535 VNSLYAVYQ-NAEDGFQDKYFEMLKAGGTKHHSELLAPFGLDASDPAFWGKGLAVIEGLI 593

Query: 621 DDVEKM 626
           D++E +
Sbjct: 594 DELEAL 599


>gi|150397882|ref|YP_001328349.1| pepF/M3 family oligoendopeptidase [Sinorhizobium medicae WSM419]
 gi|150029397|gb|ABR61514.1| oligoendopeptidase, pepF/M3 family [Sinorhizobium medicae WSM419]
          Length = 627

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 295/596 (49%), Positives = 403/596 (67%), Gaps = 4/596 (0%)

Query: 31  ENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAA 90
             LG+LP W L DLY S  S+E  +D+   E +++AF+ +W+G L  A  +     LGAA
Sbjct: 33  AELGDLPSWRLTDLYLSPSSEEFRSDLARAEADAVAFEAKWKGKLDQAAGRTGDEGLGAA 92

Query: 91  IAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLD 150
           + E+E + +L+GRIAS+A L+Y  + S+P   K Y DI +KL D    L+FF+LE+N +D
Sbjct: 93  VNEFEALDDLMGRIASFAGLTYFSDTSNPANGKLYGDIQSKLTDISAHLLFFSLELNRID 152

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIE 210
           +  ++ + A D L   Y+ WI ++RK K + L + +E L  + +  G  A  R F E I 
Sbjct: 153 DKRVDAALAADGLAAHYAPWILDLRKDKPYQLDDRLEQLFLEKTMTGANAFNRLFDETIA 212

Query: 211 SLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
           SL F ++ ++ PL        DS  EVR+ AA AL+ TF  +   F+ +TNTLAKD+EI 
Sbjct: 213 SLTFSVDGKEQPLEVTLNLLQDSSVEVRRKAALALAETFKANIRTFTLVTNTLAKDKEIS 272

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
           DRWR +E IADSRHL+N VE  V++AL  SVK  YP+ SHRYY +K KWL ++ M FWDR
Sbjct: 273 DRWRGFEDIADSRHLANRVEREVVDALAASVKAAYPRLSHRYYAMKAKWLGMEQMDFWDR 332

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
            APLP T   +IP+  ARD VL +Y  F+P+M+ IA +FF   WIDAP   GK  GAFAH
Sbjct: 333 NAPLPETPNALIPWNDARDTVLSAYHAFAPEMASIARRFFDDGWIDAPVRPGKAPGAFAH 392

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
            T+PSVHPY+L+NY+GKP+DVMTLAHELGHG+H VL+   QG L  ++ LTLAETAS+FG
Sbjct: 393 PTVPSVHPYVLVNYMGKPRDVMTLAHELGHGVHQVLAGA-QGALMASTPLTLAETASVFG 451

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E LTF +LL     + ERK +LA K+EDM+N++VRQI+FYDFE K+HT  R  G++    
Sbjct: 452 EMLTFRALLDRTKDRRERKAMLAQKVEDMINTVVRQIAFYDFERKVHTA-RKEGELTAED 510

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
           +  IW+  Q ESLGPA  LS+  Y ++W  +PHFI S FYVYAYAFG+CLVNSLY +Y+ 
Sbjct: 511 LGRIWMSVQSESLGPAIRLSE-SYETYWAYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQ- 568

Query: 571 NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           N    F+EKY ++L+AG +KH+SELL P  ++ +DP+FW +GL  +E +ID++E +
Sbjct: 569 NAERGFQEKYFDMLKAGGTKHHSELLAPFGLDAADPSFWAQGLSMIEGLIDELEAL 624


>gi|46202296|ref|ZP_00053453.2| COG1164: Oligoendopeptidase F [Magnetospirillum magnetotacticum
           MS-1]
          Length = 595

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 270/603 (44%), Positives = 391/603 (64%), Gaps = 8/603 (1%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           MT +   ++LG LP W+L DLYP+ DS E+  D++  +  + AF+T + G LA     + 
Sbjct: 1   MTFVAPADDLGTLPEWDLSDLYPAPDSPELEADLQAADSAAQAFETTYAGRLAGLPGPE- 59

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
               GAAIAE+ERI ++I R  SYA L Y+ ++S     +FY  +  ++       +FF 
Sbjct: 60  ---FGAAIAEWERIGQIIYRAMSYAQLLYSGDVSDSERGRFYQGMQERVTGITSHTLFFT 116

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
           LEIN LD+A+L +     P    Y++W+++ R  + H LS++ E +L +   VG  A  R
Sbjct: 117 LEINRLDDAVLAEKLKA-PAAAHYASWLRDTRMFRPHQLSDEAEKMLHELHVVGTAAWNR 175

Query: 204 FFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTL 263
            F E +  LRF ++ +++   +      D D   RK+AAK+L      ++ +F+ ITNTL
Sbjct: 176 LFDETMARLRFPLDGKEVTSAEVLNCLSDKDGARRKAAAKSLGKVLGDNAPLFALITNTL 235

Query: 264 AKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLD 323
           AK++EI+D+WR Y +    R+LSN VE  V++AL+++VK  +P+ SHRYY+LK KW  +D
Sbjct: 236 AKEKEIEDKWRNYARPQSFRNLSNQVEDGVVDALVEAVKGCFPQLSHRYYKLKAKWFGVD 295

Query: 324 TMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGK 383
            + +WDR APLP        +E ARD VL +Y  FSP M+ + ++FF +NWIDAP   GK
Sbjct: 296 VLDYWDRNAPLPDDDDRKYTWEQARDTVLGAYGAFSPDMAALGKRFFDNNWIDAPVRPGK 355

Query: 384 GSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLA 443
             GAFAH T+P+VHPY+L+N+LGK +DVMTLAHELGHG+H VL+S+ +G+L +++ LTLA
Sbjct: 356 SPGAFAHPTVPAVHPYLLVNFLGKSRDVMTLAHELGHGVHQVLASD-KGLLMSDTPLTLA 414

Query: 444 ETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRST 503
           ETAS+FGE LTF ++L   +S + R+I+LA+K+EDMLN++VRQ++FY FE  LH ERR  
Sbjct: 415 ETASVFGEMLTFRAMLARETSPKSRRIMLASKVEDMLNTVVRQVAFYQFESLLHDERRRG 474

Query: 504 GDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNS 563
             +   RI E+W+  Q +SLGPA    D EY  FW  +PHF+ S FYVYAYAFG+CLVNS
Sbjct: 475 E-LSPERIGELWMSVQADSLGPALRFDD-EYRHFWTYIPHFVHSPFYVYAYAFGDCLVNS 532

Query: 564 LYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDV 623
           LY ++    +  F  KYL++LRAG +  + +LL P  ++  DP FW +GL  V   ID++
Sbjct: 533 LYSVHAKGGIADFPAKYLDMLRAGGTLRHQDLLAPFGLDAGDPQFWRQGLDVVIGFIDEL 592

Query: 624 EKM 626
           E M
Sbjct: 593 EAM 595


>gi|300024141|ref|YP_003756752.1| oligoendopeptidase, pepF/M3 family [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299525962|gb|ADJ24431.1| oligoendopeptidase, pepF/M3 family [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 615

 Score =  481 bits (1238), Expect = e-133,   Method: Composition-based stats.
 Identities = 273/596 (45%), Positives = 382/596 (64%), Gaps = 9/596 (1%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           LG +P W+L DLY + D+ E+  D++    E+   KT ++G LA     K+   L  AI 
Sbjct: 26  LGAMPEWDLSDLYAAPDAPEVQRDLKAAAKEAARIKTAYQGRLADLA--KDGGKLAGAIK 83

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
           +YE++ +L+G++ SY+ L Y  + + P   KF  D++  L      LIFF LE+N +D+A
Sbjct: 84  DYEKLSDLVGKLGSYSGLYYVLDQTDPVRAKFNGDVSEALTKLYTDLIFFELELNQIDDA 143

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
            ++ +        +Y  W++++RK K H L   +E L ++ SQ  R A  R F E + +L
Sbjct: 144 TMDGALKHK-DVKRYKPWLEDLRKEKPHQLDEKLERLFTEKSQTSRSAWNRLFDETMSAL 202

Query: 213 RFKINDQ--KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
           +F +  +   + L          D + RK+A++ALS  F  +  +F+ ITNTLAKD+EI 
Sbjct: 203 KFDVKGEKTPLTLEPTLNFLSSPDEKKRKAASEALSKVFKANLPLFTLITNTLAKDKEIS 262

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
           DRWR ++ +ADSR+L+N VE  V++AL+ SV+  YP+ SHRYY +K KWL    +  WDR
Sbjct: 263 DRWRNFKDVADSRNLANRVEGPVVDALVTSVRAAYPQLSHRYYAMKAKWLGKKKLASWDR 322

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
            APLP   +  I +  A  +VL++Y  F+P+M+ IA++FF  NWIDA    GK  GAF+ 
Sbjct: 323 NAPLPDKPERTITWAEAEKIVLKAYGNFAPEMATIAKQFFDKNWIDAAVKPGKAPGAFSA 382

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
            T+PSVHPY+++NYLGKP+DVMTLAHELGHG+H  L+   QG L   + LTLAETAS+FG
Sbjct: 383 STVPSVHPYVMMNYLGKPRDVMTLAHELGHGVHQWLA-RAQGPLLAPTPLTLAETASVFG 441

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E LTF ++L     K ERK ++A K+EDMLN++VRQ++FY FE K+H ERR    + + R
Sbjct: 442 EMLTFKAILAETKDKRERKAMIAGKVEDMLNTVVRQVAFYTFERKVHEERRQGE-LTSDR 500

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
           IN IWLE Q ESLGPA +L    Y  FW  VPHFI S FYVYAYAFG+CLVNSLY +Y  
Sbjct: 501 INAIWLEIQGESLGPAIELK-PGYEVFWTYVPHFIHSPFYVYAYAFGDCLVNSLYGLYAE 559

Query: 571 NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
                F  KY ++L+AG SKH+SELL P  ++  DP FW +GL+ +E MID++E M
Sbjct: 560 AH-PGFVAKYFDLLKAGGSKHHSELLAPFGLDARDPEFWNKGLKVIEGMIDELETM 614


>gi|114764930|ref|ZP_01444103.1| oligoendopeptidase F [Pelagibaca bermudensis HTCC2601]
 gi|114542642|gb|EAU45666.1| oligoendopeptidase F [Roseovarius sp. HTCC2601]
          Length = 608

 Score =  481 bits (1238), Expect = e-133,   Method: Composition-based stats.
 Identities = 265/609 (43%), Positives = 379/609 (62%), Gaps = 10/609 (1%)

Query: 18  ALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAH 77
                D      + +LG LP W+L DLY   D+ E+  D++ +E     F   +EG +A 
Sbjct: 8   PRPVFDANASGGR-DLGKLPEWDLSDLYEGQDAPELKRDLDWLEDACARFAQDFEGKIAG 66

Query: 78  ATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEK 137
                +       +  +E+I  + GR+ S+A L Y  N       KF +D+  K+  +  
Sbjct: 67  L----DAAGFLEMVQRHEKIEAVGGRLMSFAGLRYYQNTMDSERAKFLSDLQEKVTIYTT 122

Query: 138 VLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVG 197
            L+FF+LE+NT+++      +  +    +Y      IR +K + LS+++E  L D   VG
Sbjct: 123 PLVFFSLELNTVEDDAYSALFEANDELARYKPAFDRIRAMKPYQLSDELERFLHDMGVVG 182

Query: 198 REALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
            +A  + F E I  L F I+ +++ +  A     + DR  R++AA+ L+  F ++   F+
Sbjct: 183 -DAWMKLFDETIAGLTFTIDGEEMSIEAALNFLTEQDRSKREAAARELARVFGENIRTFA 241

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
            + NT AK++E+ DRWR        RHLSN+VEP V+EAL  +V   YP+ SHRYYELK+
Sbjct: 242 RVHNTQAKEKEVMDRWRGMPSAQMGRHLSNDVEPEVVEALRDAVVAAYPRLSHRYYELKR 301

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           KWL L+TM  WDR APLP  S  I+ ++ ARD V+Q+YA F P+M+ IA  FF   WIDA
Sbjct: 302 KWLGLETMQVWDRNAPLPMESTRIVGWDEARDTVMQAYAGFDPRMAEIAAPFFDKGWIDA 361

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
               GK  GAFAH T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG +  +
Sbjct: 362 GVKPGKAPGAFAHPTVTDVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGEMLAS 420

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
           + LTLAETAS+FGE LTF ++L  A+  +ERK+LLA K+EDM+N++VRQI+FYDFE KLH
Sbjct: 421 TPLTLAETASVFGEMLTFRAMLDKATDPKERKVLLAGKVEDMINTVVRQIAFYDFECKLH 480

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
             RR  G++    IN +W+  Q ESLGP F+  +  Y SFW  +PHF+ S FYVYAYAFG
Sbjct: 481 EARR-GGELTPDDINALWMSVQAESLGPCFEFME-GYESFWAYIPHFVHSPFYVYAYAFG 538

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
           + LVN+LY +Y+ +    F++KY ++L+AG SKH+  LL P  ++ SDP FW++GL  +E
Sbjct: 539 DGLVNALYAVYQEDPA-GFEDKYFDMLKAGGSKHHKALLAPFGLDASDPRFWDKGLSMIE 597

Query: 618 KMIDDVEKM 626
             ID++E M
Sbjct: 598 GFIDELEAM 606


>gi|163797405|ref|ZP_02191357.1| hypothetical protein BAL199_28785 [alpha proteobacterium BAL199]
 gi|159177324|gb|EDP61881.1| hypothetical protein BAL199_28785 [alpha proteobacterium BAL199]
          Length = 603

 Score =  481 bits (1237), Expect = e-133,   Method: Composition-based stats.
 Identities = 275/595 (46%), Positives = 390/595 (65%), Gaps = 9/595 (1%)

Query: 31  ENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAA 90
            +LG LP W+L DLYP  DS E++ D++  E ++ AF+ R+ G +A      +   LG A
Sbjct: 6   ADLGPLPSWDLADLYPGPDSPELARDLDRCEADAKAFRDRYAGKVAGL----SGTDLGRA 61

Query: 91  IAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLD 150
           IA YE + E++GR+ S+A L Y  ++S P + KFY  +  ++      L+FF LEIN ++
Sbjct: 62  IATYEAMDEILGRVMSFAHLMYAGDMSDPNVGKFYQSMQERVNAISTELLFFTLEINRIE 121

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIE 210
           EA LE   A  P    +  W+++ R  ++H LS+D+E LL +    GR A  R F E + 
Sbjct: 122 EADLEAKLAA-PELAHFRPWLRDTRAFREHQLSDDLEKLLHEKYVAGRAAWTRLFDETMA 180

Query: 211 SLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
            LRF ++ +++   +      + D  VR+ AA+ L     ++  +F+ ITNTLAKD++I 
Sbjct: 181 RLRFPMDGKELTTAEVLDRLSNRDGTVRRKAAQVLGEVLGRNVGLFALITNTLAKDKQID 240

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
           D+WR+Y K    R+L+N VE  V+EAL+ +V+  Y + SHRYY LK +W  ++T+ +WDR
Sbjct: 241 DKWRRYTKPISLRNLANQVEDEVVEALVTAVRGKYGRLSHRYYRLKARWFGVETLDYWDR 300

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
            APLP      IP+  ARD VL +YA FSP+++ + ++FF + WIDAP   GK SGAFAH
Sbjct: 301 NAPLPEDDDAQIPWSEARDTVLDAYAGFSPRLAEVGKQFFDNAWIDAPTRPGKASGAFAH 360

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
            T+PS HPY+LLNY GK +DVMTLAHELGHG+H VL+   QG L  ++ LTLAETAS+FG
Sbjct: 361 PTVPSAHPYLLLNYQGKTRDVMTLAHELGHGVHQVLAGR-QGQLMCDTPLTLAETASVFG 419

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E LTF +LL+  S    R+++LA+K+EDMLN++VRQI+F+ FE ++H ERRS   +   R
Sbjct: 420 EMLTFQALLKKRSDPVGRRVMLASKVEDMLNTVVRQIAFHCFETRVHDERRSGE-LTPER 478

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
           + EIW+E Q ESLGPAF   D  Y +FW  +PHF+ S FYVYAYAFG+CLVNSLY +++ 
Sbjct: 479 LGEIWMEIQVESLGPAFRYDD-GYKAFWSYIPHFVHSPFYVYAYAFGDCLVNSLYAVFQ- 536

Query: 571 NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEK 625
                F +KYL +L AG +K + ELL P  ++ SDP FW++GL  VE MID++E 
Sbjct: 537 GAEAGFADKYLEMLSAGGTKRHKELLAPFGLDASDPAFWDKGLGLVESMIDELES 591


>gi|254477078|ref|ZP_05090464.1| oligoendopeptidase F [Ruegeria sp. R11]
 gi|214031321|gb|EEB72156.1| oligoendopeptidase F [Ruegeria sp. R11]
          Length = 614

 Score =  480 bits (1236), Expect = e-133,   Method: Composition-based stats.
 Identities = 275/594 (46%), Positives = 383/594 (64%), Gaps = 9/594 (1%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           LGNLP W+L DLY S D+ E+  D+  +E E  AF   +EG LA      +   L + + 
Sbjct: 28  LGNLPEWDLSDLYTSEDAAELVRDLAWLEKECAAFAADYEGKLAEL----DADGLLSCVL 83

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
             E+I  + GRI S+A L Y    +     KF +D+  K+  F   L+FF LEIN +++ 
Sbjct: 84  RNEKINAIAGRIMSFAGLRYYQLTTDAGRAKFMSDMQEKITIFTTPLVFFTLEINRIEDN 143

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
            LE  +A +    +Y      IR +K + LS+++E  L D   VG +A +R F E I  L
Sbjct: 144 QLEAHFAANSDLARYKPVFDRIRAMKPYQLSDELEKFLHDLGVVG-DAWERLFDETIAGL 202

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
            F ++ +++ +        + DR  R++AA+ L+H F  +  IF+ + NT AK++EI DR
Sbjct: 203 SFTVDGEELNIEGTLNLLTEQDRSKREAAARELAHVFADNIKIFARVHNTQAKEKEILDR 262

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR        RHLSN+VEP V+EAL ++V   YPK SHRYYELK+KWL LD M  WDR A
Sbjct: 263 WRGMPSPQMGRHLSNHVEPEVVEALREAVVAAYPKLSHRYYELKRKWLGLDRMQVWDRNA 322

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP  +  ++ +  ARD+V+++Y  F P+M  IA+ FF   WIDA    GK  GAFAH T
Sbjct: 323 PLPMETSRVVNWTEARDIVMEAYNAFDPRMGEIADPFFNKGWIDAGVKPGKAPGAFAHPT 382

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +  VHPY++LNYLGKP+DVMTLAHELGHG+H VL++E QG + +++ LTLAETAS+FGE 
Sbjct: 383 VTDVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAE-QGEMLSSTPLTLAETASVFGEM 441

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF  +L+ A  + ERKILLA K+EDM+N++VRQI+FYDFE KLH   R+ G++    IN
Sbjct: 442 LTFRKMLEKAKDQNERKILLAGKVEDMINTVVRQIAFYDFECKLHAA-RAEGELTPDDIN 500

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
            +W+  Q ESLG AFD  +  Y +FW  +PHF+ S FYVYAYAFG+ LVN+LY +Y +  
Sbjct: 501 ALWMSVQAESLGEAFDFME-GYETFWAYIPHFVHSPFYVYAYAFGDGLVNALYSVY-AEG 558

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + F++KY ++L+AG SKH+ ELL P  ++ SDP FW++GL  +  MID++E M
Sbjct: 559 AEGFEDKYFDMLKAGGSKHHKELLAPFGLDASDPTFWDKGLSMISDMIDELEAM 612


>gi|163738506|ref|ZP_02145921.1| Peptidase M3B, oligoendopeptidase-related clade 3 [Phaeobacter
           gallaeciensis BS107]
 gi|161388427|gb|EDQ12781.1| Peptidase M3B, oligoendopeptidase-related clade 3 [Phaeobacter
           gallaeciensis BS107]
          Length = 614

 Score =  480 bits (1236), Expect = e-133,   Method: Composition-based stats.
 Identities = 274/594 (46%), Positives = 383/594 (64%), Gaps = 9/594 (1%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           LGNLP W+L DLY S ++ E+  D+  ++ E  +F   +EG LA      +   L   + 
Sbjct: 28  LGNLPEWDLSDLYTSENASELERDLAWLDGECASFAADYEGKLADL----DADGLLTCVL 83

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
             E+I  + GRI S+A L Y    +     KF +D+  K+  F   L+FF LEIN L++A
Sbjct: 84  RNEKINAIAGRIMSFAGLRYYQLTTDAGRAKFMSDMQEKITIFTTPLVFFTLEINRLEDA 143

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
           +LE  +A +    +Y      IR +K + LS+++E  L D   VG +A +R F E I  L
Sbjct: 144 VLESHFAANSDLARYKPIFDRIRAMKPYQLSDELEKFLHDLGVVG-DAWERLFDETIAGL 202

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
            F ++ +++ +        + DR  R++AA+ L+  F+ +  IF+ + NT AK++EI DR
Sbjct: 203 TFTVDGEELNIEGTLNLLTEQDRSKREAAARELARVFSDNIKIFARVHNTQAKEKEILDR 262

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR        RHLSN+VEP V+EAL ++V + YPK SHRYYELK+KWL LD M  WDR A
Sbjct: 263 WRGMPSPQMGRHLSNHVEPEVVEALREAVVSAYPKLSHRYYELKRKWLGLDRMQVWDRNA 322

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP  +   + ++ AR +V+ +Y+ F P+M  +AE FF   WIDA    GK  GAFAH T
Sbjct: 323 PLPMETSRTVNWDEARKMVMDAYSAFDPRMGDLAEPFFDKGWIDAAVKPGKAPGAFAHPT 382

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +  VHPY++LNYLGKP+DVMTLAHELGHG+H VL+++ QG + +++ LTLAETAS+FGE 
Sbjct: 383 VTDVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAD-QGEMLSSTPLTLAETASVFGEM 441

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF  +L+ A  K ERKILLA K+EDM+N++VRQI+FYDFE KLH   R+ G++    IN
Sbjct: 442 LTFRKMLENAKDKTERKILLAGKVEDMINTVVRQIAFYDFECKLHAA-RAEGELTPDDIN 500

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
            +W+  Q ESLG AFD  D  Y +FW  VPHF+ S FYVYAYAFG+ LVN+LY +Y +  
Sbjct: 501 ALWMSVQAESLGEAFDFMD-GYETFWTYVPHFVHSPFYVYAYAFGDGLVNALYSVY-AEG 558

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + F++KY  +L+AG SKH+ ELL P  ++ SDP FW++GL  +  MID++E M
Sbjct: 559 AEGFEDKYFEMLKAGGSKHHKELLAPFGLDASDPTFWDKGLSMISDMIDELEAM 612


>gi|323137997|ref|ZP_08073071.1| oligoendopeptidase, pepF/M3 family [Methylocystis sp. ATCC 49242]
 gi|322396716|gb|EFX99243.1| oligoendopeptidase, pepF/M3 family [Methylocystis sp. ATCC 49242]
          Length = 611

 Score =  480 bits (1235), Expect = e-133,   Method: Composition-based stats.
 Identities = 272/592 (45%), Positives = 378/592 (63%), Gaps = 6/592 (1%)

Query: 36  LPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCH-SLGAAIAEY 94
           LP WNL DLYP  DS ++ +D+     E   F   + G LA      +   +LG A+A Y
Sbjct: 22  LPEWNLADLYPGTDSPQLKSDLARAATEVAQFGKDYRGRLAEMATGADASVALGKALARY 81

Query: 95  ERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALL 154
           E + +L+GR+ S+A L Y+ + + P   KFY D+  K+ +    L+FF LE+N LD+  L
Sbjct: 82  EALQDLLGRLMSFAGLLYSGDTTDPARAKFYGDVQEKVTNASAQLLFFQLELNRLDDETL 141

Query: 155 EQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF 214
             +  ++PL   +  W+++IRK K + L + +E L  +    G  A  R F E I SLRF
Sbjct: 142 MAAAGKEPLLR-WRPWLEDIRKEKPYELEDKLEELFHEKYISGAAAWNRLFDETIASLRF 200

Query: 215 KINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWR 274
           K+  +++ +        D +   RK AA A+  T   +  +FS ITNTLAKD+EI DRWR
Sbjct: 201 KVGGEELAIEPVLNLMQDPNEAKRKEAALAIGATLKANQRVFSLITNTLAKDKEISDRWR 260

Query: 275 KYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPL 334
            +E +ADSRHLSN VE  V+EAL ++V++ +P+ SHRYY LK KW   D + +WDR APL
Sbjct: 261 GFEDVADSRHLSNRVEREVVEALAKAVEDAHPRLSHRYYRLKAKWFGKDALDYWDRSAPL 320

Query: 335 PGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIP 394
           P T   +  +  AR +VL +Y  F+P+M+ IA  FF   WIDAP   GK  GAF+H T+P
Sbjct: 321 PATPSKLYTWPEARAIVLGAYKGFAPRMAQIAGDFFDKKWIDAPVRPGKAPGAFSHPTVP 380

Query: 395 SVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLT 454
           S HPY+LLN+ GK +DVMTLAHELGHG+H VL++  QG L   + LTLAETAS+FGE LT
Sbjct: 381 SAHPYVLLNFQGKTRDVMTLAHELGHGVHQVLAAR-QGALMAPTPLTLAETASVFGEMLT 439

Query: 455 FDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEI 514
           F +LL  A+ K +R+ LLA+K+EDM+N++VRQ++FY FE K+HTERR+   +   +I ++
Sbjct: 440 FRALLAQATDKNQRRALLASKVEDMINTVVRQMAFYAFERKVHTERRNGE-LTADQICDL 498

Query: 515 WLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVD 574
           W+  Q ESLGP+  L    Y  FW  +PHFI S FYVYAYAFG+CLVNSLY +Y+    +
Sbjct: 499 WMSVQAESLGPSIRL-GPGYECFWAYIPHFIHSPFYVYAYAFGDCLVNSLYGVYQKAH-E 556

Query: 575 CFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            F E+Y  +L AG +K Y+ELL P  ++  DP FW  GL+ +E +I ++E M
Sbjct: 557 GFAERYFALLEAGGAKPYNELLKPFGLDARDPAFWNIGLEMIEGLIAELEAM 608


>gi|13472641|ref|NP_104208.1| oligoendopeptidase F [Mesorhizobium loti MAFF303099]
 gi|14023387|dbj|BAB49994.1| oligoendopeptidase F [Mesorhizobium loti MAFF303099]
          Length = 612

 Score =  480 bits (1235), Expect = e-133,   Method: Composition-based stats.
 Identities = 293/596 (49%), Positives = 398/596 (66%), Gaps = 4/596 (0%)

Query: 31  ENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAA 90
             LG+LP WNL DLY   ++ E+  D+     +++AF+TRW+G LA    +     LG A
Sbjct: 19  AELGDLPEWNLADLYAGMEAPELKRDIAKAAADAIAFETRWKGTLAAEAGRGGAGKLGEA 78

Query: 91  IAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLD 150
           +  YE + ELIGRI SYA L Y  N + P   K Y DI  K+ D    L+FFALE+N +D
Sbjct: 79  LVAYEALEELIGRIVSYAGLVYAGNTADPQRAKLYGDIQEKMTDASAHLLFFALELNLID 138

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIE 210
           +A +E +   D     Y  W+ ++R  K + L + +E L  + S  GR A  R F E + 
Sbjct: 139 DAAIESALTSDSAFGHYRPWVLDLRMDKPYQLEDRVEQLFHEKSITGRGAWNRLFDETMT 198

Query: 211 SLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
            LRF +  +++ L  A     D+  EVR+ A++AL+ TF K+   F+ ITNTLAKD+EI 
Sbjct: 199 DLRFDVEGEELTLEPALNRLQDAYGEVRRRASEALAATFRKNLRTFTLITNTLAKDKEIS 258

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
           DRWR +E IADSRHL+N VE  V++AL  +V+  YP+ SHRYY +K +WL +D M  WDR
Sbjct: 259 DRWRGFEDIADSRHLANRVERGVVDALATAVREAYPRLSHRYYAMKARWLGMDVMNHWDR 318

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
            APLP T Q +I ++ AR+ VL +Y +FSP+M+ IA  FF  NWIDAP   GK  GAFAH
Sbjct: 319 NAPLPETPQAVIGWDEARNTVLSAYQRFSPEMAEIARTFFDRNWIDAPVRPGKSPGAFAH 378

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
            T+PS HPY+LLNY+GKP+DVMTLAHELGHG+H VL++  QG L  ++ LTLAETAS+FG
Sbjct: 379 PTVPSAHPYVLLNYMGKPRDVMTLAHELGHGVHQVLAA-GQGALMASTPLTLAETASVFG 437

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E LTF SLL+  + + ERK +LA K+EDM+N++VRQI+FY+FE K+H ERR+   + + R
Sbjct: 438 EMLTFRSLLEQTTDRRERKAMLAQKVEDMINTVVRQIAFYEFERKVHAERRNGE-LTSDR 496

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
           + + WLE Q ESLGPA  L +  Y  FW  +PHFI S FYVYAYAFG+CLVNSLY +Y+ 
Sbjct: 497 LGQFWLEVQAESLGPAIKLRE-GYEVFWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQ- 554

Query: 571 NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           N    F++KY  +LRAG +KH+S+LL P  ++ +DP FW+ GL  +  +ID++E +
Sbjct: 555 NAERGFQDKYFEMLRAGGTKHHSQLLAPFGLDATDPAFWQIGLGVISGLIDELETL 610


>gi|77462970|ref|YP_352474.1| oligoendopeptidase F [Rhodobacter sphaeroides 2.4.1]
 gi|77387388|gb|ABA78573.1| Oligoendopeptidase F [Rhodobacter sphaeroides 2.4.1]
          Length = 606

 Score =  480 bits (1235), Expect = e-133,   Method: Composition-based stats.
 Identities = 275/613 (44%), Positives = 374/613 (61%), Gaps = 10/613 (1%)

Query: 14  FFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEG 73
                    D         LGNLP W+L DLYP+ D  E  +DM  ++     F   +EG
Sbjct: 2   TLPLPRPVFDANASAGG--LGNLPDWDLRDLYPTPDGPEFRDDMAWLKEACAGFAASYEG 59

Query: 74  NLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA 133
            LA      +   L A I  YE+I  + GR+ SYA L Y  N       KF  D   K+ 
Sbjct: 60  KLASL----DAAGLLACIEAYEKIDIVAGRLMSYAGLRYYQNTMDSERAKFMADAQDKVT 115

Query: 134 DFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDT 193
           D+   L+FF+LE N L++A LE   A+     +Y      +R ++ H LS+++E  L D 
Sbjct: 116 DYTTALVFFSLEFNRLEDAHLEARLAESAALARYKPVFDRMRAMRPHQLSDELERFLHDE 175

Query: 194 SQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSS 253
           S VG  A  R F E +  L F +  +++ L        D +R  R++AA+AL+  F ++ 
Sbjct: 176 STVGAAAWNRLFDETMAGLTFTLEGEELNLESTLNLLTDPERPRREAAARALAEVFGRNI 235

Query: 254 HIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY 313
            +F+ + NTLAK++EI DRWRK       RHL+N+VEP V+EAL  +V   YPK SHRYY
Sbjct: 236 KLFARVHNTLAKEKEIHDRWRKMPTPQYGRHLANHVEPEVVEALRNAVVAAYPKLSHRYY 295

Query: 314 ELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHN 373
            LK KWL LD +  WDR APLP  +  ++ ++ A+  V+++Y+ F P+M+ IA+ FF   
Sbjct: 296 RLKAKWLGLDKLQVWDRNAPLPTETPRLVGWDEAQSTVMEAYSAFDPRMAEIAKPFFEKG 355

Query: 374 WIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGI 433
           WIDA    GK  GAFAH T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG 
Sbjct: 356 WIDAGVKPGKAPGAFAHPTVTTVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGE 414

Query: 434 LTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFE 493
           L +++ LTLAETAS+FGE LTF  LL AA +  ERK LLA K+EDM+N++VRQI+FYDFE
Sbjct: 415 LLSSTPLTLAETASVFGEMLTFRRLLDAARTPAERKTLLAGKVEDMINTVVRQIAFYDFE 474

Query: 494 LKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYA 553
            KLH  RR    +    IN +W+  Q ESLG AF+  +  Y +FW  VPHF+ S FYVYA
Sbjct: 475 CKLHEARRQGE-LTPEDINALWMSVQAESLGDAFEFME-GYETFWSYVPHFVHSPFYVYA 532

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YAFG+ LVN+LY +Y +     F++KY  +L AG SKH+ ELL P  ++ SDP FW++GL
Sbjct: 533 YAFGDGLVNALYAVY-AEGTPGFQDKYFEMLSAGGSKHHKELLAPFGLDASDPTFWDKGL 591

Query: 614 QTVEKMIDDVEKM 626
             +   ID++E M
Sbjct: 592 SMIAGFIDELEAM 604


>gi|332981322|ref|YP_004462763.1| oligopeptidase F [Mahella australiensis 50-1 BON]
 gi|332699000|gb|AEE95941.1| oligopeptidase F [Mahella australiensis 50-1 BON]
          Length = 596

 Score =  480 bits (1235), Expect = e-133,   Method: Composition-based stats.
 Identities = 152/609 (24%), Positives = 276/609 (45%), Gaps = 20/609 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           M  +  +E +    +W+LED+Y S D  E   D + ++    A + +++G L       +
Sbjct: 1   MNALPKREEIDKKYKWHLEDIYSSDDEWE--RDFKRLKDMVPAME-KYKGRLN------S 51

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
             SL  A+   + I +L  R+ +YA +  + + ++   +       + + + +  L F  
Sbjct: 52  ADSLYNALKLRDEISQLAERLFTYARMRRDEDNANTKYQALADRAMSLIIEIQSALSFIV 111

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            EI  +    +     ++P    Y  +I +I + K H+LS   E +L+   ++   A   
Sbjct: 112 PEILAIPADEVYGYMIEEPNLELYRHYIDDIMRQKAHVLSASEERILAQAGEMAEAADII 171

Query: 204 FFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           F   N   ++F     +      +   +  +     DR VRK A +AL  T+ K  +  S
Sbjct: 172 FTMINDADIKFPSIKDENGNEVELTKGRYMQFMESQDRRVRKDAFEALYDTYGKLKNTLS 231

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
              ++  K +    R RKY     +    +NV   V + L++++ +      +RY +L+K
Sbjct: 232 ATLSSNVKKDIFFSRVRKYPSSLAASLDDDNVPTSVYDGLIKAIHDNM-DLMYRYVKLRK 290

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           K L +D ++ +D   PL    +  + +E A D VL+       +   + E  F + WIDA
Sbjct: 291 KMLGVDELHMYDLYVPLVPDIKVKVSYEEAIDKVLEGLRPLGQEYISLLEHGFKNGWIDA 350

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK SGA++ G    VHP++LLN+ G   D+ T+AHE+GH +H   S   Q  +   
Sbjct: 351 YENQGKTSGAYSWG-CYGVHPFVLLNFQGTLDDIFTIAHEMGHSLHTHYSFSAQPYIYAE 409

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
             + +AE AS   E L  D +L+    +  +  L+ + +E    ++ RQ  F +FE  +H
Sbjct: 410 YRIFVAEVASTLNEALLMDHMLKTTDQRSMKLYLINHYLEQFRGTVYRQTMFAEFEKIVH 469

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
            +  +   +    ++ I+    ++  GP   + D      W  +PHF  S FYVY YA G
Sbjct: 470 DKAETGESLTPDMMSSIYHNLNEKYYGPNIVVDD-RIDLEWSRIPHFYSS-FYVYKYATG 527

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                +L     S       ++Y+N L++G S +  ELL    ++++ P   E  L+   
Sbjct: 528 FSAATALSQQILSEG-KTAVDRYINFLKSGGSDYPIELLKKAGVDMTTPKPVEAALKVFA 586

Query: 618 KMIDDVEKM 626
            ++D +E M
Sbjct: 587 GLLDQMESM 595


>gi|163743584|ref|ZP_02150961.1| oligoendopeptidase F [Phaeobacter gallaeciensis 2.10]
 gi|161383169|gb|EDQ07561.1| oligoendopeptidase F [Phaeobacter gallaeciensis 2.10]
          Length = 614

 Score =  480 bits (1235), Expect = e-133,   Method: Composition-based stats.
 Identities = 274/594 (46%), Positives = 382/594 (64%), Gaps = 9/594 (1%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           LGNLP W+L DLY S ++ E+  D+  ++ E  +F   +EG LA      +   L   + 
Sbjct: 28  LGNLPEWDLSDLYTSENASELERDLAWLDGECASFAADYEGKLADL----DADGLLTCVL 83

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
             E+I  + GRI S+A L Y    +     KF +D+  K+  F   L+FF LEIN L++A
Sbjct: 84  RNEKINAIAGRIMSFAGLRYYQLTTDAGRAKFMSDMQEKITIFTTPLVFFTLEINRLEDA 143

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
           +LE  +A +    +Y      IR +K + LS+++E  L D   VG +A +R F E I  L
Sbjct: 144 VLESHFAANSDLARYKPIFDRIRAMKPYQLSDELEKFLHDLGVVG-DAWERLFDETIAGL 202

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
            F ++ +++ +        + DR  R++AA+ L+  F+ +  IF+ + NT AK++EI DR
Sbjct: 203 TFTVDGEELNIEGTLNLLTEQDRSKREAAARELARVFSDNIKIFARVHNTQAKEKEILDR 262

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR        RHLSN+VEP V+EAL ++V   YPK SHRYYELK+KWL LD M  WDR A
Sbjct: 263 WRGMPSPQMGRHLSNHVEPEVVEALREAVVAAYPKLSHRYYELKRKWLGLDRMQVWDRNA 322

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP  +   + ++ AR +V+ +Y+ F P+M  +AE FF   WIDA    GK  GAFAH T
Sbjct: 323 PLPMETSRTVNWDEARKMVMDAYSAFDPRMGDLAEPFFDKGWIDAAVKPGKAPGAFAHPT 382

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +  VHPY++LNYLGKP+DVMTLAHELGHG+H VL+++ QG + +++ LTLAETAS+FGE 
Sbjct: 383 VTDVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAD-QGEMLSSTPLTLAETASVFGEM 441

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF  +L+ A  K ERKILLA K+EDM+N++VRQI+FYDFE KLH   R+ G++    IN
Sbjct: 442 LTFRKMLENAKDKTERKILLAGKVEDMINTVVRQIAFYDFECKLHAA-RAEGELTPDDIN 500

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
            +W+  Q ESLG AFD  +  Y +FW  VPHF+ S FYVYAYAFG+ LVN+LY +Y +  
Sbjct: 501 ALWMSVQAESLGEAFDFME-GYETFWTYVPHFVHSPFYVYAYAFGDGLVNALYSVY-AEG 558

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + FK+KY  +L+AG SKH+ ELL P  ++ SDP FW++GL  +  MID++E M
Sbjct: 559 AEGFKDKYFEMLKAGGSKHHKELLAPFGLDASDPTFWDKGLSMISDMIDELEAM 612


>gi|297583847|ref|YP_003699627.1| oligoendopeptidase F [Bacillus selenitireducens MLS10]
 gi|297142304|gb|ADH99061.1| oligoendopeptidase F [Bacillus selenitireducens MLS10]
          Length = 603

 Score =  480 bits (1235), Expect = e-133,   Method: Composition-based stats.
 Identities = 134/610 (21%), Positives = 269/610 (44%), Gaps = 19/610 (3%)

Query: 23  DMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
             T + +++++     W+LED++ S +  E   +   IE       + ++G L      +
Sbjct: 2   ATTALPNRKDIPKEKTWDLEDIFSSDEQWE--QEFNTIEQLIPQI-SDYQGKLG-----E 53

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
           +  +L  A+   + +   +G++  YA + Y+ + ++   +  +   +  +    K   F 
Sbjct: 54  SAETLYKALQFEDEVSMKLGKLYVYARMRYDQDTTNSHYQGLHDRASQLVTKAGKAASFM 113

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
             E+ ++ E  L +   +      Y    + + K + H+LS   E LL+   +V   A  
Sbjct: 114 TPELLSIPEDTLTEFLNEHEGLTLYRHAFERLNKKRPHVLSEKEEALLAQAGEVTSAASS 173

Query: 203 RFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIF 256
            F   N   ++F     +      +   +        DR VR+ A KA+  T+    + F
Sbjct: 174 TFSMLNNADMKFPTIKDEEGNDVEVSHGRFIHFLQSDDRRVREDAFKAMYATYTNFRNTF 233

Query: 257 SFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELK 316
           +   +   K    Q   R +E    +    N++   V + L+ +  N      H+Y +++
Sbjct: 234 ASTLSGNVKKNIFQANVRNHESARAAALSKNHIPEVVYDQLVNT-VNDNLHLLHKYIDIR 292

Query: 317 KKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWID 376
           K+ L LD ++ WD   P+       + ++ A +L+ +  A    +   I ++  ++ W+D
Sbjct: 293 KRALGLDELHMWDLYTPIVKDVDMKVSYDEATELMTEGLAPLGDEYVSIVKEGLSNRWVD 352

Query: 377 APQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTN 436
             +  GK SGA++ GT     PY+L+N+     ++ TLAHE GH +H   + + Q     
Sbjct: 353 IEENQGKRSGAYSSGT-YGTKPYVLMNWQDDVNNLFTLAHEFGHSVHSYYTRKFQPFPYA 411

Query: 437 NSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKL 496
           + S+ +AE AS   E L  D L +  + K+ +  LL   +E    ++ RQ  F +FE  +
Sbjct: 412 DYSIFVAEVASTTNEALLNDYLQKKETDKKRKLYLLNQFLEGFRGTVFRQTMFAEFEKMI 471

Query: 497 HTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAF 556
           H +  +   +    ++E + +  K+  G    + D E    W  +PHF   +FYVY YA 
Sbjct: 472 HDQAEAGVPLTADAMSEWYFDLNKKYFGDQIVI-DEEIAMEWARIPHFY-MNFYVYQYAT 529

Query: 557 GNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTV 616
           G     +L              ++++ L+AGNS +  E+L    ++++ P   ++ L   
Sbjct: 530 GYSAATALAKQILDEGEPAVT-RFVDYLKAGNSDYPIEVLKKAGVDMTSPEPIQQALNVF 588

Query: 617 EKMIDDVEKM 626
           E+ ++++E +
Sbjct: 589 EETLNELEAL 598


>gi|75675186|ref|YP_317607.1| peptidase M3B, oligoendopeptidase-related clade 3 [Nitrobacter
           winogradskyi Nb-255]
 gi|74420056|gb|ABA04255.1| peptidase M3B, oligoendopeptidase-related clade 3 [Nitrobacter
           winogradskyi Nb-255]
          Length = 625

 Score =  480 bits (1235), Expect = e-133,   Method: Composition-based stats.
 Identities = 284/606 (46%), Positives = 393/606 (64%), Gaps = 8/606 (1%)

Query: 20  RSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHAT 79
            +   +   S    G LP WNL DLY   D+ EI+ D++ I+ E  AF+  ++G LA  T
Sbjct: 24  PARKASAAKSGA--GRLPEWNLADLYAGIDAPEIARDLDRIDAECRAFEADYKGRLATET 81

Query: 80  NQKNCHSLGA-AIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKV 138
           +     +  A A+  YE I +L GR+AS+A L +  +   P I KFY D++ +L      
Sbjct: 82  SGPEGGAWLAGAVRRYEAIDDLAGRLASFAGLIHAGDSVDPAISKFYGDVSERLTAASLH 141

Query: 139 LIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGR 198
           L+FF LE+N LD+ ++E++  Q P    Y  WI++ RK K + L + +E L  + SQ G 
Sbjct: 142 LLFFPLELNRLDDDVIERAM-QTPELGHYRPWIEDSRKDKPYQLEDRLEQLFHEKSQTGY 200

Query: 199 EALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSF 258
            A  R F + I  LRFK+  +++ +  A     D   E RK+A +AL+ TF  +   F+ 
Sbjct: 201 SAWNRLFDQTIAGLRFKVGAKELAIEPALNLLQDRSPEKRKAAGQALAKTFKANERTFAL 260

Query: 259 ITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKK 318
           ITNTLAKD++I DRWR ++ +ADSRHL+N VE  V++AL+ SV+  YP+ SHRYY LK +
Sbjct: 261 ITNTLAKDKDISDRWRGFQDVADSRHLNNRVEREVVDALVASVRAAYPRLSHRYYALKAR 320

Query: 319 WLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAP 378
           W K   +  WDR APLP  +  +IP+  AR +VL +Y +FSP+M+ IAE+FFT  WIDAP
Sbjct: 321 WFKKKKLAHWDRNAPLPFAATGVIPWGDARKMVLSAYGEFSPEMAGIAERFFTDRWIDAP 380

Query: 379 QYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNS 438
              GK  GAF+H T PS HPY+L+NY GKP+DVMTLAHELGHG+H VL+++  G L   +
Sbjct: 381 VRPGKAPGAFSHPTTPSAHPYVLMNYQGKPRDVMTLAHELGHGVHQVLAAKN-GALMAPT 439

Query: 439 SLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHT 498
            LTLAETAS+FGE LTF  LL    + ++R+ LLA K+EDM+N++VRQI+FY FE  +HT
Sbjct: 440 PLTLAETASVFGEMLTFKRLLAQTKNAKQRQALLAGKVEDMINTVVRQIAFYTFERAVHT 499

Query: 499 ERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGN 558
           E R  G++   R+ ++WL  Q ESLGPA ++    Y +FWM +PHFI S FYVYAYAFG+
Sbjct: 500 E-RKDGELTAERLGQLWLSVQGESLGPAIEIK-PGYETFWMYIPHFIHSPFYVYAYAFGD 557

Query: 559 CLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
           CLVNSLY +Y  +  + F E+YL +L AG +KHYSELL P  ++  DP FW+ GL  +  
Sbjct: 558 CLVNSLYAVY-EHASEGFAERYLAMLAAGGTKHYSELLKPFELDARDPKFWDGGLSVIAG 616

Query: 619 MIDDVE 624
           MID++E
Sbjct: 617 MIDELE 622


>gi|221638826|ref|YP_002525088.1| Oligoendopeptidase, pepF/M3 family [Rhodobacter sphaeroides KD131]
 gi|221159607|gb|ACM00587.1| Oligoendopeptidase, pepF/M3 family [Rhodobacter sphaeroides KD131]
          Length = 606

 Score =  480 bits (1234), Expect = e-133,   Method: Composition-based stats.
 Identities = 276/613 (45%), Positives = 374/613 (61%), Gaps = 10/613 (1%)

Query: 14  FFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEG 73
                    D         LGNLP W+L DLYP+ D  E  +DM  ++     F   +EG
Sbjct: 2   TLPLPRPVFDANASAGG--LGNLPDWDLRDLYPTPDGPEFRDDMAWLKEACAGFAASYEG 59

Query: 74  NLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA 133
            LA      +   L A I  YE+I  + GR+ SYA L Y  N       KF  D   K+ 
Sbjct: 60  KLASL----DAAGLLACIEAYEKIDIVAGRLMSYAGLRYYQNTMDSERAKFMADAQDKVT 115

Query: 134 DFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDT 193
           D+   L+FF+LE N L++A LE   A+     +Y      +R ++ H LS+++E  L D 
Sbjct: 116 DYTTALVFFSLEFNRLEDAHLEARLAESAALARYKPVFDRMRAMRPHQLSDELERFLHDE 175

Query: 194 SQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSS 253
           S VG  A  R F E +  L F +  +++ L        D +R  R++AA+AL+  F ++ 
Sbjct: 176 STVGAAAWNRLFDETMAGLTFTLEGEELNLESTLNLLTDPERPRREAAARALAEVFGRNI 235

Query: 254 HIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY 313
            +F+ + NTLAK++EI DRWRK       RHL+N+VEP V+EAL  +V   YPK SHRYY
Sbjct: 236 KLFARVHNTLAKEKEIHDRWRKMPTPQYGRHLANHVEPEVVEALRNAVVAAYPKLSHRYY 295

Query: 314 ELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHN 373
            LK KWL LD +  WDR APLP  +  ++ ++ A+  V+++Y+ F P+M+ IA+ FF   
Sbjct: 296 RLKAKWLGLDKLQVWDRNAPLPTETPRLVGWDEAQSTVMEAYSAFDPRMAEIAKPFFEKG 355

Query: 374 WIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGI 433
           WIDA    GK  GAFAH T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG 
Sbjct: 356 WIDAGVKPGKAPGAFAHPTVTTVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGE 414

Query: 434 LTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFE 493
           L +++ LTLAETAS+FGE LTF  LL AA +  ERK LLA K+EDM+N++VRQI+FYDFE
Sbjct: 415 LLSSTPLTLAETASVFGEMLTFRRLLDAARTPAERKTLLAGKVEDMINTVVRQIAFYDFE 474

Query: 494 LKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYA 553
            KLH  RR    +    IN +W+  Q ESLG AF+  +  Y +FW  VPHF+ S FYVYA
Sbjct: 475 CKLHEARRQGE-LTPEDINALWMSVQAESLGDAFEFME-GYETFWSYVPHFVHSPFYVYA 532

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YAFG+ LVN+LY +Y +     F+EKY  +L AG SKH+ ELL P  ++ SDP FW++GL
Sbjct: 533 YAFGDGLVNALYAVY-AEGTPGFQEKYFEMLSAGGSKHHKELLAPFGLDASDPTFWDKGL 591

Query: 614 QTVEKMIDDVEKM 626
             +   ID++E M
Sbjct: 592 SMIAGFIDELEAM 604


>gi|260427147|ref|ZP_05781126.1| putative oligoendopeptidase F [Citreicella sp. SE45]
 gi|260421639|gb|EEX14890.1| putative oligoendopeptidase F [Citreicella sp. SE45]
          Length = 609

 Score =  479 bits (1233), Expect = e-133,   Method: Composition-based stats.
 Identities = 268/612 (43%), Positives = 380/612 (62%), Gaps = 9/612 (1%)

Query: 15  FRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGN 74
           F ++L   D        +LG+LP W+L DLY + D+ E+  D++ +E     F   +E  
Sbjct: 5   FPRSLPVFDANASAKGRDLGDLPEWDLSDLYTAPDAPELKRDLDWLEDACARFAADYESQ 64

Query: 75  LAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLAD 134
           LA      +       +  +E+I  + GR+ SYA L Y    +     KF +D+  K+  
Sbjct: 65  LAGL----DAAGFLEMVQRHEKIETVGGRLMSYAGLRYYQATTDAERAKFLSDLQEKVTI 120

Query: 135 FEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTS 194
           +   L+FF LE+NT+++      +       +Y      IR +K + LS+++E  L D  
Sbjct: 121 YTTPLVFFTLELNTIEDDAYAALFTASDELARYKPAFDRIRAMKPYQLSDELERFLHDMG 180

Query: 195 QVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
            VG +A  + F E I  L F I+D+++P+        + DR  R++AA  L+  F ++  
Sbjct: 181 VVG-DAWMKLFDETIAGLSFTIDDEELPIESTLTLLTEQDRSKREAAAHELARVFGENIR 239

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
            F+ + NT AK++EI DRWR        RHLSN+VEP V+EAL  +V   YP+ SHRYYE
Sbjct: 240 TFARVHNTQAKEKEIMDRWRGMPSAQMGRHLSNDVEPEVVEALRDAVVAAYPRLSHRYYE 299

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           LK+KWL LD M  WDR APLP  S  I+ ++ AR  V  +YA F P+M+ IAE FFT  W
Sbjct: 300 LKRKWLGLDVMQVWDRNAPLPMESDRIVGWDEARKTVTDAYAGFDPRMAEIAEPFFTKGW 359

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           IDA    GK  GAFAH T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG +
Sbjct: 360 IDAAVKPGKAPGAFAHPTVTEVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGEM 418

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
             ++ LTLAETAS+FGE LTF ++L  A  ++ERK++LA K+EDM+N++VRQI+FYDFE 
Sbjct: 419 LASTPLTLAETASVFGEMLTFRAMLDTAKDQKERKVMLAGKVEDMINTVVRQIAFYDFEC 478

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
           KLH  RR  G++    IN +W+  Q ESLGPAF+     Y +FW  +PHF+ S FYVYAY
Sbjct: 479 KLHEARR-GGELTPDDINALWMSVQAESLGPAFEYM-PGYETFWAYIPHFVHSPFYVYAY 536

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           AFG+ LVN+LY +Y+ +  + F++KY ++L+AG SKH+  LL P  ++ SDP FW++GL 
Sbjct: 537 AFGDGLVNALYAVYQESP-EGFEDKYFDMLKAGGSKHHKALLAPFGLDASDPTFWDKGLS 595

Query: 615 TVEKMIDDVEKM 626
            +E  ID++E M
Sbjct: 596 MIEGFIDELEAM 607


>gi|254473018|ref|ZP_05086416.1| oligoendopeptidase, PepF/M3 family [Pseudovibrio sp. JE062]
 gi|211957739|gb|EEA92941.1| oligoendopeptidase, PepF/M3 family [Pseudovibrio sp. JE062]
          Length = 596

 Score =  479 bits (1232), Expect = e-133,   Method: Composition-based stats.
 Identities = 274/594 (46%), Positives = 393/594 (66%), Gaps = 6/594 (1%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           LG+LP W+L   Y S +   I  DME  +  +  F+   +G LA     ++   +   + 
Sbjct: 6   LGDLPEWDLSVFYSSIEDPAIDQDMERAKELAEQFEADCKGKLAEIA-ARSGDEMAEIVR 64

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
            YE + +L+GRI SYA LSY  + + P  +KFY D+  KL      ++FF+LE+N +DEA
Sbjct: 65  RYEELEDLMGRIGSYAGLSYAGDTTDPARQKFYGDVQEKLTTASLHMLFFSLEMNKIDEA 124

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
           +LE++         Y  W++++RK + H  S ++E L  +    G  A  R F E I   
Sbjct: 125 VLEEALK-SEKLAYYRPWLEDLRKERPHERSEEIEQLFHEKHVTGAAAWNRLFDETISGS 183

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           R++I+ +++ + +       +D E+RK AA ALS TF K+  IF+ ITNTLAKD++  DR
Sbjct: 184 RYEIDGEELSIEQTLNLLQGADAELRKKAAGALSKTFAKNLSIFTLITNTLAKDKDTYDR 243

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           W  +E IADSRHLSN VE  V++AL+ SV+  YP+ SHRYY +K KWL ++ M+FWDR A
Sbjct: 244 WHNFEDIADSRHLSNRVEREVVDALVDSVRAAYPRLSHRYYAMKAKWLGVEKMHFWDRNA 303

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP      IP++ A+  VL +Y+KFSP++S IAE+FF  NWID     GK  GAF+H T
Sbjct: 304 PLPQADTRDIPWDEAKTTVLDAYSKFSPELSSIAEEFFDKNWIDGAARPGKSPGAFSHPT 363

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +PS HP++L+NY GK +DVMTLAHELGHG+H VL++   G L   + LTLAETAS+FGE 
Sbjct: 364 VPSAHPFVLINYQGKIRDVMTLAHELGHGVHQVLAAPN-GALMAPTPLTLAETASVFGEM 422

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF  LL  A + E+R+I+LA K+EDMLN++VRQI+FY FE ++H   R  G++ + +I+
Sbjct: 423 LTFKDLLAKAETPEKRQIMLAGKVEDMLNTVVRQIAFYTFERQVHEL-RKEGELTSEQIS 481

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
            IW+  Q+ESLG A DL +  Y ++W  +PHFI S FYVYAYAFG+CLVNSLY +Y+   
Sbjct: 482 AIWMSVQEESLGEAIDL-EGGYENYWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVYEEA- 539

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + F++KY ++L+AG +KH+SELL P  ++ +DP FW++GL  +E+ ID++E+M
Sbjct: 540 EEGFQQKYFDLLKAGGTKHHSELLAPFGLDATDPAFWQKGLAVIERFIDELEEM 593


>gi|119384569|ref|YP_915625.1| pepF/M3 family oligoendopeptidase [Paracoccus denitrificans PD1222]
 gi|119374336|gb|ABL69929.1| oligoendopeptidase, pepF/M3 family [Paracoccus denitrificans
           PD1222]
          Length = 620

 Score =  478 bits (1231), Expect = e-133,   Method: Composition-based stats.
 Identities = 268/611 (43%), Positives = 367/611 (60%), Gaps = 11/611 (1%)

Query: 19  LRSSDMTTMDSQENLGNL---PRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNL 75
           +   D   +       +L   P W+L DLYP+ DS E++ D+E +E     F   +EG L
Sbjct: 16  MLPRDENALPVAAEAPDLGALPEWDLSDLYPAPDSPELTRDLEAVEQACCEFARNYEGKL 75

Query: 76  AHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADF 135
           A      +   +   I  Y++I  L GRI SYA L Y  N +     K   D+  ++   
Sbjct: 76  ASL----DAGKMLDCIERYQQIDILAGRIMSYAGLRYYQNTTDSARAKQMGDLQDRITTA 131

Query: 136 EKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQ 195
              L+FF+LE N + +A  E+ +A      +Y      +R ++ + LSN++E  L D S 
Sbjct: 132 TTKLVFFSLEFNRIPDARYEEVFAAPNGPARYKPVFDRMRAMRPYQLSNELERFLHDNSV 191

Query: 196 VGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
           VG  A  R F E    L F +  +++ L        D DR  R++ A+AL   F K+  +
Sbjct: 192 VGAAAWNRLFDETTAGLTFDVAGEELGLEATLNLLTDHDRARREAGARALVEVFGKNVKL 251

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+ I NTLAK++ I+D+WRK      +RHLSN+VEP V+EAL  +V   YP+ SHRYY L
Sbjct: 252 FARIHNTLAKEKSIEDKWRKMPTPQTARHLSNHVEPEVVEALRNAVTAAYPRLSHRYYRL 311

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           K KWL LD +  WDR APLP  S  +I +  A+  VL +YA FSP+++ +A+ FF   WI
Sbjct: 312 KAKWLGLDKLQVWDRNAPLPTESPRLIAWPEAQATVLDAYAGFSPKLAELAQPFFERGWI 371

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           DA    GK  GAFAH T+ +VHPY+LLNYLGKP+DVMTLAHELGHG+H  L++  QG L 
Sbjct: 372 DAAVKPGKAPGAFAHPTVTTVHPYVLLNYLGKPRDVMTLAHELGHGVHQSLAAA-QGELL 430

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
             + LTLAETAS+FGE LTF +LL   + K +RK LLA K+EDM+N++VRQI+FYDFE K
Sbjct: 431 AATPLTLAETASVFGEMLTFRALLAKTTDKTQRKALLAGKVEDMINTVVRQIAFYDFECK 490

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           LH  R     +    IN +W+  Q ESLG AF+     Y +FW  VPHF+ S FYVYAYA
Sbjct: 491 LHAARAKGE-LTPEDINALWMSVQAESLGDAFEFM-PGYETFWTYVPHFVHSPFYVYAYA 548

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
           FG+ LVN+LY  Y  + +  F+ KY ++L AG S+H+ ELL P  ++ SDP FW++GL  
Sbjct: 549 FGDGLVNALYAAY-EDGLPDFQAKYFDMLAAGGSRHHKELLAPFGLDASDPAFWDKGLSM 607

Query: 616 VEKMIDDVEKM 626
           +E  ID++E M
Sbjct: 608 IEGFIDELEAM 618


>gi|154246013|ref|YP_001416971.1| pepF/M3 family oligoendopeptidase [Xanthobacter autotrophicus Py2]
 gi|154160098|gb|ABS67314.1| oligoendopeptidase, pepF/M3 family [Xanthobacter autotrophicus Py2]
          Length = 634

 Score =  478 bits (1231), Expect = e-133,   Method: Composition-based stats.
 Identities = 289/594 (48%), Positives = 387/594 (65%), Gaps = 6/594 (1%)

Query: 34  GNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC-HSLGAAIA 92
             LP WNL DLYP+ DS E+  D++  +    AF+T ++G LA      +   +LGAA+ 
Sbjct: 44  ERLPEWNLTDLYPAMDSPELKADLDKADVACKAFETAFKGKLAALLALPDGGAALGAAVK 103

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
            YE + +L+GRIASY  L Y  + S P   KFY DI  +L D    L+FF LE+N LD+A
Sbjct: 104 SYEEVDDLLGRIASYGSLIYAGDTSDPARAKFYGDIQERLTDASTHLLFFTLEMNRLDDA 163

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
            LE + A DP    Y  W++++RK K + L + +E L  + S   R A  R F E I SL
Sbjct: 164 ALEAAMA-DPALGYYRPWVEDLRKDKPYQLDDKIEQLFHEKSNPSRGAWSRLFDETISSL 222

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           RF ++ Q + +        D   EVRKSA  AL+ TF K+  +F+ ITNTLAKD+EI DR
Sbjct: 223 RFTVDGQDLAIEPTLNLMQDPREEVRKSAGLALADTFGKNLRLFTLITNTLAKDKEISDR 282

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR +E +A SRHL+N VE  V++A++++++  +P+ SHRYY LK +W   D + FWDR A
Sbjct: 283 WRGFEDVASSRHLANRVEKEVVDAMVEAIRVSFPRLSHRYYALKARWFGKDRLEFWDRNA 342

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP      I +  A+D VL +Y  FSP+M+ IA+ FF  +WIDAP   GK  GAFAH T
Sbjct: 343 PLPKVETRDIGWGEAKDTVLSAYGAFSPKMADIAKTFFEKSWIDAPVRPGKSPGAFAHPT 402

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +PS HPY+LLNY GKP+DVMTLAHELGHG+H VL++  QG L   + LTLAETAS+FGE 
Sbjct: 403 VPSAHPYVLLNYQGKPRDVMTLAHELGHGVHQVLAAR-QGALMAPTPLTLAETASVFGEM 461

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF  LL  A +   RKI+LA K+EDM+N++VRQ +FY FE  +H ERR    + + +I 
Sbjct: 462 LTFRRLLDGAETPRARKIMLAQKVEDMINTVVRQTAFYTFERDVHIERRQGE-LTSEKIG 520

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
           EIW++ Q ESLGPA  L    Y +FW  +PHFI S FYVYAYAFG+CLVNSLY +Y  N 
Sbjct: 521 EIWMKVQGESLGPAIHL-GAGYETFWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVY-ENA 578

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            D F ++YL +L AG +KH++ELL P  ++  DP FW+ GL  +++MI ++E M
Sbjct: 579 ADGFADRYLEMLSAGGTKHHAELLAPFGLDARDPAFWQTGLSLIDRMISELESM 632


>gi|170749210|ref|YP_001755470.1| pepF/M3 family oligoendopeptidase [Methylobacterium radiotolerans
           JCM 2831]
 gi|170655732|gb|ACB24787.1| oligoendopeptidase, pepF/M3 family [Methylobacterium radiotolerans
           JCM 2831]
          Length = 623

 Score =  478 bits (1231), Expect = e-133,   Method: Composition-based stats.
 Identities = 281/596 (47%), Positives = 372/596 (62%), Gaps = 6/596 (1%)

Query: 32  NLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS-LGAA 90
           +LG+LP W+L DLY   D    S DM   E E   F   + G +A      +  + L  A
Sbjct: 29  DLGHLPEWDLTDLYSGLDDPNFSGDMTRAEEECRRFSETYAGRIAELAAGPDASARLAEA 88

Query: 91  IAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLD 150
           +  YE I +L+G++ S+A L Y+ + +     KFY D   +L      L+FFALE+N +D
Sbjct: 89  VRTYEGIEDLLGKLMSFAGLVYSGDTTDEARAKFYGDTRERLTGASADLLFFALELNRVD 148

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIE 210
           +A +  + A  P    Y+ WI+++R+ K H L +  E L  + S     A  R F E I 
Sbjct: 149 DAAMNAAMAGGP-LAHYAPWIEDLRREKPHQLDDRTEKLFLEKSVTSNAAWDRLFNETIA 207

Query: 211 SLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
           SLRF +  +++PL        D D  VRK AA A+S        +F+ ITNTLAKD+EI 
Sbjct: 208 SLRFTVQGEEMPLEPTLNKLQDPDGAVRKEAAGAISAVLRGQLRVFTLITNTLAKDKEIS 267

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
           DRWR ++ +AD+RHLSN VEP V+EAL+ +V+  YP+ SHRYY LK KW   + + +WDR
Sbjct: 268 DRWRGFKDVADARHLSNRVEPEVVEALVDAVRAAYPRLSHRYYTLKAKWFGQEALPYWDR 327

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
            APLP   Q  IP+  ARD VL +Y  FSP+M+ IA +FF   WIDAP   GK  GAFAH
Sbjct: 328 NAPLPRVEQRTIPWTEARDTVLSAYDAFSPKMAGIARRFFDERWIDAPTRPGKAPGAFAH 387

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
            T+PSVHPY+L+NY GKP+DVMTLAHELGHG+H VL+    G L   + LTLAETAS+FG
Sbjct: 388 PTVPSVHPYVLVNYQGKPRDVMTLAHELGHGVHQVLAGPN-GALMAPTPLTLAETASVFG 446

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E LTF  LL A +   +R+ +LA K+EDM+N++VRQI+FY FE K+H   R+ G++ T +
Sbjct: 447 EMLTFRRLLAATTDTTQRRAMLAAKVEDMINTVVRQIAFYSFERKVH-LARAKGELTTDQ 505

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
           IN +WL  Q ESLGPA  L D  Y  FW  +PHFI S FYVYAYAFG+CLVNSLY +Y  
Sbjct: 506 INALWLSVQAESLGPAITL-DSGYEPFWAYIPHFIHSPFYVYAYAFGDCLVNSLYGVYAR 564

Query: 571 NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
              + F ++Y  +L AG SK Y ELL P  ++  DP FW+ GL  +E MI ++E M
Sbjct: 565 A-EEGFVDRYFALLSAGGSKPYGELLAPFGLDAKDPGFWQIGLGMIESMIVELESM 619


>gi|260575503|ref|ZP_05843502.1| oligoendopeptidase, pepF/M3 family [Rhodobacter sp. SW2]
 gi|259022423|gb|EEW25720.1| oligoendopeptidase, pepF/M3 family [Rhodobacter sp. SW2]
          Length = 606

 Score =  478 bits (1231), Expect = e-132,   Method: Composition-based stats.
 Identities = 274/612 (44%), Positives = 377/612 (61%), Gaps = 10/612 (1%)

Query: 15  FRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGN 74
                   D  +  +    G+LP W+L DLYPS ++ +++ D+  +E   +AF+   +G 
Sbjct: 3   LPLPRPVFDANS--AAAGFGDLPEWDLTDLYPSPEAPQLAADLAFVERAVVAFEAAHKGK 60

Query: 75  LAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLAD 134
           LA      +   + A + +YE I    GR+ SYA L Y  N       KF  D+  K+  
Sbjct: 61  LASL----SADQMLACVQDYEAIDIAAGRLMSYAGLRYYQNTMDSDRAKFMADMQDKITT 116

Query: 135 FEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTS 194
           F   ++FF+LE N LDE  L    A +    +Y      +R ++ + LS+++E  L D S
Sbjct: 117 FTTPMVFFSLEFNRLDENHLAGLLAANEALARYKPVFDRMRAMRPYQLSDELETFLHDES 176

Query: 195 QVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
            VG  A  R F E +  L F   ++ + L        D DR  R++AA+AL+  F +   
Sbjct: 177 VVGASAWNRLFDETMAGLTFTPENETLSLEATLNLLTDPDRARREAAARALAKVFERDIK 236

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
           +FS I NTLAK++EI DRWRK       RHLSN+VEP V+EAL  +V   YP+ SHRYY 
Sbjct: 237 LFSRIHNTLAKEKEIHDRWRKMPTPQTGRHLSNHVEPEVVEALRNAVVAAYPRLSHRYYA 296

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           LK KWL L+ M  WDR APLP  S  ++ ++ AR  V  +YA F P+M+ ++E FF+  W
Sbjct: 297 LKAKWLGLERMQVWDRNAPLPQESPKLVDWDTARQTVQAAYASFDPRMAALSEPFFSKGW 356

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           IDA    GK  GAFAH T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG L
Sbjct: 357 IDAGVKPGKAPGAFAHPTVTTVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAAA-QGEL 415

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
            +++ LTLAETAS+FGE LTF  LL  AS+  ERK LLA K+EDM+N++VRQI+FYDFE 
Sbjct: 416 LSSTPLTLAETASVFGEMLTFRKLLDGASTPAERKTLLAGKVEDMINTVVRQIAFYDFEC 475

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
           KLH   R+ G++    IN +W+  Q ESLGP FD     Y +FW  +PHF+ S FYVYAY
Sbjct: 476 KLHAA-RAQGELTPDDINALWMSVQAESLGPVFDFM-PGYETFWAYIPHFVHSPFYVYAY 533

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           AFG+ LVN+LY  Y ++ +  F+EKY ++L+AG SKH+ ELL P  ++ SDP FW++GL 
Sbjct: 534 AFGDGLVNALYAAY-ADGLPGFQEKYFDMLKAGGSKHHKELLAPFGLDASDPKFWDKGLS 592

Query: 615 TVEKMIDDVEKM 626
            +   ID++E M
Sbjct: 593 MIAGFIDELEAM 604


>gi|299132060|ref|ZP_07025255.1| oligoendopeptidase, pepF/M3 family [Afipia sp. 1NLS2]
 gi|298592197|gb|EFI52397.1| oligoendopeptidase, pepF/M3 family [Afipia sp. 1NLS2]
          Length = 623

 Score =  478 bits (1230), Expect = e-132,   Method: Composition-based stats.
 Identities = 275/592 (46%), Positives = 387/592 (65%), Gaps = 6/592 (1%)

Query: 36  LPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC-HSLGAAIAEY 94
           LP WNL DLY S  + EI+ D++ ++ + +AF+  ++G +A A ++      L  A+  +
Sbjct: 36  LPEWNLGDLYSSITAPEIARDLDKLDADCVAFEAAYKGKIADALSKPGAGEWLAEAVKSF 95

Query: 95  ERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALL 154
           E I +L GR+ SYA L +  +   P I KFY D++ +L +    L+FF LE+N +D+ L+
Sbjct: 96  EAIDDLAGRLISYAGLIHAGDTVDPAITKFYGDVSERLTNASTHLLFFTLELNRIDDELI 155

Query: 155 EQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF 214
           E++  Q P    Y  W+++IRK K + L + +E L  + S     A  R F + I  LRF
Sbjct: 156 EKAM-QVPALGHYRPWLEDIRKDKPYQLEDRIEQLFHEKSTTSYGAFNRMFDQTIAGLRF 214

Query: 215 KINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWR 274
           K+  +++ +        D   E RK+AA+AL+ TF  +   F+ +TNTLAKD+EI DRWR
Sbjct: 215 KVGSKELAIEPTLNLLQDRAPEKRKAAAQALAKTFKANERTFALVTNTLAKDKEISDRWR 274

Query: 275 KYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPL 334
            +E +ADSRHL+N VE  V++AL+ SV+  YP+ SHRYY LK  W K   +  WDR APL
Sbjct: 275 GFEDVADSRHLANRVEREVVDALVASVRAAYPRISHRYYALKASWFKKKKLAHWDRNAPL 334

Query: 335 PGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIP 394
           P  +   I +  A+  +L++Y  FSP+M+ IA++FF   WIDAP   GK  GAF+H T P
Sbjct: 335 PFATTGQIEWNDAKSTILKAYGDFSPEMAGIAKRFFDDRWIDAPVRPGKAPGAFSHPTTP 394

Query: 395 SVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLT 454
           S HPY+L+NY GKP+DVMTLAHELGHG+H VL+++ QG L   + LTLAETAS+FGE LT
Sbjct: 395 SAHPYVLMNYQGKPRDVMTLAHELGHGVHQVLAAK-QGALMAPTPLTLAETASVFGEMLT 453

Query: 455 FDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEI 514
           F  LL    + ++R+ LLA K+EDM+N++VRQI+FY FE  +HTERR+   +   R+ EI
Sbjct: 454 FKRLLAQTKNAKQRQALLAGKVEDMINTVVRQIAFYSFERAVHTERRNGE-LTAERLGEI 512

Query: 515 WLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVD 574
           WL  Q ESLGPA ++    Y +FWM +PHFI S FYVYAYAFG+CLVNSLY +Y  +  +
Sbjct: 513 WLSVQGESLGPAIEIK-PGYETFWMYIPHFIHSPFYVYAYAFGDCLVNSLYAVY-EHAAE 570

Query: 575 CFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            F ++YL++L AG +KHYSELL P  ++  DP FW+ GL  +E MI ++E M
Sbjct: 571 GFADRYLDMLAAGGTKHYSELLAPFGLDAKDPAFWDGGLSVIEGMIGELEAM 622


>gi|126461844|ref|YP_001042958.1| pepF/M3 family oligoendopeptidase [Rhodobacter sphaeroides ATCC
           17029]
 gi|126103508|gb|ABN76186.1| oligoendopeptidase, pepF/M3 family [Rhodobacter sphaeroides ATCC
           17029]
          Length = 606

 Score =  478 bits (1229), Expect = e-132,   Method: Composition-based stats.
 Identities = 274/613 (44%), Positives = 373/613 (60%), Gaps = 10/613 (1%)

Query: 14  FFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEG 73
                    D         LGNLP W+L DLYP+ D  E  +DM  ++     F   +EG
Sbjct: 2   TLPLPRPVFDANASAGG--LGNLPDWDLRDLYPTPDGPEFRDDMAWLKEACAGFAASYEG 59

Query: 74  NLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA 133
            LA      +   L A I  YE+I  + GR+ SYA L Y  N       KF  D   K+ 
Sbjct: 60  KLASL----DAAGLLACIEAYEKIDIVAGRLMSYAGLRYYQNTMDSERAKFMADAQDKVT 115

Query: 134 DFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDT 193
           D    L+FF+LE N L++A LE   A+     +Y      +R ++ H LS+++E  L D 
Sbjct: 116 DSTTALVFFSLEFNRLEDAHLEARLAESAALARYKPVFDRMRAMRPHQLSDELERFLHDE 175

Query: 194 SQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSS 253
           S VG  A  R F E +  L F +  +++ L        D +R  R++AA+AL+  F ++ 
Sbjct: 176 STVGAAAWNRLFDETMAGLTFTLEGEELNLESTLNLLTDPERPRREAAARALAEVFGRNI 235

Query: 254 HIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY 313
            +F+ + NTLAK++EI DRWRK       RHL+N+VEP V+EAL  +V   YPK SHRYY
Sbjct: 236 KLFARVHNTLAKEKEIHDRWRKMPTPQYGRHLANHVEPEVVEALRNAVVAAYPKLSHRYY 295

Query: 314 ELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHN 373
            LK KWL L+ +  WDR APLP  +  ++ ++ A+  V+++Y+ F P+M+ IA+ FF   
Sbjct: 296 RLKAKWLGLEKLQVWDRNAPLPTETPRLVGWDEAQSTVMEAYSAFDPRMAEIAKPFFEKG 355

Query: 374 WIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGI 433
           WIDA    GK  GAFAH T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG 
Sbjct: 356 WIDAGVKPGKAPGAFAHPTVTTVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGE 414

Query: 434 LTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFE 493
           L +++ LTLAETAS+FGE LTF  LL AA +  ERK LLA K+EDM+N++VRQI+FYDFE
Sbjct: 415 LLSSTPLTLAETASVFGEMLTFRKLLDAARTPAERKTLLAGKVEDMINTVVRQIAFYDFE 474

Query: 494 LKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYA 553
            KLH  RR    +    IN +W+  Q ESLG AF+  +  Y +FW  VPHF+ S FYVYA
Sbjct: 475 CKLHEARRQGE-LTPEDINALWMSVQAESLGDAFEFME-GYETFWSYVPHFVHSPFYVYA 532

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YAFG+ LVN+LY +Y +     F++KY  +L AG SKH+ ELL P  ++ SDP FW++GL
Sbjct: 533 YAFGDGLVNALYAVY-AEGTPGFQDKYFEMLSAGGSKHHKELLAPFGLDASDPTFWDKGL 591

Query: 614 QTVEKMIDDVEKM 626
             +   ID++E M
Sbjct: 592 SMIAGFIDELEAM 604


>gi|86748556|ref|YP_485052.1| peptidase M3B, oligoendopeptidase-like clade 3 [Rhodopseudomonas
           palustris HaA2]
 gi|86571584|gb|ABD06141.1| Peptidase M3B, oligoendopeptidase-related clade 3 [Rhodopseudomonas
           palustris HaA2]
          Length = 610

 Score =  477 bits (1228), Expect = e-132,   Method: Composition-based stats.
 Identities = 284/593 (47%), Positives = 387/593 (65%), Gaps = 6/593 (1%)

Query: 35  NLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGA-AIAE 93
            LP WNL DLY + D+ +++ D++ ++ E  AF+  ++G LA         +  A A+  
Sbjct: 22  KLPEWNLADLYSAIDAPQVAADLDRLDAECAAFEAEFKGKLAEQAAADGGGAWLAGAVKR 81

Query: 94  YERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEAL 153
           YE I +L GR+ SYA L +  +   P   KFY D++ +L      L+FF+LE+N +D+A+
Sbjct: 82  YEAIEDLAGRLGSYAGLVHAGDSVDPVKSKFYGDVSERLTAASVHLLFFSLELNRVDDAV 141

Query: 154 LEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLR 213
           LE++  Q P    Y  WI+++RK K + L + +E L  + SQ G  A  R F + I  LR
Sbjct: 142 LERAM-QAPELGHYRPWIEDLRKDKPYQLDDRVEQLFHEKSQTGYGAFNRLFDQTISGLR 200

Query: 214 FKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRW 273
           FK+  +++ +        D     RK+AA+AL+ TF  +   F+ ITNTLAKD+EI DRW
Sbjct: 201 FKLGGKELAIEPTLNLLQDRTPAKRKAAAEALAKTFKANERTFALITNTLAKDKEISDRW 260

Query: 274 RKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAP 333
           R +E +ADSRHL+N VE  V++AL+ SV+  YP+ SHRYY+LK  W     +  WDR AP
Sbjct: 261 RGFEDVADSRHLANRVEREVVDALVASVRAAYPRLSHRYYKLKAGWFGKKKLPHWDRNAP 320

Query: 334 LPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTI 393
           LP  +   I +  AR++VL +Y+ FSP+M+ IAE+FFT  WIDAP   GK  GAF+H T 
Sbjct: 321 LPFAATGSIAWPEAREMVLTAYSAFSPEMARIAERFFTDRWIDAPVRPGKAPGAFSHPTT 380

Query: 394 PSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETL 453
           PS HPY+L+NY GKP+DVMTLAHELGHG+H VL++   G L   + LTLAETAS+FGE L
Sbjct: 381 PSAHPYVLMNYQGKPRDVMTLAHELGHGVHQVLAAGN-GALMAPTPLTLAETASVFGEML 439

Query: 454 TFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINE 513
           TF  LL    S ++R+ LLA K+EDM+N++VRQI+FY FE  +HTERRS   +   RI E
Sbjct: 440 TFRRLLSQTKSAKQRQALLAGKVEDMINTVVRQIAFYSFERAIHTERRSGE-LTAQRIGE 498

Query: 514 IWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTV 573
           IWL  Q ESLGPA ++    Y SFWM +PHFI S FYVYAYAFG+CLVNSLY +Y  +  
Sbjct: 499 IWLGVQSESLGPAIEIK-PGYESFWMYIPHFIHSPFYVYAYAFGDCLVNSLYAVY-EHAQ 556

Query: 574 DCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           + F E+YL +L AG +KHYSELL P  ++  DP+FW+ GL  +  MID++E M
Sbjct: 557 EGFAERYLAMLSAGGTKHYSELLAPFGLDAKDPSFWDGGLSVIAGMIDELEAM 609


>gi|170741333|ref|YP_001769988.1| pepF/M3 family oligoendopeptidase [Methylobacterium sp. 4-46]
 gi|168195607|gb|ACA17554.1| oligoendopeptidase, pepF/M3 family [Methylobacterium sp. 4-46]
          Length = 616

 Score =  477 bits (1227), Expect = e-132,   Method: Composition-based stats.
 Identities = 282/617 (45%), Positives = 383/617 (62%), Gaps = 6/617 (0%)

Query: 11  SNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTR 70
           + A        S         +LG LP W+L DLY   D    + D+   E E  +F   
Sbjct: 3   TRAAVPSEGSLSTAQATARAVDLGPLPEWDLSDLYAGLDDPAFARDLARAEAECRSFAET 62

Query: 71  WEGNLAHATNQKNC-HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDIN 129
           + G +A     +     LG A+A YE I +L+GR+ S+A L Y+ N + P   KFY D  
Sbjct: 63  YRGRVAALAGGEGAADQLGTAVAAYEAIEDLMGRLMSFAGLVYSGNTTDPVRAKFYGDTQ 122

Query: 130 AKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECL 189
            +L      L+FF LE+N + +A ++ + A  P   +Y  W+++IR+ K H LS+D+E L
Sbjct: 123 ERLTAASSDLLFFTLELNRVPDADIDAAAAL-PPLARYRPWLEDIRREKPHQLSDDLEKL 181

Query: 190 LSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTF 249
           L + S  GR A  R F E I SLRF +  +++ L        D+D  +R+ AA+ALS  F
Sbjct: 182 LLEKSVTGRSAWNRLFDETIASLRFPLRGEQLTLEPTLNKLQDADEGLRRDAAEALSGVF 241

Query: 250 NKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTS 309
             +  +F+ ITNTLAKD+EI DRWR++  +ADSRHL+N VEP V+ AL+++V   YP+ S
Sbjct: 242 RANLRVFTLITNTLAKDKEISDRWRRFGDVADSRHLANRVEPEVVAALVEAVTAAYPRLS 301

Query: 310 HRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKF 369
           HRYY LK +W + D++ +WDR APLP   Q  IP+  AR+ VL +Y  FSP+M+ IA  F
Sbjct: 302 HRYYRLKARWFQRDSLAYWDRNAPLPKVEQRTIPWAEARETVLSAYGAFSPRMAEIARTF 361

Query: 370 FTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSE 429
           F   WIDAP   GK  GAFAH T+PS HPY+L+NY GKP+DVMTLAHELGHG+H VL++ 
Sbjct: 362 FEGGWIDAPVRPGKAPGAFAHPTVPSAHPYVLVNYQGKPRDVMTLAHELGHGVHQVLAAG 421

Query: 430 TQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISF 489
             G L   + LTLAETAS+FGE LTF  +L A     +R+ LLA K+EDM+N++VRQI+F
Sbjct: 422 N-GALMAPTPLTLAETASVFGEMLTFRRVLDATREPHQRRALLAAKVEDMINTVVRQIAF 480

Query: 490 YDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSF 549
           Y FE +LH  RR  G++   +I  +W+  Q ESLGPA  L D  Y  FW  +PHFI S F
Sbjct: 481 YVFERRLHLARR-DGELTAEQICALWMSVQAESLGPAIRL-DEGYEPFWAYIPHFIHSPF 538

Query: 550 YVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFW 609
           YVYAYAFG+CLVNSLY +Y+    + F  +Y  +L AG +K Y ELL P  ++  DP+FW
Sbjct: 539 YVYAYAFGDCLVNSLYGVYQRA-EEGFVARYFALLSAGGTKPYGELLAPFGLDARDPSFW 597

Query: 610 ERGLQTVEKMIDDVEKM 626
           + GL  +E MI ++E M
Sbjct: 598 QIGLSMIEGMIAELEAM 614


>gi|56696297|ref|YP_166654.1| oligoendopeptidase F [Ruegeria pomeroyi DSS-3]
 gi|56678034|gb|AAV94700.1| oligoendopeptidase F [Ruegeria pomeroyi DSS-3]
          Length = 606

 Score =  477 bits (1227), Expect = e-132,   Method: Composition-based stats.
 Identities = 272/613 (44%), Positives = 382/613 (62%), Gaps = 9/613 (1%)

Query: 14  FFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEG 73
            F       D       + LGNLP W+L DLY   D+ E+++D++ +E E  AF   +EG
Sbjct: 1   MFHLPFPLRDANAGSGSKELGNLPEWDLSDLYSGEDAPELAHDLDWLETECAAFAADYEG 60

Query: 74  NLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA 133
            LA              +   E+I  + GRI S+A L Y          KF +D   K+ 
Sbjct: 61  KLAELDAAAL----LTCVQRNEKISAIAGRIMSFAGLRYYQLTIDAGRAKFMSDCQEKIT 116

Query: 134 DFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDT 193
           +F   L+FF LE+N +++  L   +A++    +Y+   + IR +K + LS+++E  L D 
Sbjct: 117 NFTTPLVFFTLELNRIEDDALTARFAENADLARYAPVFRRIRAMKPYQLSDELEKFLHDL 176

Query: 194 SQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSS 253
             VG +A +R F E I  L F I+ +++ +        + DR  R++AA  L+  F ++ 
Sbjct: 177 GVVG-DAWERLFDETIAGLTFDIDGEELNIEGTLNLLTEQDRSKREAAAHELARVFGENI 235

Query: 254 HIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY 313
             F+ + NT AK++E+ DRWRK       RHLSN+VEP V+EAL ++V   YPK SHRYY
Sbjct: 236 KTFARVHNTAAKEKEVIDRWRKMPSAQTGRHLSNDVEPEVVEALREAVVAAYPKLSHRYY 295

Query: 314 ELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHN 373
           ELK+KWL LD M  WDR APLP      IP+  A  +V+++Y  F P+M  IA  FF+  
Sbjct: 296 ELKRKWLGLDRMQVWDRNAPLPMEDTRTIPWAQAERMVMEAYEAFDPRMGEIAAPFFSKG 355

Query: 374 WIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGI 433
           WIDA    GK  GAFAH T+  VHPY++LNYLGKP+DVMTLAHELGHG+H VL++  QG 
Sbjct: 356 WIDAAVKPGKAPGAFAHPTVTEVHPYVMLNYLGKPRDVMTLAHELGHGVHQVLAA-GQGE 414

Query: 434 LTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFE 493
           + +++ LTLAETAS+FGE LTF  +L+ A ++E+RK+LLA K+EDM+N++VRQI+FYDFE
Sbjct: 415 MLSSTPLTLAETASVFGEMLTFRKMLEKAETQEQRKVLLAGKVEDMINTVVRQIAFYDFE 474

Query: 494 LKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYA 553
            KLH  RR    +    I ++W+  Q ESLGPAFD  +  Y SFW  +PHF+ S FYVYA
Sbjct: 475 CKLHAARRQGE-LTPENIGDLWMSVQGESLGPAFDFME-GYESFWAYIPHFVHSPFYVYA 532

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YAFG+ LVN+LY +Y +   + F+EKY ++L+AG SKH+ ELL P  ++ SDP FW++GL
Sbjct: 533 YAFGDGLVNALYSVY-AEGAEGFEEKYFDMLKAGGSKHHKELLAPFGLDASDPKFWDKGL 591

Query: 614 QTVEKMIDDVEKM 626
             +  MID++E M
Sbjct: 592 SMISDMIDELEAM 604


>gi|58040284|ref|YP_192248.1| oligoendopeptidase F [Gluconobacter oxydans 621H]
 gi|58002698|gb|AAW61592.1| Oligoendopeptidase F [Gluconobacter oxydans 621H]
          Length = 602

 Score =  476 bits (1226), Expect = e-132,   Method: Composition-based stats.
 Identities = 244/589 (41%), Positives = 366/589 (62%), Gaps = 8/589 (1%)

Query: 37  PRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYER 96
           PRW+L DLY S +   +++D +     + +F   ++G L   T  +    L  A AEYE 
Sbjct: 20  PRWDLSDLYASPEDPVLASDFDRWAGAARSFCETYKGRLETLTGAE----LAKAFAEYEA 75

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQ 156
           I E +G+I S++ L +  + + P   +F   +  ++ +    L+FF LE+N + + +L +
Sbjct: 76  IEEGLGKIGSFSSLGFAAHTTDPVWGRFAQGVQERMTEVASDLMFFTLELNRIPDEVLAR 135

Query: 157 SYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI 216
              +     K+  +++++R  + + LS+++E +L D S  GR A  R F E + +L   I
Sbjct: 136 -ICEAQEMRKWDPYLRDLRMYRPYQLSDEVEQVLMDKSVTGRNAWNRLFDETMATLSVTI 194

Query: 217 NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKY 276
           + ++ PL  A+    ++DR  R++AA+ +S    ++S + + ITNTLAKD+ I D+ R Y
Sbjct: 195 DGEEKPLGDAFNLLTNTDRAKREAAAQQISAVLGENSRLLTMITNTLAKDKAIGDKLRGY 254

Query: 277 EKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPG 336
            +   +R+L+N VE  V++AL+ +V   YP+ +HRYY LK KWL L+ +  WDR APLPG
Sbjct: 255 PRPTSARNLANMVEDEVVDALVGAVDEAYPRLAHRYYALKAKWLGLEKLEHWDRNAPLPG 314

Query: 337 TSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSV 396
                I +   +++V  +YA F P +  I  +F TH WIDA    GK SGAF+H  +PSV
Sbjct: 315 VEARKIDWVQGKEIVRTAYAGFDPGLGEIVNRFLTHPWIDAAPVAGKSSGAFSHSCVPSV 374

Query: 397 HPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFD 456
           HPYIL+NY G+P+DVMTLAHELGHG+H  L+ + QG L  ++ LTLAETAS+FGE LTF 
Sbjct: 375 HPYILMNYRGQPRDVMTLAHELGHGVHQTLAGQKQGYLNADTPLTLAETASVFGEMLTFQ 434

Query: 457 SLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWL 516
           SLL A S  + R+ +LA K+EDMLN++VRQI+FY FE+K+H ER     +   R+ EIW 
Sbjct: 435 SLLDAESDPKRRRHMLAAKVEDMLNTVVRQIAFYQFEVKVHDERAKGE-LSPERLGEIWR 493

Query: 517 ETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCF 576
           E Q  SLGPAF  +  +Y  +W  +PHF+ S FYVYAYAFG+CLVN+LY +Y+    + F
Sbjct: 494 EVQVRSLGPAFHFT-PDYDLYWSYIPHFVHSPFYVYAYAFGDCLVNALYGVYQEKP-EGF 551

Query: 577 KEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEK 625
             KY  +L AG +  + ELL P  ++ +DP FW +GL  +  +ID +E+
Sbjct: 552 AAKYRTMLEAGGTLRHKELLAPFGLDATDPGFWRKGLDVISGLIDQLEQ 600


>gi|89055883|ref|YP_511334.1| peptidase M3B, oligoendopeptidase-related clade 3 [Jannaschia sp.
           CCS1]
 gi|88865432|gb|ABD56309.1| Peptidase M3B oligoendopeptidase-related clade 3 [Jannaschia sp.
           CCS1]
          Length = 607

 Score =  476 bits (1226), Expect = e-132,   Method: Composition-based stats.
 Identities = 264/612 (43%), Positives = 375/612 (61%), Gaps = 8/612 (1%)

Query: 15  FRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGN 74
                   D         L  LP W+L DLY   D+  +  D++ +E    +F   +EG 
Sbjct: 3   LTYPAPLRDAAAETGGAPLEGLPVWDLSDLYEGQDAASLKRDLDWLEEACQSFAADYEGK 62

Query: 75  LAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLAD 134
           LA      +   L      YE+I  + GRI S+A L Y    +     KF +D+  K+  
Sbjct: 63  LADL----DADGLLDCTLRYEKIDMIAGRIMSFAGLRYYQKTTDGERAKFMSDMQDKITT 118

Query: 135 FEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTS 194
           +   L+FF+LE N +++A  +    ++    +Y      +R +K + LS+++E  L DTS
Sbjct: 119 YTTPLVFFSLEFNRIEDAQYDAMMDKNADLARYKPVFDRMRAMKPYQLSDELEKFLHDTS 178

Query: 195 QVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
            VG  A  + F E I  L F ++ + + +        DSDR  R++ AKAL+  F  ++ 
Sbjct: 179 VVGASAWNKLFDEQIAGLTFDVDGESLGIEATLNLMTDSDRARREAGAKALAEKFEDTAP 238

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
           +F+ + NTLAK++EI DRWR        RHL+N+VEP V+EAL  +V   YP+ SHRYY+
Sbjct: 239 LFARVHNTLAKEKEIGDRWRGLPSPQAGRHLANHVEPEVVEALRNAVVKAYPRLSHRYYK 298

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           LK KW+ L+ M  WDR APLP +   I+ ++ AR +V ++YA F P+M+ +AE FFT  W
Sbjct: 299 LKAKWMGLEKMEVWDRNAPLPMSEDRIVGWDEARRVVSEAYAGFDPRMAELAEPFFTDGW 358

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           IDA   +GK  GAFAH T+  VHPY++LNYLGKP+DVMTLAHELGHG+H  L++  QG +
Sbjct: 359 IDAGVKEGKAPGAFAHPTVTDVHPYVMLNYLGKPRDVMTLAHELGHGVHQRLAAA-QGEM 417

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
            +++ LTLAETAS+FGE LTF  +L  A     RK++LA K+EDM+N++VRQI+FYDFE 
Sbjct: 418 LSSTPLTLAETASVFGEMLTFRKMLSEAKDDATRKVMLAGKVEDMINTVVRQIAFYDFEC 477

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
           KLH  RR  G++    IN +W+  Q ESLGP F+  D  Y +FW  +PHF+ S FYVYAY
Sbjct: 478 KLHDARR-GGELTVDDINALWMSVQGESLGPVFNFMD-GYETFWAYIPHFVHSPFYVYAY 535

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           AFG+ LVN+LY +Y +   + F+EKY ++LRAG SKH+ ELL P  ++ SDP FW++GL 
Sbjct: 536 AFGDGLVNALYAVY-AEGNEGFEEKYFDMLRAGGSKHHKELLAPFGLDASDPAFWDKGLS 594

Query: 615 TVEKMIDDVEKM 626
            +E  ID++E M
Sbjct: 595 MIEGFIDELEAM 606


>gi|209965430|ref|YP_002298345.1| oligoendopeptidase, pe PF [Rhodospirillum centenum SW]
 gi|209958896|gb|ACI99532.1| oligoendopeptidase, pe PF [Rhodospirillum centenum SW]
          Length = 603

 Score =  476 bits (1226), Expect = e-132,   Method: Composition-based stats.
 Identities = 280/598 (46%), Positives = 385/598 (64%), Gaps = 12/598 (2%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           LG LP W+L DLYP  DS +++ D+E  E E+ AF  R +G L+  T  +    LG A+A
Sbjct: 13  LGRLPTWDLTDLYPGPDSPDLTRDLERTEQEARAFAARCQGRLSSLTGAE----LGRAVA 68

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
           E+E + E + RI SYA L Y  + SSP I +FY  +  ++      L+FF LEIN L++A
Sbjct: 69  EFEALDERLARIMSYAGLLYAGDRSSPEIGRFYQSMQERVTAISVHLLFFTLEINRLEDA 128

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
            L       P   KY  W+++ R  + H LS++ E LL +    GR A  R F E +  L
Sbjct: 129 DLAAKLTA-PELAKYGPWLRDTRIFRPHQLSDEAERLLHEKYVAGRAAWVRLFDETLAGL 187

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           RF +  + +   +A     D D+ VR+ AA A+      +  +F+ ITNTLAKD+EI+DR
Sbjct: 188 RFPVGGRDLTAAEALNLLSDRDQSVRREAALAIGGVLRANLRLFTHITNTLAKDKEIEDR 247

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR Y +   +R+L+N VE  V+EAL+ +VK  YP  SHRYY LK +W   D + +WDR A
Sbjct: 248 WRSYAQPWSARNLANRVEDAVVEALVSAVKAAYPTLSHRYYALKARWFGQDRLDYWDRNA 307

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP     I+P+E AR++VL SYA+FSP+++ + ++FF   WIDAP   GK  GAFAH T
Sbjct: 308 PLPDDDDRIVPWEEAREIVLSSYARFSPELAAVGQRFFDKAWIDAPTRPGKDPGAFAHPT 367

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +P+ HPY+LLNYLG+ +DVMTLAHELGHG+H VL++  QG L  ++ LTLAETAS+FGE 
Sbjct: 368 VPAAHPYLLLNYLGRTRDVMTLAHELGHGVHQVLAA-GQGHLQADTPLTLAETASVFGEM 426

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF  LL   +   +RK LLA K+EDMLN++VRQI+FY+FE ++H ERR    +   R+N
Sbjct: 427 LTFRGLLDRTTDPRKRKALLAGKVEDMLNTVVRQIAFYEFERRVHAERREAE-LSAERLN 485

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS-- 570
            IW+E Q ESLGPAF   D  Y ++W  +PHF+ S FYVYAYAFG+CLVNSLY  Y+   
Sbjct: 486 AIWMEVQTESLGPAFRF-DESYRTYWAYIPHFVHSPFYVYAYAFGDCLVNSLYAAYEEAA 544

Query: 571 --NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
             N  D F  +YL++L AG S+H+ ELL P  ++ +DP FW +GL  + + ID++E +
Sbjct: 545 RQNGSDAFARRYLDLLAAGGSRHHKELLAPFGLDATDPAFWGKGLDLLRRFIDELEAL 602


>gi|144898001|emb|CAM74865.1| Peptidase M3B, oligoendopeptidase F [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 594

 Score =  476 bits (1225), Expect = e-132,   Method: Composition-based stats.
 Identities = 277/603 (45%), Positives = 385/603 (63%), Gaps = 9/603 (1%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           M+T ++  +LGNLP W+L DLYP+ DS E++ D++  E  + AF  R++G LA      +
Sbjct: 1   MSTKNNAADLGNLPEWDLTDLYPAPDSAELAADLDKAEAVAKAFSQRYDGKLAAI----S 56

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
               G AIAEYER+ E++ R  SYA L Y  + + P   +F+  I+ ++ D     +FF 
Sbjct: 57  GDDFGDAIAEYERLGEIMYRAMSYAQLYYAGDQTDPERGRFHQGIHERITDISSHTLFFT 116

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
           LEIN LD+A+LE        T  Y  W++++R  + H LS+++E LL D S  GR A  R
Sbjct: 117 LEINRLDDAVLEDKLKA-AKTAHYGPWLRDVRVFRPHQLSDEVERLLHDKSVAGRSAWNR 175

Query: 204 FFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTL 263
            F E +  LRF ++ + +   +A     D D   RK+AA+ L     +++ +F+ ITNTL
Sbjct: 176 LFDETMARLRFPLDGKMLTSAEALHLMSDRDPAKRKAAAETLGKVLTENTGLFALITNTL 235

Query: 264 AKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLD 323
            KD+EI+D+WRKY +    R+LSN VE  V++AL  +VK  Y + SHRYY LK KW  +D
Sbjct: 236 VKDKEIEDKWRKYARPQSYRNLSNQVEDEVVDALAAAVKGCYGQLSHRYYALKAKWFGVD 295

Query: 324 TMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGK 383
            + +WDR APLP  +     +E ARD VL +Y  FSP M+ + ++FF  NWIDAP   GK
Sbjct: 296 QLDYWDRNAPLPDVADRTYSWEQARDSVLDAYGAFSPDMAALGKRFFDGNWIDAPVRPGK 355

Query: 384 GSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLA 443
             GAFAH T+ + HPY+L+NY GK +D+MTLAHELGHG+H VL++  QG L  ++ LTLA
Sbjct: 356 SPGAFAHPTVTTAHPYLLVNYQGKVRDIMTLAHELGHGVHQVLAA-GQGGLMADTPLTLA 414

Query: 444 ETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRST 503
           ETAS+FGE LTF S+L   +    RK +LA K+EDMLN++VRQ++FY FE  +H ERR  
Sbjct: 415 ETASVFGEMLTFQSMLAKETEPARRKAMLAGKVEDMLNTVVRQVAFYQFECLVHDERRRG 474

Query: 504 GDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNS 563
             +   RI E+W++ Q ESLGPA    D  Y SFW  +PHF+ + FYVYAYAFG+CLVNS
Sbjct: 475 E-LSPDRIGELWMQVQVESLGPALRFDD-GYKSFWTYIPHFVHTPFYVYAYAFGDCLVNS 532

Query: 564 LYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDV 623
           LY +Y+ N    F EKYL++LRAG +K + +LL P  ++  DP FW +GL  V   ID++
Sbjct: 533 LYSVYR-NGAPHFAEKYLDMLRAGGTKRHQDLLAPFGLDAGDPAFWRQGLDVVVGFIDEL 591

Query: 624 EKM 626
           E M
Sbjct: 592 EAM 594


>gi|220931661|ref|YP_002508569.1| Oligoendopeptidase F [Halothermothrix orenii H 168]
 gi|219992971|gb|ACL69574.1| Oligoendopeptidase F [Halothermothrix orenii H 168]
          Length = 598

 Score =  475 bits (1223), Expect = e-132,   Method: Composition-based stats.
 Identities = 153/609 (25%), Positives = 278/609 (45%), Gaps = 19/609 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
              +  +  + +  +W+LED+Y + +  E   D   ++ +     T ++G L +     +
Sbjct: 2   AKELPERNKIDDKYKWDLEDIYKTDEEWE--KDFNRVKDKLKDIAT-FQGKLVN-----S 53

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
             +L   +     + E+  R+ +YA +  + +    + +  +    +   +   +  F  
Sbjct: 54  SQNLLDGLNLIMEVEEVATRLYAYAHMRQDEDTRDQSYQSLFNRAQSLHNELASITSFMV 113

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            EI TL    + +   +      Y   + NI + K H LS   E L++   +V +     
Sbjct: 114 PEILTLSREQMNKYLEEKEGLKLYRHLLDNILRQKDHYLSAKEERLIAMAGEVTQGPYNI 173

Query: 204 FFCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           F   N   L F I         ++   +  +   + +R VRK A KAL   +N+  + F+
Sbjct: 174 FSMMNNADLTFPIIKDEKGEEVRVTHGRFIELMENKNRRVRKDAFKALYSKYNEFINTFA 233

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
              NT  K      R RKY    +S    +NV   V   L++++K+      ++Y +L+K
Sbjct: 234 STLNTAVKSHIYYARVRKYNSALESALDDDNVPVDVYNNLIKTIKDNLKP-MYKYMKLRK 292

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           + L +D ++ +D   PL       IP+E A+++V+        +   I ++ F   WID 
Sbjct: 293 EILGVDELHMYDIYTPLVSDLDIKIPYEEAKEMVINGLKPLGDEYLNILKEGFNSGWIDV 352

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK SGA++ G    VHPY+LLNY     +V TLAHE+GH IH   S++ Q  +  N
Sbjct: 353 YENKGKRSGAYSSG-CYGVHPYVLLNYTDNLDNVFTLAHEMGHAIHTYYSNKNQPFVYAN 411

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
             + +AE AS   ETL    LL+    ++++K L+ + +E    ++ RQ  F +FE  +H
Sbjct: 412 YKIFVAEVASTLNETLLIKYLLENTQDEKKKKYLINHYLEQFRGTVYRQTMFAEFEKIIH 471

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
            +      + +  + EI+ +  +E  GP   +SD E    W  +PHF   +FYVY YA G
Sbjct: 472 EKVEQGQPLTSGLLKEIYKKLNEEYYGPDV-VSDEEIALEWARIPHFY-YNFYVYKYATG 529

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                +L +           ++Y+  L++G+S +   +L    +++S P   E  + T +
Sbjct: 530 FSAATALANKILEEGDKAV-QRYIQFLKSGDSDYPLNVLKKAGVDMSSPEPIESAISTFK 588

Query: 618 KMIDDVEKM 626
           + +D  EK+
Sbjct: 589 EFVDRFEKL 597


>gi|296447486|ref|ZP_06889410.1| oligoendopeptidase, pepF/M3 family [Methylosinus trichosporium
           OB3b]
 gi|296255024|gb|EFH02127.1| oligoendopeptidase, pepF/M3 family [Methylosinus trichosporium
           OB3b]
          Length = 617

 Score =  474 bits (1220), Expect = e-131,   Method: Composition-based stats.
 Identities = 280/592 (47%), Positives = 388/592 (65%), Gaps = 6/592 (1%)

Query: 36  LPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC-HSLGAAIAEY 94
           LP WNL DLYP+ DS  ++ D+   E ++ +F   + G L           +LG A+A Y
Sbjct: 28  LPEWNLADLYPAMDSPALTADLATAERDAASFAADYRGRLQALAEGAAANETLGEAVARY 87

Query: 95  ERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALL 154
           E + EL+GRI SYA L Y+ + S P   KFY D+  K+ D    L+FF LE+N LD+ALL
Sbjct: 88  EALQELLGRIMSYAGLVYSGDTSDPARAKFYGDMQGKITDISTQLLFFQLELNRLDDALL 147

Query: 155 EQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF 214
           + +  + P   ++  W+++IRK K + LS+++E L  + S  GR A  R F E I SLRF
Sbjct: 148 DAAAEKAP-LSRWRPWLEDIRKEKPYELSDELERLFHEKSMTGRAAWNRLFDETIASLRF 206

Query: 215 KINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWR 274
           ++  +++ L  A     D+  ++R+ AA A+  T   +   F+ +TNTLAKD+EI DRWR
Sbjct: 207 QVGGKELTLEPALNLMQDTSEDIRREAALAVGATLKANLRTFALVTNTLAKDKEISDRWR 266

Query: 275 KYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPL 334
            +  +AD+RHLSN VEP V+EAL+ SV   +PK SHRYY+LK KW   + + +WDR APL
Sbjct: 267 GFHDVADARHLSNRVEPEVVEALVASVVAAHPKLSHRYYKLKAKWFGKEALDYWDRNAPL 326

Query: 335 PGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIP 394
           P     +  ++ ARD+VL +Y++F+P+M+ IA +FF  NWIDAP   GK  GAFAH T+P
Sbjct: 327 PQVPSHVYAWDEARDIVLSAYSRFAPRMAEIASRFFERNWIDAPVRPGKAPGAFAHPTVP 386

Query: 395 SVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLT 454
           SVHPY+L+N+ GK +DVMTLAHELGHG+H VL+   QG L   + LTLAETAS+FGE LT
Sbjct: 387 SVHPYVLVNFQGKTRDVMTLAHELGHGVHQVLAGA-QGALMAPTPLTLAETASVFGEMLT 445

Query: 455 FDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEI 514
           F +LL   S  E+++ LLA K+EDMLN++VRQI+FY FE K+H   R  G++   ++ E+
Sbjct: 446 FRALLAGTSDPEKKRALLAAKVEDMLNTVVRQIAFYSFERKVH-IARKEGELTAEKLCEL 504

Query: 515 WLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVD 574
           W+  Q +SLGP+  LSD  Y SFW  +PHF+ S FYVYAYAFG+CLVNSLY +Y+     
Sbjct: 505 WMSVQADSLGPSIRLSD-GYESFWAYIPHFVHSPFYVYAYAFGDCLVNSLYGVYQKA-ET 562

Query: 575 CFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            F E+Y  +L AG +K Y ELL P  ++  DP FW  GL+ +E +I ++E M
Sbjct: 563 GFAERYFALLEAGGAKPYGELLAPFGLDARDPAFWGIGLEMIEGLIAELEAM 614


>gi|296115080|ref|ZP_06833722.1| oligoendopeptidase F [Gluconacetobacter hansenii ATCC 23769]
 gi|295978417|gb|EFG85153.1| oligoendopeptidase F [Gluconacetobacter hansenii ATCC 23769]
          Length = 630

 Score =  474 bits (1220), Expect = e-131,   Method: Composition-based stats.
 Identities = 276/621 (44%), Positives = 394/621 (63%), Gaps = 13/621 (2%)

Query: 9   FFSNAFFRKALRSSDMT---TMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESL 65
           +FS+AF R    SS      ++ S  + G LPRW+L DLY S +S  +  D+E  E ++ 
Sbjct: 20  YFSHAFPRGVRVSSPAEGGGSVASPHD-GALPRWDLRDLYDSPESPRLQTDLEQAEEDAR 78

Query: 66  AFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFY 125
           AF   W G LA A    +  ++ +AI EY+RI E++GR ASYA L +  N +   I +F 
Sbjct: 79  AFADAWRGRLAQA----DGAAVASAIVEYQRIDEVLGRAASYAQLLFAANSADAKIARFS 134

Query: 126 TDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSND 185
             +N +L      L+FF LE+N + + ++ +  A DP    ++ +I+++R  + + LS++
Sbjct: 135 QSVNERLTAISTHLLFFTLEMNRIPDDVMARQMA-DPALAHWAPFIRDLRVFRPYQLSDE 193

Query: 186 MECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKAL 245
           +E +L + S  G  A  R F E + SLR  +  +++ L  A       DR  R  AA+A+
Sbjct: 194 VESVLHEKSVTGAAAWNRLFDETMASLRVPLAGEELTLGAALDRMSSPDRMARADAARAV 253

Query: 246 SHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYY 305
             T  +   +FS +TNTLAKD+ I D  R Y +   +R+ +N VE  V++AL+Q+V   Y
Sbjct: 254 GATLQERIRLFSLVTNTLAKDKAITDTLRHYPRPTSARNCANMVEDGVVDALVQAVTASY 313

Query: 306 PKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSII 365
           P+ SHRYY LK KWL ++ + +WDR APL    + +IP+  A   VL +Y  F P+M  I
Sbjct: 314 PRLSHRYYALKAKWLGVEKLQYWDRNAPLTTQDEPLIPWADATAQVLGAYEGFDPRMGEI 373

Query: 366 AEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFV 425
             +FF + WIDAP   GK SGAFAH T+PS HPY+LLNY G+ +DVMTLAHELGHG+H V
Sbjct: 374 GRRFFDNAWIDAPPVPGKASGAFAHPTVPSAHPYLLLNYRGRTRDVMTLAHELGHGVHQV 433

Query: 426 LSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVR 485
           L+   QG L + + LTLAETAS+FGE LTF +LL A +    R+++LA K+EDMLN++VR
Sbjct: 434 LAGA-QGYLMSGTPLTLAETASVFGEMLTFRALLDAQADPARRRLMLAAKVEDMLNTVVR 492

Query: 486 QISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFI 545
           Q++FY FE  +H ERRS   +   RI EIW ETQ ESLGPAF+ +  +Y  +W  VPHFI
Sbjct: 493 QVAFYRFETLVHEERRSGELL-PERIGEIWRETQAESLGPAFEFT-PDYDVYWTYVPHFI 550

Query: 546 ESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSD 605
            S FYVYAYAFG+CLVN+LYD+++S     F++KYL++LRAG +K + ELL P  ++ +D
Sbjct: 551 HSPFYVYAYAFGDCLVNALYDVFQS-GHPGFQDKYLDMLRAGGTKRHRELLAPFGLDAAD 609

Query: 606 PNFWERGLQTVEKMIDDVEKM 626
           P FW RGL  +   ID++E++
Sbjct: 610 PGFWNRGLDVIAGFIDELERI 630


>gi|51891875|ref|YP_074566.1| oligoendopeptidase [Symbiobacterium thermophilum IAM 14863]
 gi|51855564|dbj|BAD39722.1| oligoendopeptidase [Symbiobacterium thermophilum IAM 14863]
          Length = 599

 Score =  474 bits (1220), Expect = e-131,   Method: Composition-based stats.
 Identities = 146/607 (24%), Positives = 273/607 (44%), Gaps = 19/607 (3%)

Query: 27  MDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS 86
           +  +  + +  +W+L+ +Y S ++ E   D   +E       T ++G L      ++  +
Sbjct: 3   LKKRHEVPDEHKWDLDSVYGSVEAWE--KDYARVEEMLPQL-TAFQGRLG-----ESAAT 54

Query: 87  LGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEI 146
           L  A+   + + +L+ ++  +A +  + + ++ T +       +  A       F   EI
Sbjct: 55  LLQALKMRDEVSKLLEQVVVWARMKEDEDTANSTYQALSARGRSLYAKATAAAAFLTPEI 114

Query: 147 NTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFC 206
             +    +     Q+P    Y   ++N  + K H+ S ++E LL+   +VG      F  
Sbjct: 115 LAIPAETIRAWLDQEPGLAAYRHELENTLRQKAHVRSPEVEELLAQMGEVGAAPSDIFGK 174

Query: 207 ENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFIT 260
            N   L+F     +      + L +  +      R+VRK A +AL  T+ K  +  +   
Sbjct: 175 LNNADLKFGTIKDEQGNEVELTLGRYLRFLESPVRDVRKQAFEALFTTYRKFRNTIAATY 234

Query: 261 NTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWL 320
            +  K +    R R+Y     +     NV   V + L+ +  N    + HRY +L+++ L
Sbjct: 235 ASSVKADVFYARARRYPSARAAALFGTNVPESVYDNLL-ATVNKNLPSLHRYVQLRRRML 293

Query: 321 KLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFT-HNWIDAPQ 379
            LD ++ +D   P+       IP+E A + VL++ A    +   IA +  T   W+D  +
Sbjct: 294 GLDELHMYDLYTPMVADVDRKIPYEEAVETVLKALAPLGEEYCEIARRGMTVDRWVDIYE 353

Query: 380 YDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSS 439
            +GK SGA++ G+  +  PYIL+NY      + TLAHELGH +H   S   Q     + +
Sbjct: 354 NEGKRSGAYSFGS-YTTKPYILMNYQDNLDSMFTLAHELGHSMHSYFSRRHQPYHYADYT 412

Query: 440 LTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTE 499
           + +AE AS F E L  D LL++      +  L+ +++E    ++ RQ  F +FE   H  
Sbjct: 413 IFVAEVASTFNEALLTDYLLKSTDDPRLKMYLINHQLESFRTTLYRQTMFAEFEHIAHQR 472

Query: 500 RRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNC 559
             +   +    ++EI+ +  K   G    + D      W  +PHF  + FYVY YA G  
Sbjct: 473 VENGEALTADVLDEIYYDLNKRYYGTEGMVVDDLIAVEWARIPHFYSA-FYVYQYATGIS 531

Query: 560 LVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKM 619
              +L     +       E+YLN L++G+S + + LL    ++++ P   ++ L    ++
Sbjct: 532 AATALSQQVLTEGRPAV-ERYLNFLKSGSSDYSTNLLKQAGVDMTSPEPIQQALDVFARL 590

Query: 620 IDDVEKM 626
           +D +E++
Sbjct: 591 LDQMEQL 597


>gi|239826296|ref|YP_002948920.1| oligoendopeptidase F [Geobacillus sp. WCH70]
 gi|239806589|gb|ACS23654.1| oligoendopeptidase F [Geobacillus sp. WCH70]
          Length = 604

 Score =  474 bits (1219), Expect = e-131,   Method: Composition-based stats.
 Identities = 140/608 (23%), Positives = 277/608 (45%), Gaps = 19/608 (3%)

Query: 25  TTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC 84
            ++ S+  +     W LED++P+ ++ E   + + ++       + ++G L      ++ 
Sbjct: 8   KSLPSRSEIPVEETWRLEDIFPTDEAWE--QEFQAVKKMIPKL-SDYQGRLG-----ESA 59

Query: 85  HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL 144
            +L  A+   + I   +G++ +YA + Y+ + ++   +       +  ++    + F   
Sbjct: 60  DTLYEALQYQDEISMRLGKLYTYAHMRYDQDTTNAFYQGLNDRATSLYSEASSAMAFIVP 119

Query: 145 EINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRF 204
           EI  +DEA L     +      Y   +  I + + H+LS + E LL+  ++V + +   F
Sbjct: 120 EILAIDEAKLRSFLEEKKELKLYEHALDEINRQRPHVLSAEEEALLAQAAEVMQASSTTF 179

Query: 205 FCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSF 258
              N   L F     +      +   +  +    +DR VR+ A KA+  T+ K  + F+ 
Sbjct: 180 GMLNNADLTFPTIIDENGEEVEVTHGRFIRFLESTDRRVRRDAFKAVYDTYEKYKNTFAS 239

Query: 259 ITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKK 318
                 K +    R R+Y+   ++   SNN+   V + L+++V  +     HRY  L+KK
Sbjct: 240 TLAGAVKKDNFFARVRRYKSAREAALSSNNIPESVYDNLIETVHEH-LPLLHRYVRLRKK 298

Query: 319 WLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAP 378
            L LD ++ +D   PL    +  + +E A++ +L+  A    +   I ++   + W+D  
Sbjct: 299 ALGLDELHMYDLYTPLVQDVKMEVTYEEAKEYMLKGLAPLGEEYIGIVKEGLENRWVDVR 358

Query: 379 QYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNS 438
           +  GK SGA++ G+    +PYILLN+     ++ TL HE GH +H   + +TQ     + 
Sbjct: 359 ENKGKRSGAYSSGS-YGTNPYILLNWQDNVHNLFTLVHEFGHSVHSYYTRKTQPYPYGDY 417

Query: 439 SLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHT 498
           S+ +AE AS   E L  D LL+    +++R  LL + +E    ++ RQ  F +FE  +H 
Sbjct: 418 SIFVAEVASTCNEALLSDYLLKTIDDEKKRLYLLNHYLEGFRGTVFRQTMFAEFEHMIHM 477

Query: 499 ERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGN 558
           + +    +    +  ++ E  K+  G    + D E G  W  +PHF  + +     A G 
Sbjct: 478 KAQEGEALTADSLTSMYYELNKKYFGDDIVV-DKEIGLEWARIPHFYYNYYVYQY-ATGF 535

Query: 559 CLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
               +L             ++Y+  L+AG+S +  E+L    ++++      +  Q   +
Sbjct: 536 SAATALSRQILEEGEPAV-KRYIEFLKAGSSDYPIEVLKKAGVDMTSAEPIRQACQVFAE 594

Query: 619 MIDDVEKM 626
            +D++E+M
Sbjct: 595 KLDEMEQM 602


>gi|328911179|gb|AEB62775.1| Oligopeptidase F [Bacillus amyloliquefaciens LL3]
          Length = 670

 Score =  473 bits (1218), Expect = e-131,   Method: Composition-based stats.
 Identities = 141/614 (22%), Positives = 278/614 (45%), Gaps = 19/614 (3%)

Query: 19  LRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHA 78
              +    +  +  +     W LED++PS ++   + + + ++       + ++G LAH 
Sbjct: 63  TEENKAAQLPDRSEVKAEHTWRLEDIFPSDEAW--NKEFQAVKELIPNL-SSFKGTLAH- 118

Query: 79  TNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKV 138
               +  +L AA+   + +   +G++ +YA +  + +  +   +       +  +     
Sbjct: 119 ----SADNLYAALTAQDEVTSRLGKLYAYAHMRSDQDTGNSFYQGLNDKAASLYSQAASA 174

Query: 139 LIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGR 198
             +   EI  + E  L Q   +      YS  I+ I K + H+LS   E LL++ S+   
Sbjct: 175 TAYIEPEILAIQEDKLHQFILEKEELKVYSHAIEEITKQRPHVLSEKEEALLAEASEALS 234

Query: 199 EALKRFFCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKS 252
                F   N   + F           +I           SDREVRK+A KA+  T+ + 
Sbjct: 235 SPSNTFSVLNNADITFPSIKDENGKETQITHGNFINFLESSDREVRKNAFKAVYKTYGQY 294

Query: 253 SHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRY 312
            +  +   +   K +    R +KY+   ++   +NN+   V + L++++  +     HRY
Sbjct: 295 KNTMATTLSGTVKKDNFYARVKKYKSAREAALSNNNIPEEVYDNLIKTINKH-LPLLHRY 353

Query: 313 YELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTH 372
            +L+KK L LD ++ +D   PL   S   + +E A+D +L+  A    + + I ++   +
Sbjct: 354 IDLRKKVLGLDEVHNYDLYTPLVKDSGMKVTYEEAKDYMLKGLAPLGDEYASILKEGLEN 413

Query: 373 NWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQG 432
            W+D  +  GK SGA++ GT    +PYIL+N+     ++ TL HE GH +H   + + Q 
Sbjct: 414 RWVDVYENKGKRSGAYSSGT-YGTNPYILMNWHDTVNNLFTLVHEFGHSVHSYYTRKYQP 472

Query: 433 ILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDF 492
               N S+ +AE AS   E L  + +L +   +++R  LL + +E    ++ RQ  F +F
Sbjct: 473 YPYGNYSIFVAEVASTTNEALLGEYMLNSLKDEKQRLYLLNHMLEGFRGTVFRQTMFAEF 532

Query: 493 ELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVY 552
           E  +HT+ +    +    +N+++ +  K+  G    + D E    W  +PHF  + +   
Sbjct: 533 EHLIHTKAQEGEPLTPELLNKLYYDLNKKYFGDNMVI-DEEISLEWSRIPHFYYNYYVYQ 591

Query: 553 AYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERG 612
             A G     +L             E+Y N L+AG+S++  ++L    ++++ P   E  
Sbjct: 592 Y-ATGYSAAQALSSQILKEGKPAV-ERYTNFLKAGSSEYPIDILKKAGVDMTSPEPIEAA 649

Query: 613 LQTVEKMIDDVEKM 626
            +  E+ ++++E++
Sbjct: 650 CKMFEEKLNEMEEL 663


>gi|60545050|gb|AAQ08885.2| oligopeptidase F [Bacillus amyloliquefaciens]
          Length = 684

 Score =  473 bits (1217), Expect = e-131,   Method: Composition-based stats.
 Identities = 138/630 (21%), Positives = 281/630 (44%), Gaps = 19/630 (3%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           ++ ++              +    +  +  +     W LED++PS ++   + + + ++ 
Sbjct: 61  RFFNWLEVKKTRGITMTEENKAAQLPDRSEVKAEHTWRLEDIFPSDEAW--NKEFQAVKE 118

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
                 + ++G LAH     +  +L AA+   + +   +G++ +YA +  + +  +   +
Sbjct: 119 LIPNL-SSFKGTLAH-----SADNLYAALTAQDEVTNRLGKLYAYAHMRSDQDTGNSFYQ 172

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
                  +  +       +   EI  + E  L Q   +      YS  I+ I K + H+L
Sbjct: 173 GLNDKAASLYSQAASATAYIEPEILAIQEDKLHQFILEKEELKLYSHAIEEITKQRPHVL 232

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQ------KIPLTKAYKSFFDSDRE 236
           S   E LL++ S+        F   N   + F           +I           S+RE
Sbjct: 233 SEQEEALLAEASEALSSPSNTFSVLNNADITFPSIKDENGKETQITHGNFINFLESSNRE 292

Query: 237 VRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEA 296
           VRK+A +A+  T+ +  +  +   +   K +    R +KY+   ++   +N++   V + 
Sbjct: 293 VRKNAFEAVYKTYGQYKNTMATTLSGTVKKDNFYARVKKYKSAREAALSNNSIPEEVYDN 352

Query: 297 LMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYA 356
           L++++  +     HRY +L+KK L LD ++ +D   PL   S   + +E A+D +L+  A
Sbjct: 353 LIKTINKH-LPLLHRYIDLRKKVLGLDEVHIYDLYTPLVKDSGMKVTYEEAKDYMLKGLA 411

Query: 357 KFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAH 416
               + + I ++   + W+D  +  GK SGA++ GT    +PYIL+N+     ++ TL H
Sbjct: 412 PLGEEYASILKEGLENRWVDIYENKGKRSGAYSSGT-YGTNPYILMNWHDNVNNLFTLVH 470

Query: 417 ELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKI 476
           E GH +H   + + Q     N S+ +AE AS   E L  + +L +   +++R  LL + +
Sbjct: 471 EFGHSVHSYYTRKYQPYPYGNYSIFVAEVASTTNEALLGEYMLNSLKDEKQRLYLLNHML 530

Query: 477 EDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGS 536
           E    ++ RQ  F +FE  +HT+ +    +    +NE++ +  K+  G    + D E   
Sbjct: 531 EGFRGTVFRQTMFAEFEHLIHTKAQEGEPLTPELLNELYYDLNKKYFGDNMVI-DKEISL 589

Query: 537 FWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELL 596
            W  +PHF  + +     A G     +L             E+Y   L+AG+S++  ++L
Sbjct: 590 EWSRIPHFYYNYYVYQY-ATGYSAAQALSSQILKEGKPAV-ERYTEFLKAGSSEYPIDIL 647

Query: 597 LPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
               ++++ P   E   +  E+ ++++E++
Sbjct: 648 KKAGVDMTSPEPIEAACKMFEEKLNEMEEL 677


>gi|288553402|ref|YP_003425337.1| peptidase [Bacillus pseudofirmus OF4]
 gi|288544562|gb|ADC48445.1| peptidase [Bacillus pseudofirmus OF4]
          Length = 600

 Score =  473 bits (1216), Expect = e-131,   Method: Composition-based stats.
 Identities = 142/604 (23%), Positives = 280/604 (46%), Gaps = 19/604 (3%)

Query: 29  SQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG 88
            +  +    +W+LE ++ +    E   +   ++       T ++G L      ++  SL 
Sbjct: 7   KRTEVPEASKWDLEAIFATDKEWE--EEFSAVKSLYPQM-TAYKGKLG-----ESADSLY 58

Query: 89  AAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINT 148
            A+ + + I E + R+ +YA +  + + ++   +  +    +  A   + + +   E+  
Sbjct: 59  EALQKQDEISERLNRLYTYAHMRNDEDTTNSLYQGLHDRAMSLSAQVAQSVAYLTPELLE 118

Query: 149 LDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCEN 208
           LDE +++Q   +     +Y   ++ + K K H+LS   E +L+  S+  +   + F   N
Sbjct: 119 LDEKIIKQFINEHEGLNRYEHMLEELYKEKPHVLSEAEEAILAQASEALQSPGQTFGMLN 178

Query: 209 IESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNT 262
              L F     +      I   +        DR+VR++A KA+ +T+ +  + F+   + 
Sbjct: 179 NADLTFPTIKDEDGEDVEITHGRFISLLESKDRKVRENAFKAVYNTYGQFKNTFAQTLSG 238

Query: 263 LAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKL 322
             K +      RKY    ++    N++   V + L++++        HRY +L+KK L +
Sbjct: 239 QVKKDLFFANVRKYRSAREAALSQNHIPEVVYDQLVETINKNI-HLLHRYVKLRKKVLGV 297

Query: 323 DTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDG 382
           + ++ +D   PL   S+  + +E A+DLV+Q       +   + ++ FT  W+D  +  G
Sbjct: 298 EELHMYDLYTPLVEGSKVKVSYEEAKDLVIQGVEPLGEEYVNVLKEGFTKRWVDVEETVG 357

Query: 383 KGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTL 442
           K SGA++ G      PYIL+N+     ++ TLAHE GH +H   + + Q  +  + ++ +
Sbjct: 358 KRSGAYSSG-AYGTMPYILMNWQDNIDNLFTLAHEFGHSMHSYYTRKHQPYVYGDYTIFV 416

Query: 443 AETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRS 502
           AE AS   E+L  D L++  + K+++  LL + +E    ++ RQ  F +FE K+H     
Sbjct: 417 AEVASTLNESLLNDYLVKTTTDKQQKLYLLNHFLEGFRGTVFRQTMFAEFEQKIHELSAD 476

Query: 503 TGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVN 562
              +    +   + E  K+  G    + D E G  W  +PHF   +FYVY YA G     
Sbjct: 477 GEALTPELLTTTYYELNKKYFGEEMVV-DEEIGLEWARIPHFY-YNFYVYQYATGYSAAA 534

Query: 563 SLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
           +L             ++YL+ L+AG+S    E+L    ++++     E  L+  E+ +D+
Sbjct: 535 ALSKQILEEGEPAV-DRYLSFLKAGSSNFPIEVLKEAGVDMTSKEPIEEALRLFEETLDE 593

Query: 623 VEKM 626
           +E++
Sbjct: 594 MERL 597


>gi|39937245|ref|NP_949521.1| peptidase M3B oligoendopeptidase-like clade 3 [Rhodopseudomonas
           palustris CGA009]
 gi|39651103|emb|CAE29626.1| putative oligoendopeptidase F [Rhodopseudomonas palustris CGA009]
          Length = 638

 Score =  473 bits (1216), Expect = e-131,   Method: Composition-based stats.
 Identities = 286/592 (48%), Positives = 388/592 (65%), Gaps = 6/592 (1%)

Query: 36  LPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGA-AIAEY 94
           LP WNL DLYP+  S E++ D++ ++ E  +F+  ++G LA  T +       A A+  Y
Sbjct: 51  LPEWNLMDLYPAIGSPEVAADLDRLDAECASFEADFKGRLAEETAKDGGALWLAGAVKRY 110

Query: 95  ERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALL 154
           E I +L GR+ SYA L +  +   P   KFY D++ +L      L+FF LE+N +D+A+L
Sbjct: 111 EAIEDLAGRLGSYAGLVHAGDSVDPVKSKFYGDVSERLTAASVHLLFFTLELNRVDDAVL 170

Query: 155 EQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF 214
           E +  Q P    Y  WI+++RK K + L + +E L  + SQ G  A  R F + I SLRF
Sbjct: 171 ETAM-QTPELGHYRPWIEDLRKDKPYQLEDRIEQLFHEKSQTGYGAFNRLFDQTISSLRF 229

Query: 215 KINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWR 274
           ++  +++ +        D     RK AA+AL+ TF  +   F+ ITNTLAKD+EI DRWR
Sbjct: 230 RVGGKELAIEPTLNLMQDRAPAKRKVAAEALAKTFKANERTFALITNTLAKDKEISDRWR 289

Query: 275 KYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPL 334
            +E +ADSRHL+N VE  V++AL+ SV+  YPK SHRYY+LK  W K   + +WDR APL
Sbjct: 290 GFEDVADSRHLANRVEREVVDALVASVRAAYPKLSHRYYKLKAGWFKKKKLPYWDRNAPL 349

Query: 335 PGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIP 394
           P  +   I +  AR++VL +Y  FSP+M+ IAE+FFT  WIDAP   GK  GAF+H T P
Sbjct: 350 PFAATGSIAWPDARNMVLTAYKAFSPEMAQIAERFFTDRWIDAPVRPGKAPGAFSHPTTP 409

Query: 395 SVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLT 454
           S HPY+L+NY GKP+DVMTLAHELGHG+H VL+++  G L   + LTLAETAS+FGE LT
Sbjct: 410 SAHPYVLMNYQGKPRDVMTLAHELGHGVHQVLAAKN-GALMAPTPLTLAETASVFGEMLT 468

Query: 455 FDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEI 514
           F  LL     +++R+ LLA K+EDM+N++VRQI+FY FE  +HTERRS   +   RI EI
Sbjct: 469 FRRLLTQTKDRKQRQALLAGKVEDMINTVVRQIAFYSFERAVHTERRSGE-LTAQRIGEI 527

Query: 515 WLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVD 574
           WL  Q ESLGPA ++    Y SFWM +PHFI S FYVYAYAFG+CLVNSLY +Y  +  +
Sbjct: 528 WLSVQGESLGPAIEIK-PGYESFWMYIPHFIHSPFYVYAYAFGDCLVNSLYAVY-EHAQE 585

Query: 575 CFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            F E+YL +L AG +KHYSELL P  ++  +P+FW+ GL  +  MID++E M
Sbjct: 586 GFAERYLAMLAAGGTKHYSELLAPFGLDAKNPSFWDGGLSVIAGMIDELEAM 637


>gi|296533046|ref|ZP_06895692.1| oligoendopeptidase F [Roseomonas cervicalis ATCC 49957]
 gi|296266632|gb|EFH12611.1| oligoendopeptidase F [Roseomonas cervicalis ATCC 49957]
          Length = 610

 Score =  472 bits (1214), Expect = e-131,   Method: Composition-based stats.
 Identities = 256/594 (43%), Positives = 370/594 (62%), Gaps = 8/594 (1%)

Query: 32  NLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAI 91
             G LP W+L DLY       +  D+  +E E+ AF     G L       +  +L  AI
Sbjct: 22  EAGALPVWDLSDLYAGSGDPRLEADLARVEAEARAFHEAHAGKLEKM----SGDALAEAI 77

Query: 92  AEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDE 151
           A YERI E++GR+ SYA L +  +       +FY  +  ++       +FF+LE+N LDE
Sbjct: 78  AAYERIEEVLGRVMSYASLVFAGDAQDAANGRFYQTMQERVTAISSHTLFFSLELNKLDE 137

Query: 152 ALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIES 211
           A+LE+ ++      +Y  +++++R  + H LS+++E LL +    GR A  R F E +  
Sbjct: 138 AVLEKKFS-SRALARYRPFLRDLRVFRPHQLSDEVERLLHEKEVTGRAAWNRLFDETVAG 196

Query: 212 LRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD 271
           +  K+ ++ + ++ A     D DR VR++AA+ +S  F + + +F+ ITNTLAKD+EI D
Sbjct: 197 MEVKVGEEVLNVSGALNKLSDRDRSVREAAARGVSAAFGEKARLFTLITNTLAKDKEIID 256

Query: 272 RWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRL 331
            WR Y +   SR+ +N VE  V++AL+ +V   +P  SHRYY +K KWL L  +  WDR 
Sbjct: 257 GWRHYPRPGSSRNRANMVEDAVVDALVDAVVASFPALSHRYYAMKAKWLGLPKLQHWDRN 316

Query: 332 APLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHG 391
           APLP      IP++ ARD VL +Y+ FSP++  I ++FF   WIDA    GK  GAFAH 
Sbjct: 317 APLPAEDDSQIPWDAARDRVLSAYSAFSPELGRIGKEFFDKPWIDAALRPGKSGGAFAHP 376

Query: 392 TIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGE 451
           T+PS HPY+LLNY GK +DVMTLAHELGHG+H VL+++ QG L + + LTLAETAS+FGE
Sbjct: 377 TVPSAHPYLLLNYHGKSRDVMTLAHELGHGVHQVLAAK-QGYLMSGTPLTLAETASVFGE 435

Query: 452 TLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRI 511
            LTF ++L A +  + R+ LLA K+EDMLN++VRQI+FY FE  LH  RR    +    I
Sbjct: 436 MLTFRAVLDAETDPKRRRALLAGKVEDMLNTVVRQIAFYRFETLLHDARRKGE-LSREEI 494

Query: 512 NEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSN 571
             +W+  Q ESLGPAF+ +  +Y  +W  +PHFI + FYVYAYAFG+CLVN+LY +++  
Sbjct: 495 GALWMRVQVESLGPAFEFT-PDYEIYWSYIPHFIHTPFYVYAYAFGDCLVNALYGVFQEG 553

Query: 572 TVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEK 625
            V  F+ KYL +L+AG +  + ELL P  ++ SDP FW +GL  +   ID++E+
Sbjct: 554 GVKDFQAKYLELLKAGGTLRHKELLAPFGLDASDPAFWHKGLNVIAGFIDELER 607


>gi|295401665|ref|ZP_06811632.1| oligoendopeptidase F [Geobacillus thermoglucosidasius C56-YS93]
 gi|294976285|gb|EFG51896.1| oligoendopeptidase F [Geobacillus thermoglucosidasius C56-YS93]
          Length = 604

 Score =  471 bits (1213), Expect = e-130,   Method: Composition-based stats.
 Identities = 135/608 (22%), Positives = 275/608 (45%), Gaps = 19/608 (3%)

Query: 25  TTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC 84
            ++  +  +     W LED++P+ ++ E   + + ++       + ++G L      ++ 
Sbjct: 8   KSLPLRSEIPVEETWRLEDIFPTDEAWE--QEFQEVKKMIPKL-SDYQGRLG-----ESA 59

Query: 85  HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL 144
            +L  A+   ++I   +G++ +YA + Y+ + ++   +       +  ++    + F   
Sbjct: 60  DTLYEALQYQDKISMRLGKLYTYAHMRYDQDTTNAFYQGLNDRATSLYSEASSAMAFIVP 119

Query: 145 EINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRF 204
           EI  +DEA L     +      Y   +  I + + H+LS + E +L+  ++V + +   F
Sbjct: 120 EILAIDEAKLRAFLEEKKELKLYEHALDEINRQRPHVLSAEEEAILAQAAEVMQASSTTF 179

Query: 205 FCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSF 258
              N   L F     +      +   +  +    +DR VR+ A KA+  T+ K  + F+ 
Sbjct: 180 GMLNNADLTFPTIIDENGEEVEVTHGRFIRFLESTDRRVRRDAFKAVYETYEKYKNTFAS 239

Query: 259 ITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKK 318
                 K +    R R+Y+   ++   +NN+   V + L++++  +     HRY  L+KK
Sbjct: 240 TLAGAVKKDNFFARVRRYKSAREAALSNNNIPESVYDNLIETIHEH-LPLLHRYVRLRKK 298

Query: 319 WLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAP 378
            L LD ++ +D   PL    +  + +E A++ +L+  A    +   I ++   + W+D  
Sbjct: 299 VLGLDELHMYDLYTPLVQDVKMEVTYEEAKEYMLKGLAPLGDEYIRIVKEGLENRWVDVR 358

Query: 379 QYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNS 438
           +  GK SGA++ G     +PYILLN+     ++ TL HE GH +H   + +TQ     N 
Sbjct: 359 ENKGKRSGAYSSG-AYGTNPYILLNWQDNVNNLFTLVHEFGHSVHSYYTRKTQPYPYGNY 417

Query: 439 SLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHT 498
           S+ +AE AS   E L  D LL+    +++R  LL   +E    ++ RQ  F +FE  +H 
Sbjct: 418 SIFVAEVASTCNEALLNDYLLKTIDDEKKRLYLLNYYLEGFRGTVFRQTMFAEFEHMIHI 477

Query: 499 ERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGN 558
           + +    +    +  ++ E  K+  G    + D E G  W  +PHF  + +     A G 
Sbjct: 478 KAQEGEALTADSLTSMYYELNKKYFGDDIVV-DKEIGLEWARIPHFYYNYYVYQY-ATGF 535

Query: 559 CLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
               +L             ++Y+  L+AG+S +  E+L    ++++      +  Q   +
Sbjct: 536 SAATALSRQILEEGEPAV-KRYIEFLKAGSSDYPIEVLKKAGVDMTSAEPIRQACQVFAE 594

Query: 619 MIDDVEKM 626
            ++++E++
Sbjct: 595 KLEEMEQL 602


>gi|295702860|ref|YP_003595935.1| oligoendopeptidase F [Bacillus megaterium DSM 319]
 gi|294800519|gb|ADF37585.1| oligoendopeptidase F [Bacillus megaterium DSM 319]
          Length = 605

 Score =  471 bits (1213), Expect = e-130,   Method: Composition-based stats.
 Identities = 143/611 (23%), Positives = 278/611 (45%), Gaps = 19/611 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           S +  + S+  +     W LED++ S D+ E   + E ++      + +++G L      
Sbjct: 5   SKVKKLPSRSEIKVEDTWKLEDIFASDDAWE--KEFEEVKALIPQME-KFKGKLG----- 56

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
           ++  +L  A+ E + +   + ++ +YA + Y+ + ++   +     I          L +
Sbjct: 57  ESAQTLYDALQEQDELTMRVSKLYTYAHMRYDQDTTNSFYQGLNDRIKTLYTQIASALSY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI +++E+ ++Q  A+      Y+  +  I + + H+LS   E LL+  S+V   + 
Sbjct: 117 VTPEILSIEESKIKQYMAEHKELKLYAHALDEITRERPHILSESEEALLAQASEVLGSSS 176

Query: 202 KRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L F     +      I   +  +    SDR VR+ A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLEFPSIKDENGEEVEITHGRYIRFLESSDRRVREEAFKAVYETYGKFKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K +    R R Y     S   +NN+   V + L+++  N      HRY +L
Sbjct: 237 FASTLSGTVKKDNFSARVRHYNSARHSALSTNNIPEEVYDNLVKT-VNDNLHLLHRYIDL 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +KK L ++ ++ +D   PL    +  + +E A+D +L+           + ++ F + W+
Sbjct: 296 RKKVLGIEELHMYDLYTPLVKDVKMEVTYEEAKDYILKGLKPLGEDYLNVLKEGFENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ GT    +PYIL+N+     ++ TLAHE GH +H   + +TQ    
Sbjct: 356 DVHENKGKRSGAYSSGT-YGTNPYILMNWQDNVNNLFTLAHEFGHSVHSYYTRKTQPYPY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    +++R  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTIDDEKQRLYLLNHYLEGFRGTVFRQTMFAEFEHD 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H   ++   +    + +++ +  K+  G    + D E G  W  +PHF  + +     A
Sbjct: 475 VHVRAQNGEPLTPELLTKLYYDLNKKYFGDNLVI-DEEIGLEWARIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L             E+Y+  L++G+S +  E+L    ++++     E  L  
Sbjct: 533 TGFSAAAALSKQILEEGN-AAVERYVGFLKSGSSDYPIEVLKKAGVDMTTSQPIEEALAV 591

Query: 616 VEKMIDDVEKM 626
            E+ + ++E++
Sbjct: 592 FEEKLTEMERL 602


>gi|312112000|ref|YP_003990316.1| oligoendopeptidase F [Geobacillus sp. Y4.1MC1]
 gi|311217101|gb|ADP75705.1| oligoendopeptidase F [Geobacillus sp. Y4.1MC1]
          Length = 604

 Score =  471 bits (1212), Expect = e-130,   Method: Composition-based stats.
 Identities = 135/608 (22%), Positives = 274/608 (45%), Gaps = 19/608 (3%)

Query: 25  TTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC 84
            ++  +  +     W LED++P+ ++ E   + + ++       + ++G L       + 
Sbjct: 8   KSLPLRSEIPVEETWRLEDIFPTDEAWE--QEFQEVKKMIPKL-SDYQGRLGV-----SA 59

Query: 85  HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL 144
            +L  A+   ++I   +G++ +YA + Y+ + ++   +       +  ++    + F   
Sbjct: 60  DTLYEALQYQDKISMRLGKLYTYAHMRYDQDTTNAFYQGLNDRATSLYSEASSAMAFIVP 119

Query: 145 EINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRF 204
           EI  +DEA L     +      Y   +  I + + H+LS + E +L+  ++V + +   F
Sbjct: 120 EILAIDEAKLRAFLEEKKELKLYEHALDEINRQRPHVLSAEEEAILAQAAEVMQASSTTF 179

Query: 205 FCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSF 258
              N   L F     +      +   +  +    +DR VR+ A KA+  T+ K  + F+ 
Sbjct: 180 GMLNNADLTFPTIIDENGEEVEVTHGRFIRFLESTDRRVRRDAFKAVYETYEKYKNTFAS 239

Query: 259 ITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKK 318
                 K +    R R+Y+   ++   +NN+   V + L++++  +     HRY  L+KK
Sbjct: 240 TLAGAVKKDNFFARVRRYKSAREAALSNNNIPESVYDNLIETIHEH-LPLLHRYVRLRKK 298

Query: 319 WLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAP 378
            L LD ++ +D   PL    +  + +E A++ +L+  A    +   I ++   + W+D  
Sbjct: 299 VLGLDELHMYDLYTPLVQDVKMEVTYEEAKEYMLKGLAPLGDEYIRIVKEGLENRWVDVR 358

Query: 379 QYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNS 438
           +  GK SGA++ G     +PYILLN+     ++ TL HE GH +H   + +TQ     N 
Sbjct: 359 ENKGKRSGAYSSG-AYGTNPYILLNWQDNVNNLFTLVHEFGHSVHSYYTRKTQPYPYGNY 417

Query: 439 SLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHT 498
           S+ +AE AS   E L  D LL+    +++R  LL   +E    ++ RQ  F +FE  +H 
Sbjct: 418 SIFVAEVASTCNEALLNDYLLKTIDDEKKRLYLLNYYLEGFRGTVFRQTMFAEFEHMIHI 477

Query: 499 ERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGN 558
           + +    +    +  ++ E  K+  G    + D E G  W  +PHF  + +     A G 
Sbjct: 478 KAQEGEALTADSLTSMYYELNKKYFGDDIVV-DKEIGLEWARIPHFYYNYYVYQY-ATGF 535

Query: 559 CLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
               +L             ++Y+  L+AG+S +  E+L    ++++      +  Q   +
Sbjct: 536 SAATALSRQILEEGEPAV-KRYIEFLKAGSSDYPIEVLKKAGVDMTSAEPIRQACQVFAE 594

Query: 619 MIDDVEKM 626
            ++++E++
Sbjct: 595 KLEEMEQL 602


>gi|121535192|ref|ZP_01667007.1| oligoendopeptidase F [Thermosinus carboxydivorans Nor1]
 gi|121306183|gb|EAX47110.1| oligoendopeptidase F [Thermosinus carboxydivorans Nor1]
          Length = 625

 Score =  471 bits (1211), Expect = e-130,   Method: Composition-based stats.
 Identities = 161/619 (26%), Positives = 276/619 (44%), Gaps = 19/619 (3%)

Query: 14  FFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEG 73
           FF  A ++S    +  +E + +  +W LED+Y S +  E   D   +++        ++G
Sbjct: 13  FFPTAAKTSSTAGLPVREEIPDKYKWRLEDIYASEELWE--QDFAKLKNSLPQLAA-YKG 69

Query: 74  NLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA 133
            LAH     +  +L   +   +      G++ +YA +  + N ++   +       A LA
Sbjct: 70  QLAH-----SAQNLLKCLKARDEAGITAGKLYAYARMRRDENSANAKYQALTGKTEALLA 124

Query: 134 DFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDT 193
           +   V  F   EI  + E  L +   Q+    +YS +  N+ + KKH+LS   E +LS  
Sbjct: 125 EMGAVTAFIEPEIIAMPEEKLNEFRRQEQGLAEYSFYFDNLMRQKKHVLSPAEEEILSRA 184

Query: 194 SQVGREALKRFFCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSH 247
           S+V + A   F       LRF            +   +        DR VR++A   L +
Sbjct: 185 SEVTQAAENIFNMLAHADLRFPQIQNESGQTVTLSEGRFRSFIMSPDRRVRQAAFTGLFN 244

Query: 248 TFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPK 307
           T+ +  + F+       K      R RKY    ++    +NV   V   L+ +  + +  
Sbjct: 245 TYKQFRNTFAATLGGSVKKNIFYTRTRKYNSTLEAALEPDNVPLAVYNNLI-ATVHEHLP 303

Query: 308 TSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAE 367
             HRY  LKK+ L+LD ++ +D   PL    +  IP++ A  +V ++      + S I  
Sbjct: 304 LLHRYVALKKQALRLDEIHMYDLYVPLVSDVRITIPYDEALQMVQEALKPLGAEYSEILN 363

Query: 368 KFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLS 427
           K  T  WID  +  GK +GA++ GT   VHP++LLNY  +  DV TLAHE+GH IH   S
Sbjct: 364 KGLTSGWIDVYENQGKQTGAYSWGT-YGVHPFVLLNYNDRYDDVSTLAHEMGHAIHSYYS 422

Query: 428 SETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQI 487
              Q   T + +   AE AS   E L  D +L+    K ++   L   +E +  ++ RQ 
Sbjct: 423 HANQPYATASYTTFTAEVASTTNEILLIDHMLKVTHDKRQKLYFLNQYLEAVRGTVYRQT 482

Query: 488 SFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIES 547
            F +FE  L+ +      I    ++++W E  ++  GP   + D E    W  +PHF   
Sbjct: 483 MFAEFEKLLYEKAEDGETITADMLDDLWRELNRKYYGPDIVV-DEEIAVEWARIPHFY-W 540

Query: 548 SFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPN 607
            FYVY Y  G     +L +  +       +++Y+  L++G   +   +L    +++S P 
Sbjct: 541 HFYVYQYVTGYAAATALAEQIQREGEPA-QKRYIEFLKSGGCDYSINILKRAGVDMSSPQ 599

Query: 608 FWERGLQTVEKMIDDVEKM 626
                L    + ++++EK+
Sbjct: 600 PVAVTLNKFGERLNELEKL 618


>gi|308173118|ref|YP_003919823.1| oligopeptidase F [Bacillus amyloliquefaciens DSM 7]
 gi|307605982|emb|CBI42353.1| oligopeptidase F [Bacillus amyloliquefaciens DSM 7]
 gi|328554040|gb|AEB24532.1| oligoendopeptidase F [Bacillus amyloliquefaciens TA208]
          Length = 609

 Score =  471 bits (1211), Expect = e-130,   Method: Composition-based stats.
 Identities = 141/614 (22%), Positives = 278/614 (45%), Gaps = 19/614 (3%)

Query: 19  LRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHA 78
              +    +  +  +     W LED++PS ++   + + + ++       + ++G LAH 
Sbjct: 2   TEENKAAQLPDRSEVKAEHTWRLEDIFPSDEAW--NKEFQAVKELIPNL-SSFKGTLAH- 57

Query: 79  TNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKV 138
               +  +L AA+   + +   +G++ +YA +  + +  +   +       +  +     
Sbjct: 58  ----SADNLYAALTAQDEVTSRLGKLYAYAHMRSDQDTGNSFYQGLNDKAASLYSQAASA 113

Query: 139 LIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGR 198
             +   EI  + E  L Q   +      YS  I+ I K + H+LS   E LL++ S+   
Sbjct: 114 TAYIEPEILAIQEDKLHQFILEKEELKVYSHAIEEITKQRPHVLSEKEEALLAEASEALS 173

Query: 199 EALKRFFCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKS 252
                F   N   + F           +I           SDREVRK+A KA+  T+ + 
Sbjct: 174 SPSNTFSVLNNADITFPSIKDENGKETQITHGNFINFLESSDREVRKNAFKAVYKTYGQY 233

Query: 253 SHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRY 312
            +  +   +   K +    R +KY+   ++   +NN+   V + L++++  +     HRY
Sbjct: 234 KNTMATTLSGTVKKDNFYARVKKYKSAREAALSNNNIPEEVYDNLIKTINKH-LPLLHRY 292

Query: 313 YELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTH 372
            +L+KK L LD ++ +D   PL   S   + +E A+D +L+  A    + + I ++   +
Sbjct: 293 IDLRKKVLGLDEVHNYDLYTPLVKDSGMKVTYEEAKDYMLKGLAPLGDEYASILKEGLEN 352

Query: 373 NWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQG 432
            W+D  +  GK SGA++ GT    +PYIL+N+     ++ TL HE GH +H   + + Q 
Sbjct: 353 RWVDVYENKGKRSGAYSSGT-YGTNPYILMNWHDTVNNLFTLVHEFGHSVHSYYTRKYQP 411

Query: 433 ILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDF 492
               N S+ +AE AS   E L  + +L +   +++R  LL + +E    ++ RQ  F +F
Sbjct: 412 YPYGNYSIFVAEVASTTNEALLGEYMLNSLKDEKQRLYLLNHMLEGFRGTVFRQTMFAEF 471

Query: 493 ELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVY 552
           E  +HT+ +    +    +N+++ +  K+  G    + D E    W  +PHF  + +   
Sbjct: 472 EHLIHTKAQEGEPLTPELLNKLYYDLNKKYFGDNMVI-DEEISLEWSRIPHFYYNYYVYQ 530

Query: 553 AYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERG 612
             A G     +L             E+Y N L+AG+S++  ++L    ++++ P   E  
Sbjct: 531 Y-ATGYSAAQALSSQILKEGKPAV-ERYTNFLKAGSSEYPIDILKKAGVDMTSPEPIEAA 588

Query: 613 LQTVEKMIDDVEKM 626
            +  E+ ++++E++
Sbjct: 589 CKMFEEKLNEMEEL 602


>gi|294497489|ref|YP_003561189.1| oligoendopeptidase F [Bacillus megaterium QM B1551]
 gi|294347426|gb|ADE67755.1| oligoendopeptidase F [Bacillus megaterium QM B1551]
          Length = 605

 Score =  470 bits (1210), Expect = e-130,   Method: Composition-based stats.
 Identities = 144/611 (23%), Positives = 278/611 (45%), Gaps = 19/611 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           S +  + S+  +     W LED++ S D+ E   + E ++      + +++G L      
Sbjct: 5   SKVKKLPSRSEIKVEDTWKLEDIFASDDAWE--KEFEEVKALIPQME-KFKGKLG----- 56

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
           ++  +L  A+ E + +   + ++ +YA + Y+ + ++   +     I          L +
Sbjct: 57  ESAQTLYDALQEQDELTMRVSKLYTYAHMRYDQDTTNSFYQGLNDRIKTLYTQIASALSY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI +++E+ ++Q   +      Y+  +  I + + H+LS   E LL+  S+V   + 
Sbjct: 117 VTPEILSIEESKIKQYMVEHKELKLYAHALDEITRERPHILSESEEALLAQASEVLGSSS 176

Query: 202 KRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L F     +      I   +  +    SDR VRK A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLEFPSIKDENGEEVEITHGRYIRFLESSDRRVRKEAFKAVYETYGKFKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K +    R R Y     S   +NN+   V + L+++  N      HRY +L
Sbjct: 237 FASTLSGTVKKDNFSARVRHYNSARHSALSTNNIPEEVYDNLVKT-VNDNLHLLHRYIDL 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +KK L ++ ++ +D   PL    +  + +E A+D +L+           + ++ F + W+
Sbjct: 296 RKKVLGIEELHMYDLYTPLVKDVKMEVTYEEAKDYILKGLKPLGEDYLNVLKEGFENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ GT    +PYIL+N+     ++ TLAHE GH +H   + +TQ    
Sbjct: 356 DVHENKGKRSGAYSSGT-YGTNPYILMNWQDNVNNLFTLAHEFGHSVHSYYTRKTQPYPY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    +++R  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTIDDEKQRLYLLNHYLEGFRGTVFRQTMFAEFEHD 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H   ++   +    + +++ +  K+  G    + D E G  W  +PHF  + +     A
Sbjct: 475 VHVRAQNGEPLTPELLTKLYYDLNKKYFGDNLVI-DEEIGLEWARIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L         D   E+Y+  L++G+S +  E+L    ++++     E  L  
Sbjct: 533 TGFSAAAALSKQILEEG-DAAVERYVGFLKSGSSDYPIEVLKKAGVDMTTSRPIEEALAV 591

Query: 616 VEKMIDDVEKM 626
            E+ + ++E++
Sbjct: 592 FEEKLTEMERL 602


>gi|290893135|ref|ZP_06556123.1| oligoendopeptidase F [Listeria monocytogenes FSL J2-071]
 gi|290557297|gb|EFD90823.1| oligoendopeptidase F [Listeria monocytogenes FSL J2-071]
          Length = 601

 Score =  470 bits (1210), Expect = e-130,   Method: Composition-based stats.
 Identities = 144/612 (23%), Positives = 272/612 (44%), Gaps = 21/612 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQE-ISNDMECIEHESLAFKTRWEGNLAHATN 80
           S    +  +E +     W+L  +YP+ ++ E    D++ I  ES  FK R  G       
Sbjct: 2   SKTNALPLREEVPENLTWDLTTIYPNDEAWEQAFTDLQKITEESEQFKGRLSG------- 54

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
             +  +L  A+   +   +LI  +  YA L  + + ++   +  ++   + +      L 
Sbjct: 55  --SSQTLYEALQFRDNAYDLISNLYVYAHLKMDQDTANAKYQGLHSRAGSLVTKLMSALS 112

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           ++  EI  +DE++L+Q   ++     Y+  ++ +   + ++LS   E LL++  +V   +
Sbjct: 113 YYDPEILAMDESVLKQFLNENKDLQLYAHLLEELNLSRPYILSEKEEALLANAGEVLGSS 172

Query: 201 LKRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              F   N   ++F     +      I   +  K    +D  VR+ A   +   +    +
Sbjct: 173 SNTFNTLNNADMKFPTIKDENGEDIEITHGRFGKLLESNDPRVRREAFLGVYSVYEGLKN 232

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
             +   N   K        R Y    ++    N++   V ++L++S  N      HRY +
Sbjct: 233 TLASTLNGQVKKSNFYASTRGYTSAREAALSGNHIPETVYDSLLKS-VNANADLLHRYVK 291

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+K+ L L+ ++ +D   PL         +E A++LVL++      +   I ++ F   W
Sbjct: 292 LRKELLGLEELHMYDLYTPLSDDVNLEFTYEEAKELVLEALKPLGDEYQAILKEAFDSRW 351

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           ID  +  GK           S +PYILLN+     +V TLAHELGH +H   + + Q  +
Sbjct: 352 IDVMENKGKR-SGAYSSGSYSTNPYILLNWQDNINNVYTLAHELGHSVHSYYTRKNQPFV 410

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
             + S+ LAE AS   E L  D LL+     + R  LL + ++    ++ RQ  F +FE 
Sbjct: 411 YGDYSIFLAEVASTTNENLLTDYLLKKYEDPKVRAYLLNHYLDGFKGTVFRQTQFAEFEH 470

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
            +H   +    +    + E + +  K+  G A    D E G  W  +PHF   ++YV+ Y
Sbjct: 471 AIHQADQQGVALTADFLTETYFDINKKYYGEAMVY-DAEIGYEWSRIPHFY-MNYYVFQY 528

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G    ++L     +   +     Y++ L+AG+S +  ++L    ++++ PN  +  L+
Sbjct: 529 ATGFSAASALSAKILTEGQEAVT-SYIDFLKAGSSDYPIDVLKKAGVDMATPNPVDDALK 587

Query: 615 TVEKMIDDVEKM 626
             E+ +D++EK+
Sbjct: 588 VFEQRLDELEKL 599


>gi|299822174|ref|ZP_07054060.1| oligoendopeptidase F [Listeria grayi DSM 20601]
 gi|299815703|gb|EFI82941.1| oligoendopeptidase F [Listeria grayi DSM 20601]
          Length = 602

 Score =  470 bits (1210), Expect = e-130,   Method: Composition-based stats.
 Identities = 139/608 (22%), Positives = 264/608 (43%), Gaps = 18/608 (2%)

Query: 25  TTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC 84
            T+  ++ +     W+L  +Y S +  E  +  + I+        +++G L      ++ 
Sbjct: 4   QTLPLRQEVPEHLTWDLTTIYKSDEEWE--SAFKEIQQLVTE-SGQYQGKLG-----ESS 55

Query: 85  HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL 144
            +L AA+   + + +    +  YA L  + + ++PT +  ++   + ++     + +F  
Sbjct: 56  ETLLAALRFRDTLFDKASNLYVYAHLKMDQDTANPTYQSLHSRAGSLISQLMAAVSYFDP 115

Query: 145 EINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRF 204
           EI ++DEA L     ++     Y   +  +   + ++LS   E LL+   +V   +   F
Sbjct: 116 EILSIDEAKLAGFLEENADLRLYEHLLDELSISRPYILSEKEEALLASAGEVLGSSSDTF 175

Query: 205 FCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSF 258
              N   ++F     +      I   +  K     DR VR++A K +   +    +  + 
Sbjct: 176 NTLNNADIKFPTIKNEDGESVEITHGRYGKLLESKDRSVREAAFKGVYQVYEGLKNTLAS 235

Query: 259 ITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKK 318
             +   K      R R Y+   ++    N++   V ++L+    N      HRY +L+++
Sbjct: 236 TLSGQVKKSNFYARVRGYKSAREAALSGNHIPEEVYDSLL-ESVNNNLPLLHRYVKLRQQ 294

Query: 319 WLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAP 378
            L ++ +  +D   PL         +E A+++VL+       +   I ++ F   WID  
Sbjct: 295 LLGIEDLRMYDLYTPLSNDVDLNFTYEEAKEVVLEGLKPLGEEYQAILKEAFDSRWIDVT 354

Query: 379 QYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNS 438
           +  GK SGA++ G   S  PYILLN+     +V TLAHELGH +H   +   Q  +  + 
Sbjct: 355 ENKGKRSGAYSSG-AYSTSPYILLNWQDNIDNVFTLAHELGHSVHSYYTRNNQPFIYGDY 413

Query: 439 SLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHT 498
           S+ LAE AS   E L  D LL+     + R  LL + ++    ++ RQ  F +FE K+H 
Sbjct: 414 SIFLAEVASTTNENLLTDYLLKKYDDPKIRAYLLNHYLDGFKGTVFRQSQFAEFEHKIHQ 473

Query: 499 ERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGN 558
             +    +    + E + +  K+  G      D E G  W  +PHF   ++YV+ YA G 
Sbjct: 474 ADQGGEALTADYLTETYADINKKFYGTEVMHYDKEIGYEWSRIPHFY-MNYYVFQYATGF 532

Query: 559 CLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
              ++L             + Y+  L+AGNS    ++L    ++++     +  L   EK
Sbjct: 533 SAASALSQKILDEGQSAV-DDYIAYLKAGNSDFPIDVLKKAGVDMTTSKPVDDALVVFEK 591

Query: 619 MIDDVEKM 626
            + ++E +
Sbjct: 592 RLTELETL 599


>gi|16801356|ref|NP_471624.1| hypothetical protein lin2292 [Listeria innocua Clip11262]
 gi|16414804|emb|CAC97520.1| lin2292 [Listeria innocua Clip11262]
          Length = 601

 Score =  470 bits (1209), Expect = e-130,   Method: Composition-based stats.
 Identities = 139/611 (22%), Positives = 273/611 (44%), Gaps = 19/611 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           S    +  +E +     W+L  +YP+ ++ E       +  +      +++G LA     
Sbjct: 2   SKTNALPLREEVPENLTWDLTTIYPNDEAWE--KAFTEL-QKITEESDQFKGRLA----- 53

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
           ++  +L  A+   ++  +LI  +  YA L  + + ++   +  ++   + +      L +
Sbjct: 54  ESSQTLYEALQFRDKAYDLISNLYVYAHLKMDQDTANAKYQGLHSRAGSLVTKLMSALSY 113

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
           +  EI  +DE++L+Q   ++     Y+  ++ +   + ++LS   E LL++  +V   + 
Sbjct: 114 YDPEILAMDESVLKQFLNENKDLQLYAHLLEELNLSRPYILSEKEEALLANAGEVLGSSS 173

Query: 202 KRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   ++F     +      I   +  K    +D  VRK A   +   +    + 
Sbjct: 174 NTFNTLNNADMKFPTIKDENGEEIEITHGRYGKLLESNDPRVRKDAFLGVYSVYEGLKNT 233

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
            +   N   K        R Y+   ++    N++   V ++L++S  N      HRY +L
Sbjct: 234 LASTLNGQVKKSNFYASTRGYKSAREAALSGNHIPETVYDSLLKS-VNNNASLLHRYVKL 292

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L L+ ++ +D   PL         +E A+++VL++      +   I ++ F   WI
Sbjct: 293 RKELLGLEELHMYDLYTPLSDDVNLEFTYEEAKEIVLEALKPLGDEYQSILKEAFDSRWI 352

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK           S +PYILLN+     +V TLAHELGH +H   + + Q  + 
Sbjct: 353 DVMENKGKR-SGAYSSGSYSTNPYILLNWQDNINNVYTLAHELGHSVHSYYTRKNQPFVY 411

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ LAE AS   E L  D LL+     + R  LL + ++    ++ RQ  F +FE  
Sbjct: 412 GDYSIFLAEVASTTNENLLTDYLLKKYDDPKVRAYLLNHYLDGFKGTVFRQTQFAEFEHA 471

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H   +    +    + E + +  K+  G A    D E G  W  +PHF   ++YV+ YA
Sbjct: 472 IHQADQEGVALTADYLTETYFDINKKYYGDAIVY-DAEIGYEWSRIPHFY-MNYYVFQYA 529

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G    ++L     +   +     Y++ L+AG+S +  ++L    ++++ PN  +  L+ 
Sbjct: 530 TGFSAASALSAKILTEGQEAVTA-YIDFLKAGSSDYPIDVLKKAGVDMATPNPVDDALKV 588

Query: 616 VEKMIDDVEKM 626
            E+ +D++EK+
Sbjct: 589 FEQRLDELEKL 599


>gi|291483633|dbj|BAI84708.1| hypothetical protein BSNT_01930 [Bacillus subtilis subsp. natto
           BEST195]
          Length = 670

 Score =  470 bits (1208), Expect = e-130,   Method: Composition-based stats.
 Identities = 135/614 (21%), Positives = 280/614 (45%), Gaps = 19/614 (3%)

Query: 19  LRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHA 78
                   +  +  +     W LED++PS ++   + + + ++       ++++G LA  
Sbjct: 63  AEEKKANQLPDRSEVKAEDTWRLEDIFPSDEAW--NKEFQAVKELIPNL-SKYKGKLAD- 118

Query: 79  TNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKV 138
               +   L  A+   +++ E +GR+ +YA +  + +  +   +                
Sbjct: 119 ----SADHLYEALTYQDKVMERLGRLYTYAHMRSDQDTGNSFYQGLNDKAGNLYTQAASA 174

Query: 139 LIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGR 198
             +   EI +++E  L+Q   +      YS  I+ I K + H+LS   E LL++ S+V  
Sbjct: 175 TAYLVPEILSIEEDKLQQFILEKEELKLYSHAIEEITKERPHVLSEKEEALLAEASEVLG 234

Query: 199 EALKRFFCENIESLRFKI------NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKS 252
            +   F   N   + F        N+++I            +REVRK+A  A+  T+ + 
Sbjct: 235 SSSNTFSVLNNADITFPSIKDEDGNEKQITHGNFINFLESENREVRKNAFDAVYKTYGQY 294

Query: 253 SHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRY 312
            +  +   +   K +    R +KY+   ++   +N++   V + L++++  +     HRY
Sbjct: 295 KNTMATTLSGTVKKDNFYARVKKYKSAREAALSNNSIPEEVYDNLVKTINKH-LPLLHRY 353

Query: 313 YELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTH 372
             L+KK L+LD ++ +D   PL   +   + +E A+D +L+  A    + + I ++   +
Sbjct: 354 IALRKKVLELDEVHIYDLYTPLVKDAGMKVTYEEAKDYMLKGLAPLGEEYASILKEGLEN 413

Query: 373 NWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQG 432
            W+D  +  GK +GA++ G     +PYIL+N+     ++ TL HE GH +H   + + Q 
Sbjct: 414 RWVDVYENKGKRNGAYSSG-AYGTNPYILMNWHNNVNNLFTLVHEFGHSVHSYYTRKHQP 472

Query: 433 ILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDF 492
               N S+ +AE AS   E L  + LL     +++R  +L + +E    ++ RQ  F +F
Sbjct: 473 YPYGNYSIFVAEVASTTNEALLGEYLLNNLEDEKQRLYILNHMLEGFRGTVFRQTMFAEF 532

Query: 493 ELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVY 552
           E  +HT+ +    +    + +++ +  K+  G    + D E G  W  +PHF  + +   
Sbjct: 533 EHLIHTKAQEGEPLTPELLTKVYYDLNKKYFGDGMVI-DKEIGLEWSRIPHFYYNYYVYQ 591

Query: 553 AYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERG 612
             A G     +L             ++Y++ L+AG+S++  ++L    ++++ P   E  
Sbjct: 592 Y-ATGYSAAQALSSQILKEGKPAV-DRYIDFLKAGSSQYPIDVLKKAGVDMTSPEPIEAA 649

Query: 613 LQTVEKMIDDVEKM 626
            +  E+ +D++E++
Sbjct: 650 CKMFEEKLDEMEEL 663


>gi|313622785|gb|EFR93119.1| oligoendopeptidase F [Listeria innocua FSL J1-023]
          Length = 601

 Score =  470 bits (1208), Expect = e-130,   Method: Composition-based stats.
 Identities = 139/611 (22%), Positives = 273/611 (44%), Gaps = 19/611 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           S    +  +E +     W+L  +YP+ ++ E       +  +      +++G LA     
Sbjct: 2   SKTNALPLREEVPENLTWDLTTIYPNDEAWE--KAFTEL-QKITEESDQFKGRLA----- 53

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
           ++  +L  A+   ++  +LI  +  YA L  + + ++   +  ++   + +      L +
Sbjct: 54  ESSQTLYEALQFRDKAYDLISNLYVYAHLKMDQDTANAKYQGLHSRAGSLVTKLMSALSY 113

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
           +  EI  +DE++L+Q   ++     Y+  ++ +   + ++LS   E LL++  +V   + 
Sbjct: 114 YDPEILAMDESVLKQFLNENKDLQLYAHLLEELNLSRPYILSEKEEALLANAGEVLGSSS 173

Query: 202 KRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   ++F     +      I   +  K    +D  VRK A   +   +    + 
Sbjct: 174 NTFNTLNNADMKFPTIKDENGEEIEITHGRYGKLLESNDPRVRKDAFLGVYSVYEGLKNT 233

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
            +   N   K        R Y+   ++    N++   V ++L++S  N      HRY +L
Sbjct: 234 LASTLNGQVKKSNFYASTRGYKSAREAALSGNHIPETVYDSLLKS-VNKNASLLHRYVKL 292

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L L+ ++ +D   PL         +E A+++VL++      +   I ++ F   WI
Sbjct: 293 RKELLGLEELHMYDLYTPLSDDVNLEFTYEEAKEIVLEALKPLGDEYQSILKEAFDSRWI 352

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK           S +PYILLN+     +V TLAHELGH +H   + + Q  + 
Sbjct: 353 DVMENKGKR-SGAYSSGSYSTNPYILLNWQDNINNVYTLAHELGHSVHSYYTRKNQPFVY 411

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ LAE AS   E L  D LL+     + R  LL + ++    ++ RQ  F +FE  
Sbjct: 412 GDYSIFLAEVASTTNENLLTDYLLKKYDDPKVRAYLLNHYLDGFKGTVFRQTQFAEFEHA 471

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H   +    +    + E + +  K+  G A    D E G  W  +PHF   ++YV+ YA
Sbjct: 472 IHQADQEGVALTADYLTETYFDINKKYYGDAIVY-DAEIGYEWSRIPHFY-MNYYVFQYA 529

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G    ++L     +   +     Y++ L+AG+S +  ++L    ++++ PN  +  L+ 
Sbjct: 530 TGFSAASALSAKILTEGQEAVTA-YIDFLKAGSSDYPIDVLKKAGVDMATPNPVDDALKV 588

Query: 616 VEKMIDDVEKM 626
            E+ +D++EK+
Sbjct: 589 FEQRLDELEKL 599


>gi|67009983|dbj|BAD99434.1| oligopeptidase [Geobacillus sp. MO-1]
          Length = 604

 Score =  470 bits (1208), Expect = e-130,   Method: Composition-based stats.
 Identities = 137/608 (22%), Positives = 272/608 (44%), Gaps = 19/608 (3%)

Query: 25  TTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC 84
            ++  +  +     W LED++P+ ++ E   + + ++         ++G L      ++ 
Sbjct: 8   KSLPLRSEIPVEETWRLEDIFPTDEAWE--QEFQEVKKMIPKL-AEYQGRLG-----ESA 59

Query: 85  HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL 144
             L  A+   + +   +G++ +YA + Y+ + ++   +       +  ++    + F   
Sbjct: 60  DVLYEALQYQDEVSMRLGKLYTYAHMRYDQDTTNAFYQGLNDRATSLYSEASSAMAFIVP 119

Query: 145 EINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRF 204
           EI  +DE  L     +      Y   +  I + + H+LS + E LL+  ++V + +   F
Sbjct: 120 EILAIDEVKLRSFLEEKQELKLYEHALDEINRQRPHVLSAEEEALLAQAAEVMQSSSSTF 179

Query: 205 FCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSF 258
              N   L F     +      +   +  +    +DR VR+ A KA+  T+ K  + F+ 
Sbjct: 180 SMLNNADLTFPTIIDENGEEVEVTHGRFIRFLESTDRRVRRDAFKAVYDTYEKYKNTFAS 239

Query: 259 ITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKK 318
                 K +    R R+Y+   ++   SNN+   V + L+++V  +     HRY  L+KK
Sbjct: 240 TLAGTVKKDNFFARVRRYKSAREAALSSNNIPESVYDNLIETVHEH-LPLLHRYVRLRKK 298

Query: 319 WLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAP 378
            L LD ++ +D   PL    +  + +E A++ +L++ A    +   I ++   + W+D  
Sbjct: 299 VLGLDELHMYDLYTPLVQDVKMEVTYEEAKEYMLKALAPLGEEYISIVKEGLENRWVDVR 358

Query: 379 QYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNS 438
           +  GK SGA++ G     HPYILLN+     ++ TL HE GH +H   + +TQ     N 
Sbjct: 359 ENKGKRSGAYSSG-AYGTHPYILLNWQDNVNNLFTLVHEFGHSVHSYYTRKTQPYPYANY 417

Query: 439 SLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHT 498
           S+ +AE AS   E L  D LL+    +++R  LL + +E    ++ RQ  F +FE  +H 
Sbjct: 418 SIFVAEVASTCNEALLNDYLLKTMDEEKKRLYLLNHYLEGFRGTVFRQTMFAEFEHMIHI 477

Query: 499 ERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGN 558
           + +    +    +  ++ E  K+  G    + D E G  W  +PHF  + +     A G 
Sbjct: 478 KAQEGEALTADSLTSLYYELNKKYFGDDIVV-DQEIGLEWARIPHFYYNYYVYQY-ATGF 535

Query: 559 CLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
               +L             ++Y+  L+AG+S +  E+L    ++++      +  Q   +
Sbjct: 536 SAATALSKQILEEGEPAV-KRYIEFLKAGSSDYPIEVLKKAGVDMTSAEPIRQACQVFAE 594

Query: 619 MIDDVEKM 626
            ++++E +
Sbjct: 595 KLEEMENL 602


>gi|83593527|ref|YP_427279.1| peptidase M3B, oligoendopeptidase-related clade 3 [Rhodospirillum
           rubrum ATCC 11170]
 gi|83576441|gb|ABC22992.1| Peptidase M3B, oligoendopeptidase-related clade 3 [Rhodospirillum
           rubrum ATCC 11170]
          Length = 597

 Score =  469 bits (1207), Expect = e-130,   Method: Composition-based stats.
 Identities = 262/593 (44%), Positives = 383/593 (64%), Gaps = 8/593 (1%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           +  LP W+L DLY   DS  +  D+   E  + AF+  + G +A      +  +LG AI 
Sbjct: 11  VSPLPVWDLGDLYDGPDSAALKTDLAETESGAKAFRDTYAGKVAGL----DGAALGEAIV 66

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
            +ER+ E + RI SY+ L    +++   I +F+  +  K       ++FF LEIN +D+ 
Sbjct: 67  AFERLSETLYRILSYSQLLQAGDVTDVAIGQFHQAMMEKGTAISSQMLFFTLEINLIDDD 126

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
            L +     PL  +Y+ WI+++R  +KH LS+DME LL++    G  A  R F E +  L
Sbjct: 127 ALAEKLKN-PLAGRYAPWIRDLRAFRKHQLSDDMERLLNEKDVAGSSAWMRLFDETVAHL 185

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           RF I+++ +  T+A+    D   E RK+AAKA+      +  +FS ITNTLAKD++I D 
Sbjct: 186 RFPIDNETLTSTEAFDRLSDPQPERRKAAAKAIGGVLEDNLRLFSRITNTLAKDKQIDDS 245

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR Y     +R+L N VE  V++AL+ +V+  Y   SHRYY++K KW   DT+ +WDR A
Sbjct: 246 WRGYAHPMAARNLGNQVEDAVVDALVSAVRGSYGDLSHRYYQMKAKWFGRDTLDYWDRNA 305

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP        ++ ARD VL +Y  FSP+++ + ++FF + WID P   GK SGAFAH T
Sbjct: 306 PLPEADDSRFTWDQARDTVLGAYGAFSPELAAVGKRFFDNPWIDVPARPGKASGAFAHPT 365

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +PS HPY+LLN++G+ +DVMTLAHELGHG+H VL++  QG L +++ LTLAETAS+FGE 
Sbjct: 366 VPSAHPYLLLNFMGRTRDVMTLAHELGHGVHQVLAAR-QGPLLSDTPLTLAETASVFGEM 424

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF ++L +A   + R+I+LA+K+EDM+N++VRQI+F+ FE K+H+ER     +   R+ 
Sbjct: 425 LTFRAMLDSAGDAKRRRIMLASKVEDMINTVVRQIAFHTFEHKVHSERLQGE-LSPDRLC 483

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
           EIW+E Q ESLGPAF   D EY ++W  +PHFI S FYVYAYAFG+CLVNSLY +Y+  +
Sbjct: 484 EIWMEVQTESLGPAFRF-DAEYRTYWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQEGS 542

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEK 625
           V  F+ KYL++L AG +  + ELL P  ++ S+P+FW+RGL  ++  ID++E+
Sbjct: 543 VPDFQAKYLDMLGAGGTLRHKELLAPFGLDASNPDFWKRGLGVLKGFIDELEE 595


>gi|221308994|ref|ZP_03590841.1| hypothetical protein Bsubs1_06376 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221313319|ref|ZP_03595124.1| hypothetical protein BsubsN3_06302 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221318243|ref|ZP_03599537.1| hypothetical protein BsubsJ_06246 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221322517|ref|ZP_03603811.1| hypothetical protein BsubsS_06357 [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|255767260|ref|NP_389036.2| oligoendopeptidase F [Bacillus subtilis subsp. subtilis str. 168]
 gi|321314884|ref|YP_004207171.1| oligoendopeptidase F [Bacillus subtilis BSn5]
 gi|238054309|sp|O31605|PEPF_BACSU RecName: Full=Oligoendopeptidase F homolog
 gi|225184887|emb|CAB13011.2| oligoendopeptidase F [Bacillus subtilis subsp. subtilis str. 168]
 gi|320021158|gb|ADV96144.1| oligoendopeptidase F [Bacillus subtilis BSn5]
          Length = 670

 Score =  469 bits (1206), Expect = e-130,   Method: Composition-based stats.
 Identities = 135/614 (21%), Positives = 279/614 (45%), Gaps = 19/614 (3%)

Query: 19  LRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHA 78
                   +  +  +     W LED++PS ++   + + + ++       ++++G LA  
Sbjct: 63  AEEKKANQLPDRSEVKAEDTWRLEDIFPSDEAW--NKEFQAVKELIPNL-SKYKGKLAD- 118

Query: 79  TNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKV 138
               +   L  A+   +++ E +GR+ +YA +  + +  +   +                
Sbjct: 119 ----SADHLYEALTYQDKVMERLGRLYTYAHMRSDQDTGNSFYQGLNDKAGNLYTQAASA 174

Query: 139 LIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGR 198
             +   EI +++E  L+Q   +      YS  I+ I K + H+LS   E LL++ S+V  
Sbjct: 175 TAYLVPEILSIEEDKLQQFILEKEELKLYSHAIEEITKERPHVLSEKEEALLAEASEVLG 234

Query: 199 EALKRFFCENIESLRFKI------NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKS 252
            +   F   N   + F        N+++I            +REVRK+A  A+  T+ + 
Sbjct: 235 SSSNTFSVLNNADITFPSIKDEDGNEKQITHGNFINFLESENREVRKNAFDAVYKTYGQY 294

Query: 253 SHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRY 312
            +  +   +   K +    R +KY+   ++   +N++   V + L++++  +     HRY
Sbjct: 295 KNTMATTLSGTVKKDNFYARVKKYKSAREAALSNNSIPEEVYDNLVKTINKH-LPLLHRY 353

Query: 313 YELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTH 372
             L+KK L+LD ++ +D   PL   +   + +E A+D +L+  A    + + I ++   +
Sbjct: 354 IALRKKVLELDEVHIYDLYTPLVKDAGMKVTYEEAKDYMLKGLAPLGEEYASILKEGLEN 413

Query: 373 NWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQG 432
            W+D  +  GK +GA++ G     +PYIL+N+     ++ TL HE GH +H   + + Q 
Sbjct: 414 RWVDVYENKGKRNGAYSSG-AYGTNPYILMNWHNNVNNLFTLVHEFGHSVHSYYTRKHQP 472

Query: 433 ILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDF 492
               N S+ +AE AS   E L  + LL     +++R  +L + +E    ++ RQ  F +F
Sbjct: 473 YPYGNYSIFVAEVASTTNEALLGEYLLNNLEDEKQRLYILNHMLEGFRGTVFRQTMFAEF 532

Query: 493 ELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVY 552
           E  +HT+ +    +    +  ++ +  K+  G    + D E G  W  +PHF  + +   
Sbjct: 533 EHLIHTKAQEGEPLTPELLTNVYYDLNKKYFGDGMVI-DKEIGLEWSRIPHFYYNYYVYQ 591

Query: 553 AYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERG 612
             A G     +L             ++Y++ L+AG+S++  ++L    ++++ P   E  
Sbjct: 592 Y-ATGYSAAQALSSQILKEGKPAV-DRYIDFLKAGSSQYPIDVLKKAGVDMTSPEPIEAA 649

Query: 613 LQTVEKMIDDVEKM 626
            +  E+ +D++E++
Sbjct: 650 CKMFEEKLDEMEEL 663


>gi|326403675|ref|YP_004283757.1| putative oligoendopeptidase [Acidiphilium multivorum AIU301]
 gi|325050537|dbj|BAJ80875.1| putative oligoendopeptidase [Acidiphilium multivorum AIU301]
          Length = 615

 Score =  469 bits (1206), Expect = e-130,   Method: Composition-based stats.
 Identities = 264/622 (42%), Positives = 382/622 (61%), Gaps = 17/622 (2%)

Query: 12  NAFFRKALRSSDMTTMDSQENLGN-----LPRWNLEDLYPSHDSQEISNDMECIEHESLA 66
               R      D+  +  +    +     LP WNL DLY   +   I+ D+  +  ++ A
Sbjct: 1   MTLIRPLAPPDDLAGVTVRSECDSDAAFALPSWNLTDLYRGTEDPAIATDIARLGADARA 60

Query: 67  FKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYT 126
           F   + G +A      +   L  AIA YE I + +GR+ ++A L+++ + + PT  +FY 
Sbjct: 61  FAAAFRGRVAGL----DGSGLAEAIARYEAIEQGLGRLHAFAQLNFSADATVPTAGQFYQ 116

Query: 127 DINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDM 186
            I+ +  +    ++FF LEIN +D+A  E + A DP   +++ W+ ++R ++ H LS+++
Sbjct: 117 SISERATEIGADVVFFTLEINQIDDAAFEAALA-DPALARFAPWLGDLRALRPHQLSDEI 175

Query: 187 ECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALS 246
           E LL +    G  A  R F E I +LR  +  +++ L+ A     D DR  R++A  A+ 
Sbjct: 176 ERLLHEKEVTGHAAWSRLFDETIAALRVPVAGEELTLSAALNRLSDPDRVQREAAGHAIG 235

Query: 247 HTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYP 306
            T  +++ +F+ I NT+AKD+ I+D WR+Y     +RHL+N VEP V+EAL+ +V + YP
Sbjct: 236 TTLQRNARLFTQILNTIAKDKAIEDGWRRYASPEAARHLANRVEPAVVEALVSAVTDAYP 295

Query: 307 KTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIA 366
           + +HRYY LK  WL LD +  WDR APLPG S   I +  AR+ VL +Y  FSP+M +IA
Sbjct: 296 RLAHRYYTLKAGWLGLDRLQHWDRNAPLPGESDRRIGWPEARERVLAAYGAFSPEMRVIA 355

Query: 367 EKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVL 426
            +FF   WIDA    GK  GAFAH  +P VHPYILLNY G+ +DVMTLAHELGHG+H VL
Sbjct: 356 ARFFDGGWIDAVPRPGKSGGAFAHPAVPDVHPYILLNYHGRARDVMTLAHELGHGVHQVL 415

Query: 427 SSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQ 486
           ++  QG L   + LTLAETAS+FGE LTF +LL A S  + R+++LA K+EDMLN++VRQ
Sbjct: 416 AAR-QGYLMAATPLTLAETASVFGEMLTFRALLDAESDPQRRRLMLAQKVEDMLNTVVRQ 474

Query: 487 ISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIE 546
           I+F+ FE +LH  RR    +    I+ IW+  Q+ESLGPAF+ SD +Y  FW  VPHF+ 
Sbjct: 475 IAFHQFEQRLHAARRRGELL-PDEISAIWIGVQRESLGPAFEFSD-DYRMFWAYVPHFVH 532

Query: 547 SSFYVYAYAFGNCLVNSLYDIYKSNTVDC----FKEKYLNILRAGNSKHYSELLLPLNIN 602
           S FYVYAYAFG+CLVN+LY +Y+          F  +YL++L AG ++ + ELL P  ++
Sbjct: 533 SPFYVYAYAFGDCLVNALYGVYRDQAARGAGADFVARYLDMLAAGGTRRHRELLAPFGLD 592

Query: 603 LSDPNFWERGLQTVEKMIDDVE 624
            SDP FW RGL  +   ID++E
Sbjct: 593 ASDPAFWRRGLDVIAGFIDELE 614


>gi|217963650|ref|YP_002349328.1| oligoendopeptidase F [Listeria monocytogenes HCC23]
 gi|217332920|gb|ACK38714.1| oligoendopeptidase F [Listeria monocytogenes HCC23]
 gi|307571774|emb|CAR84953.1| pepF [Listeria monocytogenes L99]
          Length = 601

 Score =  469 bits (1206), Expect = e-130,   Method: Composition-based stats.
 Identities = 143/612 (23%), Positives = 274/612 (44%), Gaps = 21/612 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQE-ISNDMECIEHESLAFKTRWEGNLAHATN 80
           S    +  +E +     W+L  +YP+ ++ E    D++ I  ES  F    +G L+    
Sbjct: 2   SKTNALPLREEVPENLTWDLTTIYPNDEAWEQAFTDLQKITEESEQF----KGRLS---- 53

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
            ++  +L  A+   +   +LI  +  YA L  + + ++   +  ++   + +      L 
Sbjct: 54  -ESSQTLYEALQFRDNAYDLISNLYVYAHLKMDQDTANAKYQGLHSRAGSLVTKLMSALS 112

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           ++  EI  +DE++L+Q   ++     Y+  ++ +   + ++LS   E LL++  +V   +
Sbjct: 113 YYDPEILAMDESVLKQFLNENKDLQLYAHLLEELNLSRPYILSEKEEALLANAGEVLGSS 172

Query: 201 LKRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              F   N   ++F     +      I   +  K    +D  VR+ A   +   +    +
Sbjct: 173 SNTFNTLNNADMKFPTIKDENGEDIEITHGRFGKLLESNDPRVRREAFLGVYSVYEGLKN 232

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
             +   N   K        R Y    ++    N++   V ++L++S  N      HRY +
Sbjct: 233 TLASTLNGQVKKSNFYASTRGYTSAREAALSGNHIPETVYDSLLKS-VNANADLLHRYVK 291

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+K+ L L+ ++ +D   PL         +E A++LVL++      +   I ++ F   W
Sbjct: 292 LRKELLGLEELHMYDLYTPLSDDVNLEFTYEEAKELVLEALKPLGDEYQAILKEAFDSRW 351

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           ID  +  GK           S +PYILLN+     +V TLAHELGH +H   + + Q  +
Sbjct: 352 IDVMENKGKR-SGAYSSGSYSTNPYILLNWQDNINNVYTLAHELGHSVHSYYTRKNQPFV 410

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
             + S+ LAE AS   E L  D LL+     + R  LL + ++    ++ RQ  F +FE 
Sbjct: 411 YGDYSIFLAEVASTTNENLLTDYLLKKYEDPKVRAYLLNHYLDGFKGTVFRQTQFAEFEH 470

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
            +H   +    +    + E + +  K+  G A    D E G  W  +PHF   ++YV+ Y
Sbjct: 471 AIHQADQQGVALTADFLTETYFDINKKYYGEAMVY-DAEIGYEWSRIPHFY-MNYYVFQY 528

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G    ++L     +   +     Y++ L+AG+S +  ++L    ++++ PN  +  L+
Sbjct: 529 ATGFSAASALSAKILTEGQEAVTA-YIDFLKAGSSDYPIDVLKKAGVDMATPNPVDDALK 587

Query: 615 TVEKMIDDVEKM 626
             E+ +D++EK+
Sbjct: 588 VFEQRLDELEKL 599


>gi|297530973|ref|YP_003672248.1| oligoendopeptidase F [Geobacillus sp. C56-T3]
 gi|297254225|gb|ADI27671.1| oligoendopeptidase F [Geobacillus sp. C56-T3]
          Length = 607

 Score =  468 bits (1205), Expect = e-130,   Method: Composition-based stats.
 Identities = 135/608 (22%), Positives = 270/608 (44%), Gaps = 19/608 (3%)

Query: 25  TTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC 84
            ++  +  +     W LED++P+ D+ E   + + ++         ++G L      ++ 
Sbjct: 10  KSLPLRSEIPVEETWRLEDIFPTDDAWE--EEFKQVKAMIPKL-GEYKGRLG-----ESP 61

Query: 85  HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL 144
             L  A+   + +   +G++ +YA + Y+ + ++   +       +  ++    + F   
Sbjct: 62  EVLYEALQCQDDVSMRLGKLYTYAHMRYDQDTTNSFYQGLDARAKSLYSEASSAMAFIVP 121

Query: 145 EINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRF 204
           EI  +DEA+L     Q      Y+  +  I + + H+LS + E +L+  ++V +     F
Sbjct: 122 EILAIDEAVLRSFLEQYEPLRLYAHALDEITRQRPHVLSAEEEAILAQAAEVMQATSNTF 181

Query: 205 FCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSF 258
              N   L F     +      +   +  +    +DR VR+ A  A+ HT+ K  + F+ 
Sbjct: 182 SALNNADLTFPTIIDENGEEVEVTHGRFIRFLESTDRRVRRDAFYAVYHTYEKFQNTFAN 241

Query: 259 ITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKK 318
                 K +    R R+Y    ++   +NN+   V + L+ ++  +     HRY  L+K+
Sbjct: 242 TLAGTVKKDNFFARIRRYRSAREAALDANNIPESVYDNLIATIHEH-LPLLHRYVRLRKR 300

Query: 319 WLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAP 378
            L LD ++ +D   PL    +  + +E A+  +L+  A    +   I ++   + W+D  
Sbjct: 301 VLGLDELHMYDLYTPLVQEVKMEVTYEEAKQYMLEGLAPLGEEYVAIVKEGLDNRWVDVR 360

Query: 379 QYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNS 438
           +  GK SGA++ G     HPYILLN+     ++ TL HE GH +H   + +TQ     + 
Sbjct: 361 ENKGKRSGAYSSG-AYGTHPYILLNWQDNVNNLFTLVHEFGHSVHSYYTRKTQPYPYAHY 419

Query: 439 SLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHT 498
           S+ +AE AS   E L  D LL+    +++R  LL + +E    ++ RQ  F +FE  +H 
Sbjct: 420 SIFVAEVASTCNEALLNDYLLKTIDDEKKRLYLLNHYLEGFRGTVFRQTMFAEFEHLIHL 479

Query: 499 ERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGN 558
           + +    +    +  ++ +  K   G    + D E G  W  +PHF  + +     A G 
Sbjct: 480 KAQQGEALTAETLTSLYYDLNKTYFGDDIVV-DKEIGLEWARIPHFYYNYYVYQY-ATGF 537

Query: 559 CLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
               +L              +Y++ L+AG+S +  E+L    ++++      +  Q   +
Sbjct: 538 SAATALSKQILEEGEPAV-RRYIDFLKAGSSDYPIEVLKKAGVDMTSAEPIRQACQVFAE 596

Query: 619 MIDDVEKM 626
            +D++E++
Sbjct: 597 KLDEMERL 604


>gi|316935699|ref|YP_004110681.1| oligoendopeptidase, pepF/M3 family [Rhodopseudomonas palustris
           DX-1]
 gi|315603413|gb|ADU45948.1| oligoendopeptidase, pepF/M3 family [Rhodopseudomonas palustris
           DX-1]
          Length = 639

 Score =  468 bits (1205), Expect = e-129,   Method: Composition-based stats.
 Identities = 286/594 (48%), Positives = 389/594 (65%), Gaps = 6/594 (1%)

Query: 34  GNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGA-AIA 92
             LP WNL DLYP+ D+ E++ D++ ++ E  +F+  ++G LA  T +       A A+ 
Sbjct: 50  AKLPEWNLTDLYPAIDAPEVAADLDRLDAECTSFEADFKGRLAEETAKDGGALWLAGAVK 109

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
            YE I +L GR+ SYA L +  +   P   KFY D++ +L      L+FF LE+N +D A
Sbjct: 110 RYEAIEDLAGRLGSYAGLVHAGDSVDPVKSKFYGDVSERLTAASVHLLFFTLELNRVDNA 169

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
           +LE++  Q P    Y  WI+++RK K + L + +E L  + SQ G  A  R F + I SL
Sbjct: 170 VLERAM-QTPELGHYRPWIEDLRKDKPYQLEDRIEQLFHEKSQTGYGAFNRLFDQTISSL 228

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           RFK+  +++ +        D     RK+AA+AL+ TF  +   F+ ITNTLAKD+EI DR
Sbjct: 229 RFKVGAKELAIEPTLNLMQDRAPAKRKAAAEALAKTFKANERTFALITNTLAKDKEISDR 288

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR +E +ADSRHL+N VE  V++AL+ SV+  YPK SHRYY+LK  W K   + +WDR A
Sbjct: 289 WRGFEDVADSRHLANRVEREVVDALVASVRAAYPKLSHRYYKLKAGWFKKKKLPYWDRNA 348

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PLP  +   I +  AR++VL +Y  FSP+M+ IAE+FF   WIDAP   GK  GAF+H T
Sbjct: 349 PLPFAATGTIAWPEARNMVLTAYKAFSPEMAQIAERFFNDRWIDAPVRPGKAPGAFSHPT 408

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
            PS HPY+L+NY GKP+DVMTLAHELGHG+H VL+++  G L   + LTLAETAS+FGE 
Sbjct: 409 TPSAHPYVLMNYQGKPRDVMTLAHELGHGVHQVLAAKN-GALMAPTPLTLAETASVFGEM 467

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           LTF  LL     +++R+ LLA K+EDM+N++VRQI+FY FE  +HTERRS   +   RI 
Sbjct: 468 LTFRRLLAQTKDRKQRQALLAGKVEDMINTVVRQIAFYSFERAIHTERRSGE-LTAQRIG 526

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNT 572
           EIWL  Q ESLGPA ++    Y SFWM +PHFI S FYVYAYAFG+CLVNSLY +Y  + 
Sbjct: 527 EIWLSVQGESLGPAIEIK-PGYESFWMYIPHFIHSPFYVYAYAFGDCLVNSLYAVY-EHA 584

Query: 573 VDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            + F E+YL +L AG +KHYSELL P  ++  +P+FW+ GL  +  MID++E M
Sbjct: 585 QEGFAERYLAMLAAGGTKHYSELLAPFGLDAKNPSFWDGGLSVIAGMIDELEAM 638


>gi|254853313|ref|ZP_05242661.1| oligoendopeptidase F [Listeria monocytogenes FSL R2-503]
 gi|258606676|gb|EEW19284.1| oligoendopeptidase F [Listeria monocytogenes FSL R2-503]
          Length = 601

 Score =  468 bits (1204), Expect = e-129,   Method: Composition-based stats.
 Identities = 143/612 (23%), Positives = 273/612 (44%), Gaps = 21/612 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQE-ISNDMECIEHESLAFKTRWEGNLAHATN 80
           S    +  +E +     W+L  +YP+ ++ E    D++ I  ES  F    +G L+    
Sbjct: 2   SKTNALPLREEVPENLTWDLTTIYPNDEAWEQAFTDLQKITEESEQF----KGRLS---- 53

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
            ++  +L  A+   +   +LI  +  YA L  + + ++   +  ++   + +      L 
Sbjct: 54  -ESSQTLYEALQFRDNAYDLISNLYVYAHLKMDQDTANAKYQGLHSRAGSLVTKLMSALS 112

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           ++  EI  +DE++L+Q   ++     Y+  ++ +   + ++LS   E LL++  +V   +
Sbjct: 113 YYDPEILAMDESVLKQFLNENKDLQLYAHLLEELNLSRPYILSEKEEALLANAGEVLGSS 172

Query: 201 LKRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              F   N   ++F     +      I   +  K    +D  VR+ A   +   +    +
Sbjct: 173 SNTFNTLNNTDMKFPTIKDENGEDIEITHGRFGKLLESNDPRVRREAFLGVYSVYEGLKN 232

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
             +   N   K        R Y    ++    N++   V ++L++S  N      HRY +
Sbjct: 233 TLASTLNGQVKKSNFYASTRGYTSAREAALSGNHIPETVYDSLLKS-VNANADLLHRYVK 291

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+K+ L L+ ++ +D   PL         +E A++LVL++      +   I ++ F   W
Sbjct: 292 LRKELLGLEELHMYDLYTPLSDDVNLEFTYEEAKELVLEALKPLGDEYQAILKEAFDSRW 351

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           ID  +  GK           S  PYILLN+     +V TLAHELGH +H   + + Q  +
Sbjct: 352 IDVMENKGKR-SGAYSSGSYSTSPYILLNWQDNINNVYTLAHELGHSVHSYYTRKNQPFV 410

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
             + S+ LAE AS   E L  D LL+     + R  LL + ++    ++ RQ  F +FE 
Sbjct: 411 YGDYSIFLAEVASTTNENLLTDYLLKKYDDPKVRAYLLNHYLDGFKGTVFRQTQFAEFEH 470

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
            +H   +    +    + E + +  K+  G A    D E G  W  +PHF   ++YV+ Y
Sbjct: 471 AIHQADQEGVALTADYLTETYFDINKKYYGEAMVY-DAEIGYEWSRIPHFY-MNYYVFQY 528

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G    ++L     +   +     Y++ L+AG+S +  ++L    ++++ PN  +  L+
Sbjct: 529 ATGFSAASALSAKILTEGQEAVTA-YIDFLKAGSSDYPIDVLKKAGVDMATPNPVDDALK 587

Query: 615 TVEKMIDDVEKM 626
             E+ +D++EK+
Sbjct: 588 VFEQRLDELEKL 599


>gi|224501012|ref|ZP_03669319.1| hypothetical protein LmonFR_00585 [Listeria monocytogenes FSL
           R2-561]
          Length = 601

 Score =  468 bits (1204), Expect = e-129,   Method: Composition-based stats.
 Identities = 143/612 (23%), Positives = 273/612 (44%), Gaps = 21/612 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQE-ISNDMECIEHESLAFKTRWEGNLAHATN 80
           S    +  +E +     W+L  +YP+ ++ E    D++ I  ES  F    +G L+    
Sbjct: 2   SKTNALPLREEVPENLTWDLTTIYPNDEAWEKAFTDLQKITEESDQF----KGRLS---- 53

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
            ++  +L  A+   ++  +LI  +  YA L  + + ++   +  ++   + +      L 
Sbjct: 54  -ESSQTLYEALQFRDKAYDLISNLYVYAHLKMDQDTANAKYQGLHSRAGSLVTKLMSALS 112

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           ++  EI  +DE +L+Q   ++     Y   ++ +   + ++LS   E LL++  +V   +
Sbjct: 113 YYDPEILAMDENVLKQFLDENKDLQLYDHLLEELNLSRPYILSEKEEALLANAGEVLGSS 172

Query: 201 LKRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              F   N   ++F     +      I   +  K    +D  VR+ A   +   +    +
Sbjct: 173 SNTFNTLNNADMKFPTIKDENGEDIEITHGRFGKLLESNDPRVRRDAFHGVYSVYEGLKN 232

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
             +   N   K        R Y    ++    N++   V ++L++S  N      HRY +
Sbjct: 233 TLASTLNGQVKKSNFYASTRGYTSAREAALSGNHIPETVYDSLLKS-VNANASLLHRYVK 291

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+K+ L L+ ++ +D   PL         +E A++LVL++      +   I ++ F   W
Sbjct: 292 LRKELLGLEELHMYDLYTPLSDDVNLEFTYEEAKELVLEALKPLGDEYQAILKEAFDSRW 351

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           ID  +  GK           S +PYILLN+     +V TLAHELGH +H   + + Q  +
Sbjct: 352 IDVMENKGKR-SGAYSSGSYSTNPYILLNWQDNINNVYTLAHELGHSVHSYYTRKNQPFV 410

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
             + S+ LAE AS   E L  D LL+     + R  LL + ++    ++ RQ  F +FE 
Sbjct: 411 YGDYSIFLAEVASTTNENLLTDYLLKKYDDPKVRAYLLNHYLDGFKGTVFRQTQFAEFEH 470

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
            +H   +    +    + E + +  K+  G A    D E G  W  +PHF   ++YV+ Y
Sbjct: 471 AIHQADQQGVALTADFLTETYFDINKKYYGEAMVY-DAEIGYEWSRIPHFY-MNYYVFQY 528

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G    ++L     +   D     Y++ L+AG+S +  ++L    ++++ PN  +  L+
Sbjct: 529 ATGFSAASALSAKILTEGQDAVTA-YIDFLKAGSSDYPIDVLKKAGVDMATPNPVDDALK 587

Query: 615 TVEKMIDDVEKM 626
             E+ +D++E++
Sbjct: 588 VFEQRLDELEEL 599


>gi|47095762|ref|ZP_00233368.1| oligoendopeptidase F [Listeria monocytogenes str. 1/2a F6854]
 gi|254826923|ref|ZP_05231610.1| oligoendopeptidase F [Listeria monocytogenes FSL N3-165]
 gi|254831375|ref|ZP_05236030.1| hypothetical protein Lmon1_08452 [Listeria monocytogenes 10403S]
 gi|254899110|ref|ZP_05259034.1| hypothetical protein LmonJ_04839 [Listeria monocytogenes J0161]
 gi|254912749|ref|ZP_05262761.1| oligoendopeptidase F [Listeria monocytogenes J2818]
 gi|254937076|ref|ZP_05268773.1| oligoendopeptidase F [Listeria monocytogenes F6900]
 gi|284802635|ref|YP_003414500.1| hypothetical protein LM5578_2391 [Listeria monocytogenes 08-5578]
 gi|284995777|ref|YP_003417545.1| hypothetical protein LM5923_2342 [Listeria monocytogenes 08-5923]
 gi|47015905|gb|EAL06832.1| oligoendopeptidase F [Listeria monocytogenes str. 1/2a F6854]
 gi|258599303|gb|EEW12628.1| oligoendopeptidase F [Listeria monocytogenes FSL N3-165]
 gi|258609678|gb|EEW22286.1| oligoendopeptidase F [Listeria monocytogenes F6900]
 gi|284058197|gb|ADB69138.1| hypothetical protein LM5578_2391 [Listeria monocytogenes 08-5578]
 gi|284061244|gb|ADB72183.1| hypothetical protein LM5923_2342 [Listeria monocytogenes 08-5923]
 gi|293590743|gb|EFF99077.1| oligoendopeptidase F [Listeria monocytogenes J2818]
          Length = 601

 Score =  468 bits (1203), Expect = e-129,   Method: Composition-based stats.
 Identities = 143/612 (23%), Positives = 273/612 (44%), Gaps = 21/612 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQE-ISNDMECIEHESLAFKTRWEGNLAHATN 80
           S    +  +E +     W+L  +YP+ ++ E    D++ I  ES  F    +G L+    
Sbjct: 2   SKTNALPLREEVPENLTWDLTTIYPNDEAWEQAFTDLQKITEESEQF----KGRLS---- 53

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
            ++  +L  A+   ++  +LI  +  YA L  + + ++   +  ++   + +      L 
Sbjct: 54  -ESSQTLYEALQFRDKAYDLISNLYVYAHLKMDQDTANAKYQGLHSRAGSLVTKLMSALS 112

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           ++  EI  +DE +L+Q   ++     Y   ++ +   + ++LS   E LL++  +V   +
Sbjct: 113 YYDPEILAMDENVLKQFLDENKDLQLYDHLLEELNLSRPYILSEKEEALLANAGEVLGSS 172

Query: 201 LKRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              F   N   ++F     +      I   +  K    +D  VR+ A   +   +    +
Sbjct: 173 SNTFNTLNNADMKFPTIKDENGEDIEITHGRFGKLLESNDPRVRRDAFHGVYSVYEGLKN 232

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
             +   N   K        R Y    ++    N++   V ++L++S  N      HRY +
Sbjct: 233 TLASTLNGQVKKSNFYASTRGYTSAREAALSGNHIPETVYDSLLKS-VNANASLLHRYVK 291

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+K+ L L+ ++ +D   PL         +E A++LVL++      +   I ++ F   W
Sbjct: 292 LRKELLGLEELHMYDLYTPLSDDVNLEFTYEEAKELVLEALKPLGDEYQAILKEAFDSRW 351

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           ID  +  GK           S +PYILLN+     +V TLAHELGH +H   + + Q  +
Sbjct: 352 IDVMENKGKR-SGAYSSGSYSTNPYILLNWQDNINNVYTLAHELGHSVHSYYTRKNQPFV 410

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
             + S+ LAE AS   E L  D LL+     + R  LL + ++    ++ RQ  F +FE 
Sbjct: 411 YGDYSIFLAEVASTTNENLLTDYLLKKYDDPKVRAYLLNHYLDGFKGTVFRQTQFAEFEH 470

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
            +H   +    +    + E + +  K+  G A    D E G  W  +PHF   ++YV+ Y
Sbjct: 471 AIHQADQQGVALTADFLTETYFDINKKYYGEAMVY-DAEIGYEWSRIPHFY-MNYYVFQY 528

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G    ++L     +   D     Y++ L+AG+S +  ++L    ++++ PN  +  L+
Sbjct: 529 ATGFSAASALSAKILTEGQDAVTA-YIDFLKAGSSDYPIDVLKKAGVDMATPNPVDDALK 587

Query: 615 TVEKMIDDVEKM 626
             E+ +D++E++
Sbjct: 588 VFEQRLDELEEL 599


>gi|226312111|ref|YP_002772005.1| oligopeptidase F [Brevibacillus brevis NBRC 100599]
 gi|226095059|dbj|BAH43501.1| oligopeptidase F [Brevibacillus brevis NBRC 100599]
          Length = 605

 Score =  468 bits (1203), Expect = e-129,   Method: Composition-based stats.
 Identities = 140/599 (23%), Positives = 263/599 (43%), Gaps = 19/599 (3%)

Query: 25  TTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC 84
            T+  + ++    +W LED+YP+ +  E   D++ ++  +       +G+LA      + 
Sbjct: 8   KTLPKRSDVPAEYKWRLEDMYPTDNDWE--ADVQKVKQLTEKIAA-MKGSLAT-----SG 59

Query: 85  HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL 144
             L A +   + + + + ++  YA +  + + ++   +       +        + +   
Sbjct: 60  KQLLAVLTLQDELLKTLDQVYVYARMRRDEDNANSQYQGLTDRATSLSTQVYGSISYIQP 119

Query: 145 EINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRF 204
           EI  +    L+    +      Y   +  I + K H LS + E LL++ S++     K F
Sbjct: 120 EILAISTEDLQTWIKEVEGLEHYRILLDEITRFKPHTLSAEEEALLANMSELASSPSKIF 179

Query: 205 FCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSF 258
              N   ++F +   +      +   +  +     DR VRK A +AL  T+ K  +  + 
Sbjct: 180 GMLNNADMKFPMITDESGEEVELTKGRYTQFMESKDRRVRKKAFEALYSTYGKFRNTIAA 239

Query: 259 ITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKK 318
              +  K +    R RKY     +   ++NVE  V + L+ ++  +     HRY  L+KK
Sbjct: 240 SLTSAIKGDVFYARTRKYPSALYAALFADNVELPVYDNLIATIHEH-LPLMHRYIALRKK 298

Query: 319 WLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAP 378
            L LD ++ +D   P+   +   IP++ A   + ++      +   I ++ F++ WID  
Sbjct: 299 LLGLDELHMYDLYVPIVPETDMKIPYDQAVSTIKEALHPLGEEYGRILDEGFSNGWIDVH 358

Query: 379 QYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNS 438
           + +GK SGA++ G   S HP++L+NY     ++ TLAHE+GH +H   S+  Q     + 
Sbjct: 359 ENEGKTSGAYSWGAYTS-HPFVLMNYQDNVNNMFTLAHEMGHALHSYYSNHAQPYTYADY 417

Query: 439 SLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHT 498
            + +AE AS   E L  + LL+  + K++R  L+ + +E    ++ RQ  F +FE  +H 
Sbjct: 418 KIFVAEVASTLNEALLMNHLLETTTDKKQRMYLINHYLEQFRGTVFRQTMFAEFEKIVHA 477

Query: 499 ERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGN 558
           +      +    ++ I+ E      GP   + D E    W  +PHF    FYVY YA G 
Sbjct: 478 KEEQGEPLTAESLSTIYRELNVAYHGPDMVV-DSEVDLEWARIPHFYR-GFYVYKYATGF 535

Query: 559 CLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
               SL             ++YL  L+ G+S +   LL    ++++ P      L   +
Sbjct: 536 SAATSLSKQILEEGQPAV-DRYLQFLKGGSSDYPLNLLKGAGVDMTSPTPIAEALSVFK 593


>gi|47091857|ref|ZP_00229652.1| oligoendopeptidase F [Listeria monocytogenes str. 4b H7858]
 gi|226224796|ref|YP_002758903.1| oligoendopeptidase [Listeria monocytogenes Clip81459]
 gi|254825248|ref|ZP_05230249.1| oligoendopeptidase F [Listeria monocytogenes FSL J1-194]
 gi|254931699|ref|ZP_05265058.1| oligoendopeptidase F [Listeria monocytogenes HPB2262]
 gi|255520808|ref|ZP_05388045.1| oligoendopeptidase [Listeria monocytogenes FSL J1-175]
 gi|300764003|ref|ZP_07073999.1| oligoendopeptidase F [Listeria monocytogenes FSL N1-017]
 gi|47019868|gb|EAL10606.1| oligoendopeptidase F [Listeria monocytogenes str. 4b H7858]
 gi|225877258|emb|CAS05972.1| Putative oligoendopeptidase [Listeria monocytogenes serotype 4b
           str. CLIP 80459]
 gi|293583254|gb|EFF95286.1| oligoendopeptidase F [Listeria monocytogenes HPB2262]
 gi|293594494|gb|EFG02255.1| oligoendopeptidase F [Listeria monocytogenes FSL J1-194]
 gi|300515344|gb|EFK42395.1| oligoendopeptidase F [Listeria monocytogenes FSL N1-017]
 gi|328465991|gb|EGF37172.1| oligoendopeptidase F [Listeria monocytogenes 1816]
 gi|332312640|gb|EGJ25735.1| Oligoendopeptidase F-like protein [Listeria monocytogenes str.
           Scott A]
          Length = 601

 Score =  468 bits (1203), Expect = e-129,   Method: Composition-based stats.
 Identities = 143/612 (23%), Positives = 273/612 (44%), Gaps = 21/612 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQE-ISNDMECIEHESLAFKTRWEGNLAHATN 80
           S    +  +E +     W+L  +YP+ ++ E    D++ I  ES  F    +G L+    
Sbjct: 2   SKTNALPLREEVPENLTWDLTTIYPNDEAWEQAFTDLQKITEESEQF----KGRLS---- 53

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
            ++  +L  A+   +   +LI  +  YA L  + + ++   +  ++   + +      L 
Sbjct: 54  -ESSQTLYEALQFRDNAYDLISNLYVYAHLKMDQDTANAKYQGLHSRAGSLVTKLMSALS 112

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           ++  EI  +DE++L+Q   ++     Y+  ++ +   + ++LS   E LL++  +V   +
Sbjct: 113 YYDPEILAMDESVLKQFLNENKDLQLYAHLLEELNLSRPYILSEKEEALLANAGEVLGSS 172

Query: 201 LKRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              F   N   ++F     +      I   +  K    +D  VR+ A   +   +    +
Sbjct: 173 SNTFNTLNNADMKFPTIKDENGEDIEITHGRFGKLLESNDPRVRREAFLGVYSVYEGLKN 232

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
             +   N   K        R Y    ++    N++   V ++L++S  N      HRY +
Sbjct: 233 TLASTLNGQVKKSNFYASTRGYTSAREAALSGNHIPETVYDSLLKS-VNANADLLHRYVK 291

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+K+ L L+ ++ +D   PL         +E A++LVL++      +   I ++ F   W
Sbjct: 292 LRKELLGLEELHMYDLYTPLSDDVNLEFTYEEAKELVLEALKPLGDEYQAILKEAFDSRW 351

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           ID  +  GK           S  PYILLN+     +V TLAHELGH +H   + + Q  +
Sbjct: 352 IDVMENKGKR-SGAYSSGSYSTSPYILLNWQDNINNVYTLAHELGHSVHSYYTRKNQPFV 410

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
             + S+ LAE AS   E L  D LL+     + R  LL + ++    ++ RQ  F +FE 
Sbjct: 411 YGDYSIFLAEVASTTNENLLTDYLLKKYDDPKVRAYLLNHYLDGFKGTVFRQTQFAEFEH 470

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
            +H   +    +    + E + +  K+  G A    D E G  W  +PHF   ++YV+ Y
Sbjct: 471 AIHQADQEGVALTADYLTETYFDINKKYYGEAMVY-DAEIGYEWSRIPHFY-MNYYVFQY 528

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G    ++L     +   +     Y++ L+AG+S +  ++L    ++++ PN  +  L+
Sbjct: 529 ATGFSAASALSAKILTEGQEAVTA-YIDFLKAGSSDYPIDVLKKAGVDMATPNPVDDALK 587

Query: 615 TVEKMIDDVEKM 626
             E+ +D++EK+
Sbjct: 588 VFEQRLDELEKL 599


>gi|46908422|ref|YP_014811.1| oligoendopeptidase F [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|46881693|gb|AAT04988.1| oligoendopeptidase F [Listeria monocytogenes serotype 4b str.
           F2365]
          Length = 601

 Score =  468 bits (1203), Expect = e-129,   Method: Composition-based stats.
 Identities = 143/612 (23%), Positives = 273/612 (44%), Gaps = 21/612 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQE-ISNDMECIEHESLAFKTRWEGNLAHATN 80
           S    +  +E +     W+L  +YP+ ++ E    D++ I  ES  F    +G L+    
Sbjct: 2   SKTNALPLREEVPENLTWDLTTIYPNDEAWEQAFTDLQKITEESEQF----KGRLS---- 53

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
            ++  +L  A+   +   +LI  +  YA L  + + ++   +  ++   + +      L 
Sbjct: 54  -ESSQTLYEALQFRDNAYDLISNLYVYAHLKMDQDTANAKYQGLHSRAGSLVTKLMSALS 112

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           ++  EI  +DE++L+Q   ++     Y+  ++ +   + ++LS   E LL++  +V   +
Sbjct: 113 YYDPEILAMDESVLKQFLNENKDLQLYAHLLEELNLSRPYILSEKEEALLANAGEVLGSS 172

Query: 201 LKRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              F   N   ++F     +      I   +  K    +D  VR+ A   +   +    +
Sbjct: 173 SNTFNTLNNADMKFPTIKDENGEDIEITHGRFGKLLESNDPRVRREAFLGVYSVYEGLKN 232

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
             +   N   K        R Y    ++    N++   V ++L++S  N      HRY +
Sbjct: 233 TLASTLNGQVKKSNFYASTRGYTSAREAALSGNHIPETVYDSLLKS-VNANADLLHRYVK 291

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+K+ L L+ ++ +D   PL         +E A++LVL++      +   I ++ F   W
Sbjct: 292 LRKELLGLEELHMYDLYMPLSDDVNLEFTYEEAKELVLEALKPLGDEYQAILKEAFDSRW 351

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           ID  +  GK           S  PYILLN+     +V TLAHELGH +H   + + Q  +
Sbjct: 352 IDVMENKGKR-SGAYSSGSYSTSPYILLNWQDNINNVYTLAHELGHSVHSYYTRKNQPFV 410

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
             + S+ LAE AS   E L  D LL+     + R  LL + ++    ++ RQ  F +FE 
Sbjct: 411 YGDYSIFLAEVASTTNENLLTDYLLKKYDDPKVRAYLLNHYLDGFKGTVFRQTQFAEFEH 470

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
            +H   +    +    + E + +  K+  G A    D E G  W  +PHF   ++YV+ Y
Sbjct: 471 AIHQADQEGVALTADYLTETYFDINKKYYGEAMVY-DAEIGYEWSRIPHFY-MNYYVFQY 528

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G    ++L     +   +     Y++ L+AG+S +  ++L    ++++ PN  +  L+
Sbjct: 529 ATGFSAASALSAKILTEGQEAVTA-YIDFLKAGSSDYPIDVLKKAGVDMATPNPVDDALK 587

Query: 615 TVEKMIDDVEKM 626
             E+ +D++EK+
Sbjct: 588 VFEQRLDELEKL 599


>gi|16804227|ref|NP_465712.1| hypothetical protein lmo2188 [Listeria monocytogenes EGD-e]
 gi|16411658|emb|CAD00266.1| lmo2188 [Listeria monocytogenes EGD-e]
          Length = 601

 Score =  467 bits (1202), Expect = e-129,   Method: Composition-based stats.
 Identities = 143/612 (23%), Positives = 273/612 (44%), Gaps = 21/612 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQE-ISNDMECIEHESLAFKTRWEGNLAHATN 80
           S    +  +E +     W+L  +YP+ ++ E    D++ I  ES  F    +G L+    
Sbjct: 2   SKTNALPLREEVPENLTWDLTTIYPNDEAWEKAFTDLQKITEESDQF----KGRLS---- 53

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
            ++  +L  A+   ++  +LI  +  YA L  + + ++   +  ++   + +      L 
Sbjct: 54  -ESSQTLYEALQFRDKAYDLISNLYVYAHLKMDQDTANAKYQGLHSRAGSLVTKLMSALS 112

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           ++  EI  +DE +L+Q   ++     Y   ++ +   + ++LS   E LL++  +V   +
Sbjct: 113 YYDPEILAMDENVLKQFLDENKDLQLYDHLLEELNLSRPYILSEKEEALLANAGEVLGSS 172

Query: 201 LKRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              F   N   ++F     +      I   +  K    +D  VR+ A   +   +    +
Sbjct: 173 SNTFNTLNNADMKFPTIKDENGEDIEITHGRFGKLLESNDPRVRRDAFHGVYSVYEGLKN 232

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
             +   N   K        R Y    ++    N++   V ++L++S  N      HRY +
Sbjct: 233 TLASTLNGQVKKSNFYASTRGYTSAREAALSGNHIPETVYDSLLKS-VNANASLLHRYVK 291

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+K+ L L+ ++ +D   PL         +E A++LVL++      +   I ++ F   W
Sbjct: 292 LRKELLGLEELHMYDLYTPLSDDVNLEFTYEEAKELVLEALKPLGDEYQAILKEAFDSRW 351

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           ID  +  GK           S +PYILLN+     +V TLAHELGH +H   + + Q  +
Sbjct: 352 IDVMENKGKR-SGAYSSGSYSTNPYILLNWQDNINNVYTLAHELGHSVHSYYTRKNQPFV 410

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
             + S+ LAE AS   E L  D LL+     + R  LL + ++    ++ RQ  F +FE 
Sbjct: 411 YGDYSIFLAEVASTTNENLLTDYLLKKYDDPKVRAYLLNHYLDGFKGTVFRQTQFAEFEH 470

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
            +H   +    +    + E + +  K+  G A    D E G  W  +PHF   ++YV+ Y
Sbjct: 471 AIHQADQQGVALTADFLTETYFDINKKYYGEAMVY-DAEIGYEWSRIPHFY-MNYYVFQY 528

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G    ++L     +   D     Y++ L+AG+S +  ++L    ++++ PN  +  L+
Sbjct: 529 ATGFSAASALSAKILTEGQDAVTA-YIDFLKAGSSDYPIDVLKKAGVDMATPNPVDDALK 587

Query: 615 TVEKMIDDVEKM 626
             E+ +D++E++
Sbjct: 588 VFEQKLDELEEL 599


>gi|296332575|ref|ZP_06875036.1| oligoendopeptidase F [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305673856|ref|YP_003865528.1| oligoendopeptidase F [Bacillus subtilis subsp. spizizenii str. W23]
 gi|296150493|gb|EFG91381.1| oligoendopeptidase F [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305412100|gb|ADM37219.1| oligoendopeptidase F [Bacillus subtilis subsp. spizizenii str. W23]
          Length = 670

 Score =  467 bits (1202), Expect = e-129,   Method: Composition-based stats.
 Identities = 135/614 (21%), Positives = 278/614 (45%), Gaps = 19/614 (3%)

Query: 19  LRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHA 78
                   +  +  +     W LED++PS ++   + + + ++       ++++G LA  
Sbjct: 63  AEEKKANQLPDRSEVKAEDTWRLEDIFPSDEAW--NKEFQAVKELIPNL-SKYKGKLAD- 118

Query: 79  TNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKV 138
               +   L  A+   +++ E +GR+ +YA +  + +  +   +                
Sbjct: 119 ----SADHLYEALTFQDKVMERLGRLYTYAHMRSDQDTGNSFYQGLNDKAGNLYTQAASA 174

Query: 139 LIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGR 198
             +   EI +++E  L+Q   +      YS  I+ I K + H+LS   E LL++ S V  
Sbjct: 175 TAYLVPEILSIEEDKLQQFILEKEELKLYSHAIEEITKERPHVLSEKEEALLAEASDVLG 234

Query: 199 EALKRFFCENIESLRFKI------NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKS 252
            +   F   N   + F        N+++I            +REVRK+A  A+  T+ + 
Sbjct: 235 SSSNTFSVLNNAEITFPSIKDEEGNEKQITHGNFINFLESENREVRKNAFDAVYKTYGQY 294

Query: 253 SHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRY 312
            +  +   +   K +    R +KY+   ++   +N++   V + L++++  +     HRY
Sbjct: 295 KNTMATTLSGTVKKDNFYARVKKYKSAREAALSNNSIPEEVYDNLVKTINKH-LPLLHRY 353

Query: 313 YELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTH 372
             L+KK L+LD ++ +D   PL   +   + +E A+D +L+  A    + + I ++   +
Sbjct: 354 IALRKKVLELDEVHIYDLYTPLVKDAGMKVTYEEAKDYMLKGLAPLGEEYASILKEGLEN 413

Query: 373 NWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQG 432
            W+D  +  GK +GA++ G     +PYIL+N+     ++ TL HE GH +H   + + Q 
Sbjct: 414 RWVDVYENKGKRNGAYSSG-AYGTNPYILMNWHDNVNNLFTLVHEFGHSVHSYYTRKHQP 472

Query: 433 ILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDF 492
               N S+ +AE AS   E L  + LL     +++R  +L + +E    ++ RQ  F +F
Sbjct: 473 YPYGNYSIFVAEVASTTNEALLGEYLLNNLDDEKQRLYILNHMLEGFRGTVFRQTMFAEF 532

Query: 493 ELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVY 552
           E  +HT+ +    +    +  ++ +  K+  G    + D E G  W  +PHF  + +   
Sbjct: 533 EHLIHTKAQEGEPLTPELLTNVYYDLNKKYFGDGMVI-DKEIGLEWSRIPHFYYNYYVYQ 591

Query: 553 AYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERG 612
             A G     +L             ++Y++ L+AG+S++  ++L    ++++ P   E  
Sbjct: 592 Y-ATGYSAAQALSSQILKEGKPAV-DRYIDFLKAGSSQYPIDVLKKAGVDMTSPEPIEAA 649

Query: 613 LQTVEKMIDDVEKM 626
            +  E+ +D++E++
Sbjct: 650 CKMFEEKLDEMEEL 663


>gi|138894374|ref|YP_001124827.1| oligopeptidase F [Geobacillus thermodenitrificans NG80-2]
 gi|134265887|gb|ABO66082.1| Oligopeptidase F [Geobacillus thermodenitrificans NG80-2]
          Length = 607

 Score =  467 bits (1202), Expect = e-129,   Method: Composition-based stats.
 Identities = 134/608 (22%), Positives = 270/608 (44%), Gaps = 19/608 (3%)

Query: 25  TTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC 84
            ++ S+  +     W LED++P+ D+ E   + + ++       + ++G L      ++ 
Sbjct: 10  KSLPSRSEIPVEETWRLEDIFPTDDAWE--QEFQQVKAMIPKI-SEYKGRLG-----ESP 61

Query: 85  HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL 144
             +  A+   + +   +G++ +YA + Y+ + ++   +          ++    + F   
Sbjct: 62  EVMYEALQYQDEVSMRLGKLYTYAHMRYDQDTTNSFYQGLDDRAKGLYSEASSAMAFIVP 121

Query: 145 EINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRF 204
           EI  +DEA+L     Q      Y   +  I + + H+LS + E LL+  ++V +     F
Sbjct: 122 EILAIDEAVLRSFLEQYEPLRLYEHALDEITRQRPHVLSAEEEALLAQAAEVMQATSSTF 181

Query: 205 FCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSF 258
              N   L F     +      +   +  +    +DR VR+ A  A+ HT+ K  + F+ 
Sbjct: 182 SALNNADLTFPTIRDENGDEVEVTHGRFIRFLESTDRRVRRDAFHAVYHTYEKFQNTFAN 241

Query: 259 ITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKK 318
                 K +    R R+Y+   ++   +NN+   V + L+ ++  +     HRY  L+K 
Sbjct: 242 TLAGTVKKDNFFARVRRYKSAREAALDANNIPESVYDNLIATIHEH-LPLLHRYVRLRKS 300

Query: 319 WLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAP 378
            L LD ++ +D   PL    +  + ++ A+  +L   A    +   I ++   + W+D  
Sbjct: 301 VLGLDELHMYDLYTPLVQDVKMEVTYDEAKQYMLDGLAPLGEEYVSIVKEGLENRWVDVR 360

Query: 379 QYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNS 438
           +  GK SGA++ G     HPYILLN+     ++ TL HE GH +H   + +TQ     + 
Sbjct: 361 ENKGKRSGAYSSG-AYGTHPYILLNWQDNVNNLFTLVHEFGHSVHSYYTRKTQPYPYAHY 419

Query: 439 SLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHT 498
           S+ +AE AS   E L  D LL+    +++R  LL + +E    ++ RQ  F +FE  +H 
Sbjct: 420 SIFVAEVASTCNEALLNDYLLKTIDDEKKRLYLLNHYLEGFRGTVFRQTMFAEFEHLIHL 479

Query: 499 ERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGN 558
           + +    +    +  ++ +  K+  G    + D E G  W  +PHF  + +     A G 
Sbjct: 480 KAQEGEALTAQTLTSLYYDLNKKYFGDDMVV-DEEIGLEWARIPHFYYNYYVYQY-ATGF 537

Query: 559 CLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
               +L             ++Y+  L+AG+S +  E+L    ++++      +  Q   +
Sbjct: 538 SAATALSKQILEEGEPAV-KRYIEFLKAGSSDYPIEVLKKAGVDMTSAEPIRQACQVFAE 596

Query: 619 MIDDVEKM 626
            ++++E++
Sbjct: 597 KLEEMERL 604


>gi|261419056|ref|YP_003252738.1| oligoendopeptidase F [Geobacillus sp. Y412MC61]
 gi|319765873|ref|YP_004131374.1| oligoendopeptidase F [Geobacillus sp. Y412MC52]
 gi|261375513|gb|ACX78256.1| oligoendopeptidase F [Geobacillus sp. Y412MC61]
 gi|317110739|gb|ADU93231.1| oligoendopeptidase F [Geobacillus sp. Y412MC52]
          Length = 607

 Score =  467 bits (1202), Expect = e-129,   Method: Composition-based stats.
 Identities = 135/608 (22%), Positives = 270/608 (44%), Gaps = 19/608 (3%)

Query: 25  TTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC 84
            ++  +  +     W LED++P+ D+ E   + + ++         ++G L      ++ 
Sbjct: 10  KSLPLRSEIPVEETWRLEDIFPTDDAWE--EEFKQVKAMIPKL-GEYKGRLG-----ESP 61

Query: 85  HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL 144
             L  A+   + +   +G++ +YA + Y+ + ++   +       +  ++    + F   
Sbjct: 62  EVLYEALQCQDDVSMRLGKLYTYAHMRYDQDTTNSFYQGLDARAKSLYSEASSAMAFIVP 121

Query: 145 EINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRF 204
           EI  +DEA+L     Q      Y+  +  I + + H+LS + E +L+  ++V +     F
Sbjct: 122 EILAIDEAVLRSFLEQYEPLRLYAHALDEITRQRPHVLSAEEEAILAQAAEVMQATSDTF 181

Query: 205 FCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSF 258
              N   L F     +      +   +  +    +DR VR+ A  A+ HT+ K  + F+ 
Sbjct: 182 SALNNADLTFPTIIDENGEEVEVTHGRFIRFLESTDRRVRRDAFYAVYHTYEKFQNTFAN 241

Query: 259 ITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKK 318
                 K +    R R+Y    ++   +NN+   V + L+ ++  +     HRY  L+K+
Sbjct: 242 TLAGTVKKDNFFARIRRYRSAREAALDANNIPESVYDNLIATIHEH-LPLLHRYVRLRKR 300

Query: 319 WLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAP 378
            L LD ++ +D   PL    +  + +E A+  +L+  A    +   I ++   + W+D  
Sbjct: 301 VLGLDELHMYDLYTPLVQEVKMEVTYEEAKQYMLEGLAPLGEEYVAIVKEGLDNRWVDVR 360

Query: 379 QYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNS 438
           +  GK SGA++ G     HPYILLN+     ++ TL HE GH +H   + +TQ     + 
Sbjct: 361 ENKGKRSGAYSSG-AYGTHPYILLNWQDNVNNLFTLVHEFGHSVHSYYTRKTQPYPYAHY 419

Query: 439 SLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHT 498
           S+ +AE AS   E L  D LL+    +++R  LL + +E    ++ RQ  F +FE  +H 
Sbjct: 420 SIFVAEVASTCNEALLNDYLLRTIDDEKKRLYLLNHYLEGFRGTVFRQTMFAEFEHLIHL 479

Query: 499 ERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGN 558
           + +    +    +  ++ +  K   G    + D E G  W  +PHF  + +     A G 
Sbjct: 480 KAQQGEALTAETLTSLYYDLNKTYFGDDIVV-DKEIGLEWARIPHFYYNYYVYQY-ATGF 537

Query: 559 CLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
               +L              +Y++ L+AG+S +  E+L    ++++      +  Q   +
Sbjct: 538 SAATALSKQILEEGEPAV-RRYIDFLKAGSSDYPIEVLKKAGVDMTSAEPIRQACQVFAE 596

Query: 619 MIDDVEKM 626
            +D++E++
Sbjct: 597 KLDEMERL 604


>gi|224498934|ref|ZP_03667283.1| hypothetical protein LmonF1_04223 [Listeria monocytogenes Finland
           1988]
          Length = 601

 Score =  467 bits (1201), Expect = e-129,   Method: Composition-based stats.
 Identities = 143/612 (23%), Positives = 273/612 (44%), Gaps = 21/612 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQE-ISNDMECIEHESLAFKTRWEGNLAHATN 80
           S    +  +E +     W+L  +YP+ ++ E    D++ I  ES  F    +G L+    
Sbjct: 2   SKTNALPLREEVPENLTWDLTTIYPNDETWEKAFTDLQKITEESDQF----KGRLS---- 53

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
            ++  +L  A+   ++  +LI  +  YA L  + + ++   +  ++   + +      L 
Sbjct: 54  -ESSQTLYEALQFRDKAYDLISNLYVYAHLKMDQDTANAKYQGLHSRAGSLVTKLMSALS 112

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           ++  EI  +DE +L+Q   ++     Y   ++ +   + ++LS   E LL++  +V   +
Sbjct: 113 YYDPEILAMDENVLKQFLDENKDLQLYDHLLEELNLSRPYILSEKEEALLANAGEVLGSS 172

Query: 201 LKRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              F   N   ++F     +      I   +  K    +D  VR+ A   +   +    +
Sbjct: 173 SNTFNTLNNADMKFPTIKDENGEDIEITHGRFGKLLESNDPRVRRDAFHGVYSVYEGLKN 232

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
             +   N   K        R Y    ++    N++   V ++L++S  N      HRY +
Sbjct: 233 TLASTLNGQVKKSNFYASTRGYTSAREAALSGNHIPETVYDSLLKS-VNANASLLHRYVK 291

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+K+ L L+ ++ +D   PL         +E A++LVL++      +   I ++ F   W
Sbjct: 292 LRKELLGLEELHMYDLYTPLSDNVNLEFTYEEAKELVLEALKPLGDEYQAILKEAFDSRW 351

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           ID  +  GK           S +PYILLN+     +V TLAHELGH +H   + + Q  +
Sbjct: 352 IDVMENKGKR-SGAYSSGSYSTNPYILLNWQDNINNVYTLAHELGHSVHSYYTRKNQPFV 410

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
             + S+ LAE AS   E L  D LL+     + R  LL + ++    ++ RQ  F +FE 
Sbjct: 411 YGDYSIFLAEVASTTNENLLTDYLLKKYDDPKVRAYLLNHYLDGFKGTVFRQTQFAEFEH 470

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
            +H   +    +    + E + +  K+  G A    D E G  W  +PHF   ++YV+ Y
Sbjct: 471 AIHQADQQGVALTADFLTETYFDINKKYYGEAMVY-DAEIGYEWSRIPHFY-MNYYVFQY 528

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G    ++L     +   D     Y++ L+AG+S +  ++L    ++++ PN  +  L+
Sbjct: 529 ATGFSAASALSAKILTEGQDAVTA-YIDFLKAGSSDYPIDVLKKAGVDMATPNPVDDALK 587

Query: 615 TVEKMIDDVEKM 626
             E+ +D++E++
Sbjct: 588 VFEQRLDELEEL 599


>gi|315304342|ref|ZP_07874664.1| oligoendopeptidase F [Listeria ivanovii FSL F6-596]
 gi|313627289|gb|EFR96100.1| oligoendopeptidase F [Listeria ivanovii FSL F6-596]
          Length = 601

 Score =  466 bits (1200), Expect = e-129,   Method: Composition-based stats.
 Identities = 140/611 (22%), Positives = 273/611 (44%), Gaps = 19/611 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           S    +  +E +     W+L  +YPS ++ E     E +  +     T+++G+LA     
Sbjct: 2   SKTNALPLREEVPKELTWDLATIYPSDEAWE--KAFEEL-QKIAEESTKFKGHLAD---- 54

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            +  +L  A+   ++  +LI  +  YA L  + + ++   +  ++   + +      L +
Sbjct: 55  -SSQTLYEALQFRDKAYDLISNLYVYAHLKMDQDTANAKYQGLHSRAGSLVTKLMSALSY 113

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
           +  EI  +DE +L Q   ++     Y   ++ +   + ++LS   E LL++  +V   + 
Sbjct: 114 YDPEILAMDETVLNQFVKENSDLQLYGHLLEELNLSRPYILSEKEEALLANAGEVLGSSS 173

Query: 202 KRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   ++F     +      I   +  K    +D  VR+ A   +   +    + 
Sbjct: 174 NTFNTLNNADMKFPTIKDEDGEEIEITHGRFGKLLESNDPRVRRDAFLGVYSVYEGLKNT 233

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
            +   N   K        R Y+   ++    N++   V ++L++S  N      HRY +L
Sbjct: 234 LASTLNGQVKKSNFYAATRGYQSAREAALSGNHIPETVYDSLLKS-VNTNANLLHRYVKL 292

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L L+ ++ +D   PL         ++ A++LVL++      +   I ++ F+  WI
Sbjct: 293 RKELLGLEELHMYDLYTPLSDDVNLEFTYDEAKELVLEALKPLGEEYQEILKEAFSSRWI 352

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK           S +PYILLN+     +V TLAHELGH +H   + + Q  + 
Sbjct: 353 DVMENKGKR-SGAYSSGSYSTNPYILLNWQDNINNVYTLAHELGHSVHSYYTRKNQPFVY 411

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ LAE AS   E L  D LL+     + R  LL + ++    ++ RQ  F +FE  
Sbjct: 412 GDYSIFLAEVASTTNENLLTDYLLKKYEDPKVRAYLLNHYLDGFKGTVFRQTQFAEFEHT 471

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H   ++   +    + E + +  K+  G A    D E G  W  +PHF   ++YV+ YA
Sbjct: 472 IHQADQNGIALTADYLTETYFDINKKYYGEAMVY-DEEIGYEWSRIPHFY-MNYYVFQYA 529

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G    ++L     +         Y++ L+AG+S +  ++L    ++++ P+  +  L+ 
Sbjct: 530 TGFSAASALSAKILTEGQSAVTA-YIDFLKAGSSDYPIDVLKKAGVDMATPDPVDDALKV 588

Query: 616 VEKMIDDVEKM 626
            E+ +D++EK+
Sbjct: 589 FEQRLDELEKL 599


>gi|254993091|ref|ZP_05275281.1| oligoendopeptidase [Listeria monocytogenes FSL J2-064]
          Length = 601

 Score =  466 bits (1200), Expect = e-129,   Method: Composition-based stats.
 Identities = 143/612 (23%), Positives = 272/612 (44%), Gaps = 21/612 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQE-ISNDMECIEHESLAFKTRWEGNLAHATN 80
           S    +  +E +     W+L  +YP+ +  E    D++ I  ES  F    +G L+    
Sbjct: 2   SKTNALPLREEVPENLTWDLTTIYPNDEGWEQAFTDLQKITEESEQF----KGRLS---- 53

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
            ++  +L  A+   +   +LI  +  YA L  + + ++   +  ++   + +      L 
Sbjct: 54  -ESSQTLYEALQFRDNAYDLISNLYVYAHLKMDQDTANAKYQGLHSRAGSLVTKLMSALS 112

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           ++  EI  +DE++L+Q   ++     Y+  ++ +   + ++LS   E LL++  +V   +
Sbjct: 113 YYDPEILAMDESVLKQFLNENKDLQLYAHLLEELNLSRPYILSEKEEALLANAGEVLGSS 172

Query: 201 LKRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              F   N   ++F     +      I   +  K    +D  VR+ A   +   +    +
Sbjct: 173 SNTFNTLNNADMKFPTIKDENGEDIEITHGRFGKLLESNDPRVRREAFLGVYSVYEGLKN 232

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
             +   N   K        R Y    ++    N++   V ++L++S  N      HRY +
Sbjct: 233 TLASTLNGQVKKSNFYASTRGYTSAREAALSGNHIPETVYDSLLKS-VNANADLLHRYVK 291

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+K+ L L+ ++ +D   PL         +E A++LVL++      +   I ++ F   W
Sbjct: 292 LRKELLGLEELHMYDLYTPLSDDVNLEFTYEEAKELVLEALKPLGDEYQAILKEAFDSRW 351

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           ID  +  GK           S  PYILLN+     +V TLAHELGH +H   + + Q  +
Sbjct: 352 IDVMENKGKR-SGAYSSGSYSTSPYILLNWQDNINNVYTLAHELGHSVHSYYTRKNQPFV 410

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
             + S+ LAE AS   E L  D LL+     + R  LL + ++    ++ RQ  F +FE 
Sbjct: 411 YGDYSIFLAEVASTTNENLLTDYLLKKYDDPKVRAYLLNHYLDGFKGTVFRQTQFAEFEH 470

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
            +H   +    +    + E + +  K+  G A    D E G  W  +PHF   ++YV+ Y
Sbjct: 471 AIHQADQEGVALTADYLTETYFDINKKYYGEAMVY-DAEIGYEWSRIPHFY-MNYYVFQY 528

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G    ++L     +   +     Y++ L+AG+S +  ++L    ++++ PN  +  L+
Sbjct: 529 ATGFSAASALSAKILTEGQEAVTA-YIDFLKAGSSDYPIDVLKKAGVDMATPNPVDDALK 587

Query: 615 TVEKMIDDVEKM 626
             E+ +D++EK+
Sbjct: 588 VFEQRLDELEKL 599


>gi|196248014|ref|ZP_03146716.1| oligoendopeptidase F [Geobacillus sp. G11MC16]
 gi|196212798|gb|EDY07555.1| oligoendopeptidase F [Geobacillus sp. G11MC16]
          Length = 607

 Score =  466 bits (1200), Expect = e-129,   Method: Composition-based stats.
 Identities = 134/608 (22%), Positives = 269/608 (44%), Gaps = 19/608 (3%)

Query: 25  TTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC 84
            ++ S+  +     W LED++P+ D+ E   + + ++       + ++G L      ++ 
Sbjct: 10  KSLPSRSEIPVEETWRLEDIFPTDDAWE--QEFQQVKAMIPKI-SEYKGRLG-----ESP 61

Query: 85  HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL 144
             +  A+   + +   +G++ +YA + Y+ + ++   +          ++    + F   
Sbjct: 62  EVMYEALQYQDEVSMRLGKLYTYAHMRYDQDTTNSFYQGLDDRAKGLYSEASSAMAFIVP 121

Query: 145 EINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRF 204
           EI  +DEA+L     Q      Y   +  I + + H+LS + E LL+  ++V +     F
Sbjct: 122 EILAIDEAVLRSFLEQYEPLRLYEHALDEITRQRPHVLSAEEEALLAQAAEVMQATSSTF 181

Query: 205 FCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSF 258
              N   L F     +      +   +  +    +DR VR+ A  A+ HT+ K  + F+ 
Sbjct: 182 SALNNADLTFPTIRDENGDEVEVTHGRFIRFLESTDRRVRRDAFHAVYHTYEKFQNTFAN 241

Query: 259 ITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKK 318
                 K +    R R+Y+   ++   +NN+   V + L+ ++  +     HRY  L+K 
Sbjct: 242 TLAGTVKKDNFFARVRRYKSAREAALDANNIPESVYDNLIATIHEH-LPLLHRYVRLRKS 300

Query: 319 WLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAP 378
            L LD ++ +D   PL    +  + ++ A+  +L   A    +   I ++   + W+D  
Sbjct: 301 VLGLDELHMYDLYTPLVQDVKMEVTYDEAKQYMLDGLAPLGEEYVSIVKEGLENRWVDVR 360

Query: 379 QYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNS 438
           +  GK SGA++ G     HPYILLN+     ++ TL HE GH +H   + +TQ     + 
Sbjct: 361 ENKGKRSGAYSSG-AYGTHPYILLNWQDNVNNLFTLVHEFGHSVHSYYTRKTQPYPYAHY 419

Query: 439 SLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHT 498
           S  +AE AS   E L  D LL+    +++R  LL + +E    ++ RQ  F +FE  +H 
Sbjct: 420 STFVAEVASTCNEALLNDYLLKTIDDEKKRLYLLNHYLEGFRGTVFRQTMFAEFEHLIHL 479

Query: 499 ERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGN 558
           + +    +    +  ++ +  K+  G    + D E G  W  +PHF  + +     A G 
Sbjct: 480 KAQEGEALTAQTLTSLYYDLNKKYFGDDMVV-DEEIGLEWARIPHFYYNYYVYQY-ATGF 537

Query: 559 CLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
               +L             ++Y+  L+AG+S +  E+L    ++++      +  Q   +
Sbjct: 538 SAATALSKQILEEGEPAV-KRYIEFLKAGSSDYPIEVLKKAGVDMTSAEPIRQACQVFAE 596

Query: 619 MIDDVEKM 626
            ++++E++
Sbjct: 597 KLEEMERL 604


>gi|315283277|ref|ZP_07871504.1| oligoendopeptidase F [Listeria marthii FSL S4-120]
 gi|313613078|gb|EFR86993.1| oligoendopeptidase F [Listeria marthii FSL S4-120]
          Length = 601

 Score =  466 bits (1200), Expect = e-129,   Method: Composition-based stats.
 Identities = 146/612 (23%), Positives = 272/612 (44%), Gaps = 21/612 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISN-DMECIEHESLAFKTRWEGNLAHATN 80
           S    +  +E +     W+L  +YP+ ++ E +  D++ I  ES  F    +G LA    
Sbjct: 2   SKTNALPLREEVPENLTWDLTTIYPNDEAWEQAFVDLQKITEESEQF----KGRLA---- 53

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
            ++  +L  A+   +   +LI  +  YA L  + + ++   +  Y+   + +      L 
Sbjct: 54  -ESSQTLFEALQFRDNAYDLISNLYVYAHLKMDQDTANAKYQGLYSRAGSLVTKLMSALS 112

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           ++  EI  +DE  L+Q   ++     Y+  ++ +   + ++LS   E LL++  +V   +
Sbjct: 113 YYDPEILAMDENTLQQFLDENKDLQLYAHLLEELNLSRPYILSEKEEALLANAGEVLGSS 172

Query: 201 LKRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              F   N   ++F     +      I   +  K    +D  VR+ A   +   +    +
Sbjct: 173 SNTFNTLNNADMKFPTIKDENGEEIEITHGRFGKLLESNDPRVRRDAFLGVYSVYEGLKN 232

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
             +   N   K        R Y    ++    N++   V +AL++S  N      HRY +
Sbjct: 233 TLASTLNGQVKKSNFYAATRGYTSAREAALSGNHIPETVYDALLKS-VNANASLLHRYVK 291

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+K+ L L+ ++ +D   PL         +E A++LVL++      +   I ++ F   W
Sbjct: 292 LRKELLGLEELHMYDLYTPLSDDVNLEFTYEEAKELVLEALKPLGEEYQAILKEAFDGRW 351

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           ID  +  GK           S +PYILLN+     +V TLAHELGH +H   + + Q  +
Sbjct: 352 IDVMENKGKR-SGAYSSGSYSTNPYILLNWQDNINNVYTLAHELGHSVHSYYTRKNQPFV 410

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
             + S+ LAE AS   E L  D LL+     + R  LL + ++    ++ RQ  F +FE 
Sbjct: 411 YGDYSIFLAEVASTTNENLLTDYLLKKYDDPKVRAYLLNHYLDGFKGTVFRQTQFAEFEH 470

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
            +H   +    +    + E + +  K+  G A    D E G  W  +PHF   ++YV+ Y
Sbjct: 471 AIHQADQEGVALTADYLTETYFDINKKYYGEAMVY-DAEIGYEWSRIPHFY-MNYYVFQY 528

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G    ++L     +         Y++ L+AG+S +  ++L    ++++ PN  +  L+
Sbjct: 529 ATGFSAASALSAKILTEGQTAVTA-YIDFLKAGSSDYPIDVLKKAGVDMATPNPVDDALK 587

Query: 615 TVEKMIDDVEKM 626
             E+ +D++EK+
Sbjct: 588 VFEQRLDELEKL 599


>gi|1651216|dbj|BAA13561.1| Pz-peptidase [Bacillus licheniformis]
          Length = 628

 Score =  466 bits (1199), Expect = e-129,   Method: Composition-based stats.
 Identities = 135/614 (21%), Positives = 280/614 (45%), Gaps = 19/614 (3%)

Query: 19  LRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHA 78
                   +  +  +     W LED++PS ++   + + + ++       ++++G LA  
Sbjct: 21  AEEKKANQLPDRSEVKAEDTWRLEDIFPSDEAW--NKEFQAVKELIPNL-SKYKGKLAD- 76

Query: 79  TNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKV 138
               +   L  A+   +++ E +GR+ +YA +  + +  +   +                
Sbjct: 77  ----SADHLYEALTYQDKVMERLGRLYTYAHMRSDQDTGNSFYQGLNDKAGNLYTQAASA 132

Query: 139 LIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGR 198
             +   EI +++E  L+Q   +      YS  I+ I K + H+LS   E LL++ S+V  
Sbjct: 133 TAYLVPEILSIEEDKLQQFILEKEELKLYSHAIEEITKERPHVLSEKEEALLAEASEVLG 192

Query: 199 EALKRFFCENIESLRFKI------NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKS 252
            +   F   N   + F        N+++I            +REVRK+A  A+  T+ + 
Sbjct: 193 SSSNTFSVLNNADITFPSIKDEDGNEKQITHGNFINFLESENREVRKNAFDAVYKTYGQY 252

Query: 253 SHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRY 312
            +  +   +   K +    R +KY+   ++   +N++   V + L++++  +     HRY
Sbjct: 253 KNTMATTLSGTVKKDNFYARVKKYKSAREAALSNNSIPEEVYDNLVKTINKH-LPLLHRY 311

Query: 313 YELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTH 372
             L+KK L+LD ++ +D   PL   +   + +E A+D +L+  A    + + I ++   +
Sbjct: 312 IALRKKVLELDEVHIYDLYTPLVKDAGMKVTYEEAKDYMLKGLAPLGEEYASILKEGLEN 371

Query: 373 NWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQG 432
            W+D  +  GK +GA++ G     +PYIL+N+     ++ TL HE GH +H   + + Q 
Sbjct: 372 RWVDVYENKGKRNGAYSSG-AYGTNPYILMNWHNNVNNLFTLVHEFGHSVHSYYTRKHQP 430

Query: 433 ILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDF 492
               N S+ +AE AS   E L  + LL     +++R  +L + +E    ++ RQ  F +F
Sbjct: 431 YPYGNYSIFVAEVASTTNEALLGEYLLNNLEDEKQRLYILNHMLEGFRGTVFRQTMFAEF 490

Query: 493 ELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVY 552
           E  +HT+ +    +    + +++ +  K+  G    + D E G  W  +PHF  + +   
Sbjct: 491 EHLIHTKAQEGEPLTPELLTKVYYDLNKKYFGDGMVI-DKEIGLEWSRIPHFYYNYYVYQ 549

Query: 553 AYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERG 612
             A G     +L             ++Y++ L+AG+S++  ++L    ++++ P   E  
Sbjct: 550 Y-ATGYSAAQALSSQILKEGKPAV-DRYIDFLKAGSSQYPIDVLKKAGVDMTSPEPIEAA 607

Query: 613 LQTVEKMIDDVEKM 626
            +  E+ +D++E++
Sbjct: 608 CKMFEEKLDEMEEL 621


>gi|163848151|ref|YP_001636195.1| oligoendopeptidase F [Chloroflexus aurantiacus J-10-fl]
 gi|222526052|ref|YP_002570523.1| oligoendopeptidase F [Chloroflexus sp. Y-400-fl]
 gi|163669440|gb|ABY35806.1| oligoendopeptidase F [Chloroflexus aurantiacus J-10-fl]
 gi|222449931|gb|ACM54197.1| oligoendopeptidase F [Chloroflexus sp. Y-400-fl]
          Length = 602

 Score =  466 bits (1199), Expect = e-129,   Method: Composition-based stats.
 Identities = 140/612 (22%), Positives = 265/612 (43%), Gaps = 19/612 (3%)

Query: 21  SSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
           ++  + + ++  +     W+L  ++P   + E   ++  +E  +       +G LA    
Sbjct: 2   TTTTSKVPTRAEVPEEYTWDLSQIFPDVAAWE--QELSAVEARAQELAA-LQGTLA---- 54

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
            +    L  A+   + +   +  I  YA    + + ++P  +      ++  A  +  L 
Sbjct: 55  -QGPAQLLTALTLRDEVGRRLYAIYVYATHLKDSDSTNPVGQGLAERASSFAARIQAALA 113

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           F   E+ T+    +E      P    Y   ++ + + + H+ S ++E ++++ S + R  
Sbjct: 114 FIEPELLTIPAETIEAWVDATPDLHVYRYELEKLNRQRAHIRSAEVEQVMAEFSDLVRTP 173

Query: 201 LKRFFCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
            + F       L+F   +       ++   +  +     DR VR+ A K     F    +
Sbjct: 174 YRTFSMLTDSDLQFPTIEDENGQPVQLSHARYGRLLESQDRRVRRDAFKGYYSAFLPFRN 233

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
             +       +   I+ R R Y    ++    N +   V   L+ +         HRY  
Sbjct: 234 TIATTLGAAIRSHVIEARLRNYSSALEAALAPNEIPVEVYHNLI-ATVEANLPRFHRYLS 292

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           ++++ L LD ++F+D         +  IP+  A DL+  ++     + S   E+ F+  W
Sbjct: 293 VRRRLLGLDELHFYDLYVQPVPDVELTIPYHEACDLMRSAFRPLGEEYSAALEQMFSRRW 352

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           ID  +  GK SGA++ G+     PYILLNY  + +DV TLAHELGH +H   +   Q  +
Sbjct: 353 IDVYENVGKRSGAYSGGS-YGTPPYILLNYQDRLRDVFTLAHELGHSLHSYFTRTHQPFV 411

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
             N ++ +AE AS   E L    +L   + +  R+ LLA +IE++  +I RQ  F  FEL
Sbjct: 412 YGNYTIFVAEVASTLNEALLTHYMLTNGADEALRRRLLAQQIEEIRGTIFRQTMFAAFEL 471

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
            +H        +    +++ + +      GP   + D E    WM +PHF   +FYVY Y
Sbjct: 472 WMHERAERGQPLTADALSQYYRDLVIRYHGPELQVDD-ELAYEWMRIPHFY-YNFYVYQY 529

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     +L     +       E+YL  LR+G+S+   +LL    ++++ P   +  + 
Sbjct: 530 ATGISAALALSRQIINEGQPA-IERYLRFLRSGSSRSSIDLLRDAGVDMTSPEPIQAAMD 588

Query: 615 TVEKMIDDVEKM 626
           T   ++D +E++
Sbjct: 589 TFAGLVDQLEQL 600


>gi|313636804|gb|EFS02441.1| oligoendopeptidase F [Listeria seeligeri FSL S4-171]
          Length = 601

 Score =  466 bits (1199), Expect = e-129,   Method: Composition-based stats.
 Identities = 138/611 (22%), Positives = 273/611 (44%), Gaps = 19/611 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           S    +  +E +     W+L  +YP+ ++ E       ++  +    T+++G LA     
Sbjct: 2   SKTNALPLREEVPENLTWDLTSIYPNDEAWE--EAFVQLQKTAEE-STKFKGRLAD---- 54

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            N  +L  A+   ++  +LI  +  YA L  + + ++   +  ++   + +      L +
Sbjct: 55  -NSQTLYEALQFRDKAYDLISNLYVYAHLKMDQDTANAKYQGLHSRAGSLVTKLMSALSY 113

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
           +  EI  +DE++L+Q   ++     YS  ++ +   + ++LS   E LL++  +V   + 
Sbjct: 114 YDPEILAMDESVLKQFLEENQDLQLYSHLLEELNLSRPYILSEKEEALLANAGEVLGSSS 173

Query: 202 KRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   ++F     +      I   +  K    +D  VR+ A   +   +    + 
Sbjct: 174 NTFNTLNNADMKFPTIKNEDGEEIEITHGRYGKLLESNDPRVRREAFLGVYSVYEGLKNT 233

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
            +   N   K        R Y+   ++   +N++   V ++L++S  N      HRY +L
Sbjct: 234 LASTLNGQVKKSNFYASTRGYKSAREAALSNNHIPETVYDSLLKS-VNENANLLHRYVKL 292

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L L+ ++ +D   PL         ++ A++LVL++      +   I ++ F   WI
Sbjct: 293 RKELLGLEELHMYDLYTPLSDDVNLEFSYDEAKELVLEALKPLGEEYQSILKEAFDSRWI 352

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK           S +PYILLN+     +V TLAHELGH +H   + + Q  + 
Sbjct: 353 DVMENKGKR-SGAYSSGSYSTNPYILLNWQDNINNVYTLAHELGHSVHSYYTRKNQPFVY 411

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ LAE AS   E L  D LL+     + R  LL + ++    ++ RQ  F +FE  
Sbjct: 412 GDYSIFLAEVASTTNENLLTDYLLKKYDDPKVRAYLLNHYLDGFKGTVFRQTQFAEFEHA 471

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H   ++   +    + E + +  K+  G      D E G  W  +PHF   ++YV+ YA
Sbjct: 472 IHQADQNGVALTADYLTETYFDINKKYYGEEMVY-DEEIGYEWSRIPHFY-MNYYVFQYA 529

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G    ++L     +         Y++ L+AG+S +  ++L    ++++ P+  +  L+ 
Sbjct: 530 TGFSAASALSAKILTEGQPAITA-YIDFLKAGSSDYPIDVLKKAGVDMATPDPVDDALKV 588

Query: 616 VEKMIDDVEKM 626
             + +D++EK+
Sbjct: 589 FAQRLDELEKL 599


>gi|154685588|ref|YP_001420749.1| YjbG [Bacillus amyloliquefaciens FZB42]
 gi|154351439|gb|ABS73518.1| YjbG [Bacillus amyloliquefaciens FZB42]
          Length = 609

 Score =  466 bits (1199), Expect = e-129,   Method: Composition-based stats.
 Identities = 138/614 (22%), Positives = 277/614 (45%), Gaps = 19/614 (3%)

Query: 19  LRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHA 78
              +    +  +  +     W LED++PS ++   + + + ++       + ++G LAH 
Sbjct: 2   TEENKAAQLPDRSEVKAEHTWRLEDIFPSDEAW--NKEFQAVKELIPNL-SSFKGTLAH- 57

Query: 79  TNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKV 138
               +  +L AA+   + +   +G++ +YA +  + +  +   +       +  +     
Sbjct: 58  ----SADNLYAALTAQDEVTNRLGKLYAYAHMRSDQDTGNSFYQGLNDKAASLYSQAASA 113

Query: 139 LIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGR 198
             +   EI  + E  L Q   +      YS  I+ I K + H+LS   E LL++ S+   
Sbjct: 114 TAYIEPEILAIQEDKLHQFILEKEELKLYSHAIEEITKQRPHVLSEQEEALLAEASEALS 173

Query: 199 EALKRFFCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKS 252
                F   N   + F           +I           S+REVRK+A +A+  T+ + 
Sbjct: 174 SPSNTFSVLNNADITFPSIKDENGKETQITHGNFINFLESSNREVRKNAFEAVYKTYGQY 233

Query: 253 SHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRY 312
            +  +   +   K +    R +KY+   ++   +N++   V + L++++  +     HRY
Sbjct: 234 KNTMATTLSGTVKKDNFYARVKKYKSAREAALSNNSIPEEVYDNLIKTINKH-LPLLHRY 292

Query: 313 YELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTH 372
            +L+KK L LD ++ +D   PL   S   + +E A+D +L+  A    + + I ++   +
Sbjct: 293 IDLRKKVLGLDEVHIYDLYTPLVKDSGMKVTYEEAKDYMLKGLAPLGEEYASILKEGLEN 352

Query: 373 NWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQG 432
            W+D  +  GK SGA++ GT    +PYIL+N+     ++ TL HE GH +H   + + Q 
Sbjct: 353 RWVDIYENKGKRSGAYSSGT-YGTNPYILMNWHDNVNNLFTLVHEFGHSVHSYYTRKYQP 411

Query: 433 ILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDF 492
               N S+ +AE AS   E L  + +L +   +++R  LL + +E    ++ RQ  F +F
Sbjct: 412 YPYGNYSIFVAEVASTTNEALLGEYMLNSLKDEKQRLYLLNHMLEGFRGTVFRQTMFAEF 471

Query: 493 ELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVY 552
           E  +HT+ +    +    +NE++ +  K+  G    + D E    W  +PHF  + +   
Sbjct: 472 EHLIHTKAQEGEPLTPELLNELYYDLNKKYFGDNMVI-DKEISLEWSRIPHFYYNYYVYQ 530

Query: 553 AYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERG 612
             A G     +L             E+Y   L+AG+S++  ++L    ++++ P   E  
Sbjct: 531 Y-ATGYSAAQALSSQILKEGKPAV-ERYTEFLKAGSSEYPIDILKKAGVDMTSPEPIEAA 588

Query: 613 LQTVEKMIDDVEKM 626
            +  E+ ++++E++
Sbjct: 589 CKMFEEKLNEMEEL 602


>gi|313632298|gb|EFR99347.1| oligoendopeptidase F [Listeria seeligeri FSL N1-067]
          Length = 601

 Score =  466 bits (1198), Expect = e-129,   Method: Composition-based stats.
 Identities = 136/611 (22%), Positives = 270/611 (44%), Gaps = 19/611 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           S    +  +E +     W+L  +Y + ++ E       +  +     T+++G LA     
Sbjct: 2   SKTNALPLREEVPENLTWDLTSIYANDEAWE--EAFVQL-QKIAEESTKFKGRLAD---- 54

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            N  +L  A+   ++  +LI  +  YA L  + + ++   +  ++   + +      L +
Sbjct: 55  -NSQTLYEALQFRDKAYDLISNLYVYAHLKMDQDTANAKYQGLHSRAGSLVTKLMSALSY 113

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
           +  EI  +DE++L+Q   ++     YS  ++ +   + ++LS   E LL++  +V   + 
Sbjct: 114 YDPEILAMDESVLKQFLEENQDLQLYSHLLEELNLSRPYILSEKEEALLANAGEVLGSSS 173

Query: 202 KRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   ++F     +      I   +  K    +D  VR+ A   +   +    + 
Sbjct: 174 NTFNTLNNADMKFPTIKNEDGEEIEITHGRYGKLLESNDPRVRREAFLGVYSVYEGLKNT 233

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
            +   N   K        R Y+   ++   +N++   V ++L++S  N      HRY +L
Sbjct: 234 LASTLNGQVKKSNFYASTRGYKSAREAALSNNHIPETVYDSLLKS-VNENANLLHRYVKL 292

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L L+ ++ +D   PL         ++ A++LVL++      +   I ++ F   WI
Sbjct: 293 RKELLGLEELHMYDLYTPLSDDVNLEFSYDEAKELVLEALKPLGEEYQSILKEAFDSRWI 352

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK           S +PYILLN+     +V TLAHELGH +H   + + Q  + 
Sbjct: 353 DVMENKGKR-SGAYSSGSYSTNPYILLNWQDNINNVYTLAHELGHSVHSYYTRKNQPFVY 411

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ LAE AS   E L  D LL+     + R  LL + ++    ++ RQ  F +FE  
Sbjct: 412 GDYSIFLAEVASTTNENLLTDYLLKKYDDPKVRAYLLNHYLDGFKGTVFRQTQFAEFEHA 471

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H   ++   +    +   + +  K+  G      D E G  W  +PHF   ++YV+ YA
Sbjct: 472 VHQADQNGVALTADYLTGTYFDINKKYYGEEMVY-DEEIGYEWSRIPHFY-MNYYVFQYA 529

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G    ++L     +         Y++ L+AG+S +  ++L    ++++ P+  +  L+ 
Sbjct: 530 TGFSAASALSAKILTEGQPAVTA-YIDFLKAGSSDYPIDVLKKAGVDMATPDPVDDALKV 588

Query: 616 VEKMIDDVEKM 626
             + +D++EK+
Sbjct: 589 FAQRLDELEKL 599


>gi|148260482|ref|YP_001234609.1| pepF/M3 family oligoendopeptidase [Acidiphilium cryptum JF-5]
 gi|146402163|gb|ABQ30690.1| oligoendopeptidase, pepF/M3 family [Acidiphilium cryptum JF-5]
          Length = 615

 Score =  466 bits (1198), Expect = e-129,   Method: Composition-based stats.
 Identities = 264/622 (42%), Positives = 382/622 (61%), Gaps = 17/622 (2%)

Query: 12  NAFFRKALRSSDMTTMDSQENLGN-----LPRWNLEDLYPSHDSQEISNDMECIEHESLA 66
               R      D+  +  +    +     LP WNL DLY   +   I+ D+  +  ++ A
Sbjct: 1   MTLIRPLAPPDDLAGVTVRPECDSDAAFALPSWNLTDLYRGTEDPAIATDIARLGADARA 60

Query: 67  FKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYT 126
           F   + G +A      +   L  AIA YE I + +GR+ ++A L+++ + + PT  +FY 
Sbjct: 61  FAAAFRGRVAGL----DGSGLAEAIARYEAIEQGLGRLHAFAQLNFSADATVPTAGQFYQ 116

Query: 127 DINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDM 186
            I+ +  +    ++FF LEIN +D+A  E + A DP   +++ W+ ++R ++ H LS+++
Sbjct: 117 SISERATEIGADVVFFTLEINQIDDAAFEAALA-DPALARFAPWLGDLRALRPHQLSDEI 175

Query: 187 ECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALS 246
           E LL +    G  A  R F E I +LR  +  +++ L+ A     D DR  R++A  A+ 
Sbjct: 176 ERLLHEKEVTGHAAWSRLFDETIAALRVPVAGEELTLSAALNRLSDPDRAQREAAGHAIG 235

Query: 247 HTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYP 306
            T  +++ +F+ I NT+AKD+ I+D WR+Y     +RHL+N VEP V+EAL+ +V + YP
Sbjct: 236 TTLQRNARLFTQILNTIAKDKAIEDGWRRYASPEAARHLANRVEPAVVEALVSAVTDAYP 295

Query: 307 KTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIA 366
           + +HRYY LK  WL LD +  WDR APLPG S   I +  AR+ VL +Y  FSP+M +IA
Sbjct: 296 RLAHRYYTLKAGWLGLDRLQHWDRNAPLPGESDRRIGWPEARERVLAAYGAFSPEMRVIA 355

Query: 367 EKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVL 426
            +FF   WIDA    GK  GAFAH  +P VHPYILLNY G+ +DVMTLAHELGHG+H VL
Sbjct: 356 ARFFDGGWIDAVPRPGKSGGAFAHPAVPDVHPYILLNYHGRARDVMTLAHELGHGVHQVL 415

Query: 427 SSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQ 486
           ++  QG L   + LTLAETAS+FGE LTF +LL A S  + R+++LA K+EDMLN++VRQ
Sbjct: 416 AAR-QGYLMAATPLTLAETASVFGEMLTFRALLDAESDPQRRRLMLAQKVEDMLNTVVRQ 474

Query: 487 ISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIE 546
           I+F+ FE +LH  RR    +    I+ IW+  Q+ESLGPAF+ SD +Y  FW  VPHF+ 
Sbjct: 475 IAFHQFEQRLHAARRRGELL-LDEISAIWIGVQRESLGPAFEFSD-DYRMFWAYVPHFVH 532

Query: 547 SSFYVYAYAFGNCLVNSLYDIYKSNTVDC----FKEKYLNILRAGNSKHYSELLLPLNIN 602
           S FYVYAYAFG+CLVN+LY +Y+          F  +YL++L AG ++ + ELL P  ++
Sbjct: 533 SPFYVYAYAFGDCLVNALYGVYRDQAARGAGADFVARYLDMLAAGGTRRHRELLAPFGLD 592

Query: 603 LSDPNFWERGLQTVEKMIDDVE 624
            SDP FW RGL  +   ID++E
Sbjct: 593 ASDPAFWRRGLDVIAGFIDELE 614


>gi|167628683|ref|YP_001679182.1| oligoendopeptidase f [Heliobacterium modesticaldum Ice1]
 gi|167591423|gb|ABZ83171.1| oligoendopeptidase f [Heliobacterium modesticaldum Ice1]
          Length = 604

 Score =  465 bits (1197), Expect = e-129,   Method: Composition-based stats.
 Identities = 147/608 (24%), Positives = 272/608 (44%), Gaps = 19/608 (3%)

Query: 25  TTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC 84
             +  ++++    +W LED+YP+ D+ E   D + +        T  +G L   +     
Sbjct: 5   KALPKRQDISAEFKWKLEDIYPTDDAWE--KDFQAVPALLDKI-TALKGKLQEKSAN--- 58

Query: 85  HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL 144
             L A +   + + + + +I +YA +  + + ++PT +       A  A       F   
Sbjct: 59  --LLAVLQLQDELGKGLEKIFTYARMRRDEDNTNPTYQALTDRAVALNARAAGETSFITP 116

Query: 145 EINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRF 204
           EI  + + +L++   ++     Y   + ++++ K H+L+ D E +L+  S++G+   + F
Sbjct: 117 EILAIPDDILQRFQKEEQGLALYRFLLDDLKRQKAHVLTADEEAILAQASELGQSPGQIF 176

Query: 205 FCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSF 258
              N   L F     +      I   +  +     DR VRK A   L  T+ K  +  + 
Sbjct: 177 TMLNNADLTFPTIRDEEGREVEITHGRYGQLMESKDRRVRKEAFYGLYGTYKKLENTLAA 236

Query: 259 ITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKK 318
              +  K +    R R+Y    ++    +NV   V + L+ +V+ +     HRY  L+KK
Sbjct: 237 TFTSAIKRDVFFSRVRRYPSALEAALFGDNVPKDVYDNLIGTVRKHN-DAMHRYVRLRKK 295

Query: 319 WLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAP 378
            L +D ++ +D   P+       + ++ A ++V Q           + ++ F   WID  
Sbjct: 296 LLGVDQLHMYDLYVPMVADVDWKVTYKEALEMVKQGLEPLGDDYGRVLDESFKTGWIDVY 355

Query: 379 QYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNS 438
           +  GK SGA++ G     HPY+LLNY  +  DV TLAHE+GH +H   S + Q  + +  
Sbjct: 356 ENKGKTSGAYSWG-PYGTHPYVLLNYQDRLDDVFTLAHEMGHALHSYYSHKEQPYIYSAY 414

Query: 439 SLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHT 498
           ++ +AE AS   ETL    LL+    K  R  L+ + +E    ++ RQ  F +FE  +H 
Sbjct: 415 TIFVAEVASTVNETLLIRHLLEREQDKSRRLYLINHYLEQFRGTLYRQTMFAEFEKIVHA 474

Query: 499 ERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGN 558
           +  +   +    + +I+     +  GP   +   +    W  +PHF   +FYVY YA G 
Sbjct: 475 KIEAAEALTLQELKQIYHRLNVDYYGPDIIVD-DDIDIEWARIPHFYN-NFYVYKYATGF 532

Query: 559 CLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
               +L     +       E+YL  L++G S +  ELL    +++      E+ L    +
Sbjct: 533 SAATALSAQILAEGQPAV-ERYLTFLKSGGSDYPLELLKRAGVDMGTAEPIEKALSVFRE 591

Query: 619 MIDDVEKM 626
           ++D++EK+
Sbjct: 592 LLDEMEKL 599


>gi|56419357|ref|YP_146675.1| thimet oligoendopeptidase [Geobacillus kaustophilus HTA426]
 gi|56379199|dbj|BAD75107.1| thimet oligoendopeptidase [Geobacillus kaustophilus HTA426]
          Length = 605

 Score =  465 bits (1197), Expect = e-129,   Method: Composition-based stats.
 Identities = 135/608 (22%), Positives = 272/608 (44%), Gaps = 19/608 (3%)

Query: 25  TTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC 84
            ++  +  +     W LED++P+ D+ E   + + ++         ++G L      ++ 
Sbjct: 8   KSLPLRSEIPVEETWRLEDIFPTDDAWE--EEFKQVKAMIPKL-GEYKGRLG-----ESP 59

Query: 85  HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL 144
             L  A+   + +   +G++ +YA + Y+ + ++   +       +  ++    + F   
Sbjct: 60  EVLYEALQCQDDVSMRLGKLYTYAHMRYDQDTTNSFYQGLDARAKSLYSEASSAMAFIVP 119

Query: 145 EINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRF 204
           EI  +DEA+L     Q      Y+  +  I + + H+LS + E +L+  ++V +     F
Sbjct: 120 EILAIDEAVLRSFLEQYEPLRLYAHALDEITRQRPHVLSAEEEAILAQAAEVMQATSDTF 179

Query: 205 FCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSF 258
              N   L F     +      +   +  +    +DR VR+ A  A+ HT+ K  + F+ 
Sbjct: 180 SALNNADLTFPTIIDENGEEVEVTHGRFIRFLESTDRRVRRDAFYAVYHTYEKFQNTFAN 239

Query: 259 ITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKK 318
           +     K +    R R+Y    ++   +NN+   V + L+ ++  +     HRY  L+K+
Sbjct: 240 MLAGTVKKDNFFARIRRYRSAREAALDANNIPESVYDNLIAAIHEH-LPLLHRYVRLRKR 298

Query: 319 WLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAP 378
            L LD ++ +D   PL    +  + +E A+  +L+  A    +   I ++   + W+D  
Sbjct: 299 VLGLDELHMYDLYTPLVQEVKMEVTYEEAKQYMLEGLAPLGEEYVAIVKEGLDNRWVDVR 358

Query: 379 QYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNS 438
           +  GK SGA++ G     HPYILLN+     ++ TL HE GH +H   + +TQ     + 
Sbjct: 359 ENKGKRSGAYSSG-AYGTHPYILLNWQDNVNNLFTLVHEFGHSVHSYYTRKTQPYPYAHY 417

Query: 439 SLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHT 498
           S+ +AE AS   E L  D LL+    +++R  LL + +E    ++ RQ  F +FE  +H 
Sbjct: 418 SIFVAEVASTCNEALLNDYLLRTIDDEKKRLYLLNHYLEGFRGTVFRQTMFAEFEHLIHL 477

Query: 499 ERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGN 558
           + +    +    ++ ++ +  K   G    + D E G  W  +PHF  + +     A G 
Sbjct: 478 KAQQGEALTAETLSALYYDLNKTYFGDDIVV-DKEIGLEWARIPHFYYNYYVYQY-ATGF 535

Query: 559 CLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
               +L              +Y++ L+AG+S +  E+L    ++++      +  Q   +
Sbjct: 536 SAATALSKQILEEGEPAV-RRYIDFLKAGSSDYPIEVLKKAGVDMTSAEPIRQACQVFAE 594

Query: 619 MIDDVEKM 626
            +D++E++
Sbjct: 595 KLDEMERL 602


>gi|158422061|ref|YP_001523353.1| peptidase M3B protein [Azorhizobium caulinodans ORS 571]
 gi|158328950|dbj|BAF86435.1| peptidase M3B protein [Azorhizobium caulinodans ORS 571]
          Length = 634

 Score =  465 bits (1197), Expect = e-129,   Method: Composition-based stats.
 Identities = 285/592 (48%), Positives = 387/592 (65%), Gaps = 6/592 (1%)

Query: 36  LPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAA-IAEY 94
           LP WNL DLY   D   I+ D+   +  S AF+  ++G LA      +  +   A +  Y
Sbjct: 45  LPEWNLADLYAGMDDPRIATDLAEADALSKAFEADYKGKLADIAAAADAGAQLGAAVKRY 104

Query: 95  ERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALL 154
           E I +L+GR+AS+  L Y  + + P   KF++DI  KL D    L+FF LE+N L++A +
Sbjct: 105 EAIDDLMGRVASFGSLVYAGDTADPARAKFFSDIQEKLTDSSTHLLFFTLEMNRLEDAQV 164

Query: 155 EQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF 214
           E +   D     Y  W++++RK K + L + +E L  + S   R A  R F E + SLRF
Sbjct: 165 EAALK-DAAFGHYRPWVEDLRKDKPYQLEDRVEQLFHEKSSPARGAWGRLFDETMSSLRF 223

Query: 215 KINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWR 274
            ++ +++ +        D +  VRK+A +AL+ TF+++  +FS ITNTLAKD+EI DRWR
Sbjct: 224 SVDGKELAIEPTLNLMQDPNEAVRKAAGQALAQTFSENLRLFSLITNTLAKDKEISDRWR 283

Query: 275 KYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPL 334
            +E +ADSRHL+N VE  V++A++ S++  +P+ SHRYY LK KW   + + FWDR APL
Sbjct: 284 GFEDVADSRHLANRVEREVVDAMVASIREAFPRLSHRYYALKAKWFGKEKLEFWDRNAPL 343

Query: 335 PGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIP 394
           P      I ++ ARD VL +Y+ FSP+M+ IA  FF  NWIDAP   GK  GAFAH T+P
Sbjct: 344 PKVDTRDIGWDEARDTVLGAYSTFSPRMADIARVFFDKNWIDAPVRPGKSPGAFAHPTVP 403

Query: 395 SVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLT 454
           S HPY+LLNY GKP+DVMTLAHELGHG+H VL+   QG L   + LTLAETAS+FGE LT
Sbjct: 404 SAHPYVLLNYQGKPRDVMTLAHELGHGVHQVLAGR-QGALMAPTPLTLAETASVFGEMLT 462

Query: 455 FDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEI 514
           F  LL AA + + RKI+LA K+EDM+N++VRQ +FY FE K+HTERR    I   RI E+
Sbjct: 463 FRRLLAAAETPQARKIMLAQKVEDMINTVVRQTAFYTFERKVHTERRQGE-ITAERIGEL 521

Query: 515 WLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVD 574
           W++ Q ESLGPA +LS   Y +FW  +PHFI S FYVYAYAFG+CLVNSLY +Y+    D
Sbjct: 522 WMDVQTESLGPAINLS-AGYETFWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQKA-SD 579

Query: 575 CFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            F E+YL +L AG +KH+SELL P  ++  DP FW+ GL  +E MI ++E+M
Sbjct: 580 GFAERYLEMLAAGGTKHHSELLAPFGLDARDPAFWQTGLGLIESMITELEQM 631


>gi|167040062|ref|YP_001663047.1| oligoendopeptidase F [Thermoanaerobacter sp. X514]
 gi|307724618|ref|YP_003904369.1| oligoendopeptidase F [Thermoanaerobacter sp. X513]
 gi|166854302|gb|ABY92711.1| oligoendopeptidase F [Thermoanaerobacter sp. X514]
 gi|307581679|gb|ADN55078.1| oligoendopeptidase F [Thermoanaerobacter sp. X513]
          Length = 596

 Score =  465 bits (1195), Expect = e-128,   Method: Composition-based stats.
 Identities = 152/609 (24%), Positives = 265/609 (43%), Gaps = 20/609 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           M  +  +  + +  +W LED+Y + +  E   D    +        +++G +  + N   
Sbjct: 1   MEVLKDRSEIEDKYKWRLEDIYENENLWE--EDYNKTKELLKEIV-KFKGKINTSRN--- 54

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
              L   +   ++I     +I +YA +  + + ++P  +           +      F A
Sbjct: 55  ---LLEVLKLNDQIGMTASKIFAYARMRRDEDNTNPKYQALTDKAMRLNVEVMSATSFIA 111

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            EI ++D   L +          Y  +++++ + K H+LS + E +L++   +       
Sbjct: 112 PEILSIDTQKLMEMIEGLEELKIYKQYLEDLIRFKPHVLSPEEEKILAEAKTLAESVSNI 171

Query: 204 FFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           +   N   +RF I   +      +      +     DR VRK+A  A+  T+ K  + F+
Sbjct: 172 YTMLNNADMRFPIIKDEEGKEVEVTHGNFVRFMQSKDRNVRKAAFNAMYDTYKKFINTFA 231

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
                  K +    + RKY    ++    +NV   V   L+    +      HRY  LKK
Sbjct: 232 STMAGNVKKDIFYVKTRKYNSSLEASLFEDNVSLEVYNNLI-ETVHSRLDVLHRYVRLKK 290

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           K L LD ++ +D   PL         +E A +LVL+       +   + ++ F   W+D 
Sbjct: 291 KLLGLDELHMYDLYVPLIQEYDKKFTYEEAIELVLEGLKPLGDEYINLLKQGFNSRWVDV 350

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK SGA++ GT    HPY+LLNY GK  DV T+AHE+GH +H   S+ TQ  +   
Sbjct: 351 YENRGKTSGAYSWGT-YGTHPYVLLNYQGKLNDVFTIAHEMGHSLHTYYSNATQPYVYAG 409

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
             + +AE AS   E L  D LL+ +  ++ER  LL +  E+   ++ RQ+ F +FE  +H
Sbjct: 410 YKIFVAEVASTCNEALLMDYLLKNSKDEKERLYLLNHFFEEFRGTVYRQVMFAEFEKLIH 469

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
                   +    +N+ + E  K   G    + D      W  +PHF   +FYVY YA G
Sbjct: 470 EMAERGEPLTAEVLNKKYYELNKLYYGDDIVV-DEGISYEWARIPHFYR-NFYVYKYATG 527

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                ++  +  +       E+Y   L++G+S +   LL    ++L+ P      L   E
Sbjct: 528 FSAAIAISQMILNEGEKAV-ERYKEFLKSGSSDYPLNLLKKAGVDLTTPKPVNDALDVFE 586

Query: 618 KMIDDVEKM 626
           K++D+ EKM
Sbjct: 587 KLLDEFEKM 595


>gi|256752696|ref|ZP_05493546.1| oligoendopeptidase F [Thermoanaerobacter ethanolicus CCSD1]
 gi|256748415|gb|EEU61469.1| oligoendopeptidase F [Thermoanaerobacter ethanolicus CCSD1]
          Length = 596

 Score =  465 bits (1195), Expect = e-128,   Method: Composition-based stats.
 Identities = 152/609 (24%), Positives = 265/609 (43%), Gaps = 20/609 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           M  +  +  + +  +W LED+Y + +  E   D    +        +++G +  + N   
Sbjct: 1   MEVLKDRSEIEDKYKWRLEDIYENENLWE--EDYNKTKELLKEIV-KFKGKINTSKN--- 54

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
              L   +   ++I     +I +YA +  + + ++P  +           +      F A
Sbjct: 55  ---LLEVLKLNDQIGMTASKIFAYARMRRDEDNTNPKYQALTDKAMRLNIEVMSATSFIA 111

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            EI ++D   L +          Y  +++++ + K H+LS + E +L++   +       
Sbjct: 112 PEILSIDTQKLMEMIEGLEELKIYKQYLEDLIRFKPHVLSPEEEKILAEAKTLAESVSNI 171

Query: 204 FFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           +   N   +RF I   +      +      +     DR VRK+A  A+  T+ K  + F+
Sbjct: 172 YTMLNNADMRFPIIKDEEGKEVEVTHGNFVRFMQSKDRNVRKAAFNAMYDTYKKFINTFA 231

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
                  K +    + RKY    ++    +NV   V   L+    +      HRY  LKK
Sbjct: 232 STMVGNVKKDIFYVKTRKYNSSLEASLFEDNVSLEVYNNLI-ETVHSRLDVLHRYVRLKK 290

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           K L LD ++ +D   PL         +E A +LVL+       +   + ++ F   W+D 
Sbjct: 291 KLLGLDELHMYDLYVPLIQEYDKKFTYEEAIELVLEGLKPLGDEYINLLKQGFNSRWVDV 350

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK SGA++ GT    HPY+LLNY GK  DV T+AHE+GH +H   S+ TQ  +   
Sbjct: 351 YENRGKTSGAYSWGT-YGTHPYVLLNYQGKLNDVFTIAHEMGHSLHTYYSNATQPYVYAG 409

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
             + +AE AS   E L  D LL+ +  ++ER  LL +  E+   ++ RQ+ F +FE  +H
Sbjct: 410 YKIFVAEVASTCNEALLMDYLLKNSKDEKERLYLLNHFFEEFRGTVYRQVMFAEFEKLIH 469

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
                   +    +N+ + E  K   G    + D      W  +PHF   +FYVY YA G
Sbjct: 470 EMAERGEPLTAEVLNKKYYELNKLYYGDDIVV-DEGISYEWARIPHFYR-NFYVYKYATG 527

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                ++  +  +       E+Y   L++G+S +   LL    ++L+ P      L   E
Sbjct: 528 FSAAIAISQMILNEGEKAV-ERYKEFLKSGSSDYPLNLLKKAGVDLTTPKPVNDALDVFE 586

Query: 618 KMIDDVEKM 626
           K++D+ EKM
Sbjct: 587 KLLDEFEKM 595


>gi|148655405|ref|YP_001275610.1| oligoendopeptidase F [Roseiflexus sp. RS-1]
 gi|148567515|gb|ABQ89660.1| oligoendopeptidase F [Roseiflexus sp. RS-1]
          Length = 600

 Score =  464 bits (1194), Expect = e-128,   Method: Composition-based stats.
 Identities = 140/611 (22%), Positives = 261/611 (42%), Gaps = 19/611 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           ++   +  ++ +    RW+L  +Y    + E   D+  IE          +G +A     
Sbjct: 2   TETQKVPRRDEIPEHYRWDLTTIYVDDAAWE--QDVATIEQMLSD-VAAVQGRVAG---- 54

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            +   L AA+   +++   + +I  YA   ++ + + P  +          A     L F
Sbjct: 55  -SPDDLLAALRLRDQVSMRLWQIYVYANRRFDSDTTDPVGQALAERAGTLAAKVGAALAF 113

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI    E  +     + P    Y   +  + + + H+ S ++E +L+  S + R   
Sbjct: 114 IEPEILAAPEDQIRAWIREYPDLAVYEYALDQLLRQRAHVRSAEVEAILAQFSDITRAPG 173

Query: 202 KRFFCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
           + F       L F   +       ++   +  +     DR VR+ A       F    + 
Sbjct: 174 EIFEVLTNADLHFPSIEDEQGQPVQLSHGRFLRFLRSPDRRVRRDAFVGYYSAFQGIRNT 233

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
                    +   +  + R Y    ++    N++   V   L+ +  N      HRY++ 
Sbjct: 234 LGASLAAQVRTHVLNAKVRNYASSLEAALTPNDIPVEVYHNLI-ATVNASLPRLHRYFQA 292

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           ++K + LD ++F+D  APL   +   +P+E A  +V  ++     +      + F   WI
Sbjct: 293 RRKIMGLDELHFYDLYAPLVPEADVAVPYEEAERMVRAAFEPLGDEYGAAVAQAFRSRWI 352

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G+  +  P++LLNY  +  DV TLAHELGH +H   + +TQ  + 
Sbjct: 353 DVYENIGKRSGAYSDGS-YTTAPFMLLNYQERLNDVFTLAHELGHAMHSYFTRKTQPYIY 411

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + ++ +AE AS   E L  D LL+       R+ L+  ++ED+  ++ RQ  F +FEL+
Sbjct: 412 GDYTIFVAEVASTLNEALLTDHLLRTRDDPILRRYLIVEQLEDIRTTLFRQTMFAEFELE 471

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H    +   + T   + I+ +      G    L D +    W  +PHF   +FYVY YA
Sbjct: 472 IHRRAETGEPLTTELFSTIYRDLVARYHGSEVAL-DEQIALEWARIPHFY-YNFYVYQYA 529

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L+            E+YL+ LR+G+S+   ELL    +++  P   +  +  
Sbjct: 530 TGLSAALALHKRIVQEGSPA-IERYLHFLRSGSSRPSIELLRDAGVDMLSPAPIQAAMDH 588

Query: 616 VEKMIDDVEKM 626
              ++D++E+M
Sbjct: 589 FSALLDELERM 599


>gi|116873621|ref|YP_850402.1| oligoendopeptidase F [Listeria welshimeri serovar 6b str. SLCC5334]
 gi|116742499|emb|CAK21623.1| oligoendopeptidase F [Listeria welshimeri serovar 6b str. SLCC5334]
          Length = 601

 Score =  464 bits (1194), Expect = e-128,   Method: Composition-based stats.
 Identities = 139/611 (22%), Positives = 267/611 (43%), Gaps = 19/611 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           S    +  +E +     W+L  ++PS ++         ++  +     +++G LA     
Sbjct: 2   SKTNALPLREEVPEELTWDLTTIFPSDEA--FEEAFLDLQKMTEE-SNQFKGRLA----- 53

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
           ++   L  A+   ++  +LI  +  YA L  + + ++   +  Y+   +        L +
Sbjct: 54  ESSQILFEALQFRDKAYDLISNLYVYAHLKMDQDTANAKYQGLYSRAGSLATKLMSALSY 113

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
           +  EI  +DE++L+Q   ++     Y+  ++ +   + ++LS   E LL++  +V   + 
Sbjct: 114 YDPEILAMDESVLKQFLNENKDLQLYAHLLEELNLSRPYILSEKEEALLANAGEVLGSSS 173

Query: 202 KRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   ++F     +      I   +  K    +D  VR+ A   +   +    + 
Sbjct: 174 NTFNTLNNADMKFPSIKDENGEEIEITHGRYGKLLESNDPRVRRDAFFGVYSVYEGLKNT 233

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
            +   N   K        R Y+   ++    N++   V +AL+ S  N      HRY +L
Sbjct: 234 LASTLNGQVKKSNFYAATRGYKSAREAALSGNHIPETVYDALLNS-VNTNANLLHRYVKL 292

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL         ++ A++LVL++      +   I ++ F   WI
Sbjct: 293 RKELLGLDELHMYDLYTPLSDDVNLEFTYDEAKELVLEALKPLGEEYQSILKEAFDSRWI 352

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK           S  PYILLN+     +V TLAHELGH +H   + + Q  + 
Sbjct: 353 DVIENKGKR-SGAYSSGSYSTSPYILLNWQDNINNVYTLAHELGHSVHSYYTRKNQPFVY 411

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ LAE AS   E L  D LL+     + R  LL + ++    ++ RQ  F +FE  
Sbjct: 412 GDYSIFLAEVASTTNENLLTDYLLKKYDDPKVRAYLLNHYLDGFKGTVFRQTQFAEFEHA 471

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H   ++   +    + E + +  K+  G      D E G  W  +PHF   ++YV+ YA
Sbjct: 472 IHQADQNGTALTADYLTETYFDINKKYYGEDMVY-DTEIGYEWSRIPHFY-MNYYVFQYA 529

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G    ++L         +     Y++ L+AG+S +  E+L    ++++ P+     L+ 
Sbjct: 530 TGFSAASALSAKILLEGQEAVTA-YIDFLKAGSSDYPIEVLKKAGVDMTTPDPVNDALKV 588

Query: 616 VEKMIDDVEKM 626
            E+ +D++EK+
Sbjct: 589 FEQRLDELEKL 599


>gi|162147894|ref|YP_001602355.1| group B oligopeptidase pepB [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209542511|ref|YP_002274740.1| oligoendopeptidase, pepF/M3 family [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161786471|emb|CAP56053.1| Group B oligopeptidase pepB [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209530188|gb|ACI50125.1| oligoendopeptidase, pepF/M3 family [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 615

 Score =  464 bits (1194), Expect = e-128,   Method: Composition-based stats.
 Identities = 270/592 (45%), Positives = 380/592 (64%), Gaps = 9/592 (1%)

Query: 34  GNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAE 93
           G+LPRW+L DLY S +S  +  D+   E ++ AF   W G LA A    +  +L  AIAE
Sbjct: 32  GDLPRWDLGDLYDSPESDRLRTDLNQAEADAAAFADVWRGRLAGA----SPAALAEAIAE 87

Query: 94  YERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEAL 153
           Y+RI E++GR ASYA L +  + S   I +F   +N +L D    L+FF LE+N + +  
Sbjct: 88  YQRIDEVLGRAASYAQLLFAGDSSDAAIGRFSQSVNERLTDISTHLLFFTLELNRIGDDE 147

Query: 154 LEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLR 213
           +    A DP    ++ +++++R  + H LS+++E +L + S  G  A  R F E +  LR
Sbjct: 148 MAARLA-DPALAVWAPFLRDLRVFRPHQLSDEIEQVLHEKSVTGAAAWCRLFDETMAGLR 206

Query: 214 FKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRW 273
             ++D ++ + +A     D DR VR+ AA+A+   F  +  +FS ITNTLAKD+ I D  
Sbjct: 207 IPLDDSRLTVGEALNRLSDPDRAVRERAARAIGAVFGDNIRLFSLITNTLAKDKAISDSL 266

Query: 274 RKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAP 333
           R Y +    R+ SN VE  V++AL+Q+V   YP+ SHRYY LK KWL L+ +  WDR AP
Sbjct: 267 RHYPRPGSYRNRSNMVEDEVVDALVQAVTTDYPRLSHRYYALKAKWLGLEKLEHWDRNAP 326

Query: 334 LPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTI 393
           LP     IIP++ A   VL +Y  F P+M  +A +FF H WIDA    GK SGAFAH T+
Sbjct: 327 LPSADDRIIPWDQATRQVLAAYEAFDPRMGTVARRFFDHAWIDAAPAPGKASGAFAHPTV 386

Query: 394 PSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETL 453
           PSVHPY+LLNY G+ +DVMTLAHELGHG+H VL++   G L + + LTLAETAS+FGE L
Sbjct: 387 PSVHPYLLLNYHGRTRDVMTLAHELGHGVHQVLAAPH-GYLMSGTPLTLAETASVFGEML 445

Query: 454 TFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINE 513
           TF +LL A +    R+++LA K+EDMLN++VRQI+FY FE  +H E R +G++   RI  
Sbjct: 446 TFRALLDAETDPARRRLMLAAKVEDMLNTVVRQIAFYRFETLVHAE-RKSGELLPERIGA 504

Query: 514 IWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTV 573
           IW + Q ESLGPAF+ +  +Y  +W  VPHFI S FYVYAYAFG+CLVN+LY +++S   
Sbjct: 505 IWRQVQTESLGPAFNFT-PDYDVYWTYVPHFIHSPFYVYAYAFGDCLVNALYGVFQS-GH 562

Query: 574 DCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEK 625
             F++KYL++LRAG +  + ELL P  ++ +DP FW +GL  +   ID++E+
Sbjct: 563 AGFQDKYLDMLRAGGTMRHRELLAPFGLDAADPGFWRKGLDVIAGFIDELER 614


>gi|163795236|ref|ZP_02189204.1| hypothetical protein BAL199_06194 [alpha proteobacterium BAL199]
 gi|159179634|gb|EDP64163.1| hypothetical protein BAL199_06194 [alpha proteobacterium BAL199]
          Length = 595

 Score =  464 bits (1193), Expect = e-128,   Method: Composition-based stats.
 Identities = 272/595 (45%), Positives = 391/595 (65%), Gaps = 9/595 (1%)

Query: 31  ENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAA 90
            +LG+LP+W+L DLYP  DS E++ D+E  E ++ AF+ +  G +A      +   LG A
Sbjct: 6   ADLGSLPQWDLADLYPGPDSPELARDLERCEADAKAFRDKHAGAVASL----SGTDLGRA 61

Query: 91  IAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLD 150
            A YE + E++GR+ S+A L Y  N+S P + +FY  +  ++      L+FF LEIN ++
Sbjct: 62  TAAYEAMDEILGRVMSFANLMYAGNMSDPQVGRFYQSMQERVNAISTELLFFGLEINRIE 121

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIE 210
           EA L       P    +  W+++ R  ++H LS+++E LL +    GR A  R F E + 
Sbjct: 122 EADLTTKLKA-PELAHFQPWLRDTRAYREHQLSDELEKLLHEKYVAGRAAWTRLFDETMA 180

Query: 211 SLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
            LRF ++ +++   +        D  +R+ AA +L+    K+  +F+ +TNTLAKD++I+
Sbjct: 181 RLRFTLDGEELTTAQVLDRLSHRDAAMRRKAAHSLAEVLGKNVGLFALVTNTLAKDKQIE 240

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
           D+WR+Y K   SR+++N VE  V+EAL+ +V+  Y + SHRYY LK KW  +D + +WDR
Sbjct: 241 DKWRRYAKPISSRNIANQVEDDVVEALVTAVRGKYSRLSHRYYALKAKWFGVDQLDYWDR 300

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAH 390
            APLP      IP+  ARD VL++YA FSP+++ + +KFF + WIDAP   GK SGAFAH
Sbjct: 301 NAPLPEDDDAQIPWTEARDTVLKAYAGFSPKLAEVGQKFFDNAWIDAPTRPGKASGAFAH 360

Query: 391 GTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFG 450
            T+PS HPY+LLNY GK +DVMTLAHELGHG+H VL+S   G L  ++ LTLAETAS+FG
Sbjct: 361 PTVPSAHPYLLLNYQGKTRDVMTLAHELGHGVHQVLASRH-GQLMCDTPLTLAETASVFG 419

Query: 451 ETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHR 510
           E LTF +LLQ+ S    R+++LA+K+EDMLN++VRQI+F+ FE ++H ERRS   +   R
Sbjct: 420 EMLTFQALLQSRSDPVGRRVMLASKVEDMLNTVVRQIAFHTFEARIHDERRSGE-LTPDR 478

Query: 511 INEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKS 570
           + EIW++ Q ESLGPA    D  Y SFW  +PHF+ S FYVYAYAFG+CLVNSLY +++ 
Sbjct: 479 LGEIWMDVQAESLGPAIRFDD-GYKSFWSYIPHFVHSPFYVYAYAFGDCLVNSLYAVFQ- 536

Query: 571 NTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEK 625
           +    F +KYL +L AG +K + ELL P  ++ SDP FW++GL+ VE MID +E 
Sbjct: 537 DAEAGFADKYLEMLAAGGTKRHKELLAPFGLDASDPAFWDKGLELVETMIDQLEA 591


>gi|300914146|ref|ZP_07131462.1| oligoendopeptidase F [Thermoanaerobacter sp. X561]
 gi|300889081|gb|EFK84227.1| oligoendopeptidase F [Thermoanaerobacter sp. X561]
          Length = 596

 Score =  464 bits (1193), Expect = e-128,   Method: Composition-based stats.
 Identities = 152/609 (24%), Positives = 265/609 (43%), Gaps = 20/609 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           M  +  +  + +  +W LED+Y + +  E   D    +        +++G +  + N   
Sbjct: 1   MEVLKDRSEIEDKYKWRLEDIYENENLWE--EDYNKTKEILKEIV-KFKGKINTSRN--- 54

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
              L   +   ++I     +I +YA +  + + ++P  +           +      F A
Sbjct: 55  ---LLEVLKLNDQIGMTASKIFAYARMRRDEDNTNPKYQALTDKAMRLNVEVMSATSFIA 111

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            EI ++D   L +          Y  +++++ + K H+LS + E +L++   +       
Sbjct: 112 PEILSIDTQKLMEMIEGLEELKIYKQYLEDLIRFKPHVLSPEEEKILAEAKTLAESVSNI 171

Query: 204 FFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           +   N   +RF I   +      +      +     DR VRK+A  A+  T+ K  + F+
Sbjct: 172 YTMLNNADMRFPIIKDEEGKEVEVTHGNFVRFMQSKDRNVRKAAFNAMYDTYKKFINTFA 231

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
                  K +    + RKY    ++    +NV   V   L+    +      HRY  LKK
Sbjct: 232 STMAGNVKKDIFYVKTRKYNSSLEASLFEDNVSLEVYNNLI-ETVHSRLDVLHRYVRLKK 290

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           K L LD ++ +D   PL         +E A +LVL+       +   + ++ F   W+D 
Sbjct: 291 KLLGLDELHMYDLYVPLIQEYDKKFTYEEAIELVLEGLKPLGDEYINLLKQGFNSRWVDV 350

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK SGA++ GT    HPY+LLNY GK  DV T+AHE+GH +H   S+ TQ  +   
Sbjct: 351 YENRGKTSGAYSWGT-YGTHPYVLLNYQGKLNDVFTIAHEMGHSLHTYYSNATQPYVYAG 409

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
             + +AE AS   E L  D LL+ +  ++ER  LL +  E+   ++ RQ+ F +FE  +H
Sbjct: 410 YKIFVAEVASTCNEALLMDYLLKNSKDEKERLYLLNHFFEEFRGTVYRQVMFAEFEKLIH 469

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
                   +    +N+ + E  K   G    + D      W  +PHF   +FYVY YA G
Sbjct: 470 EMAERGEPLTAEVLNKKYYELNKLYYGDDIVV-DEGISYEWARIPHFYR-NFYVYKYATG 527

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                ++  +  +       E+Y   L++G+S +   LL    ++L+ P      L   E
Sbjct: 528 FSAAIAISQMILNEGEKAV-ERYKEFLKSGSSDYPLNLLKKAGVDLTTPKPVNDALDVFE 586

Query: 618 KMIDDVEKM 626
           K++D+ EKM
Sbjct: 587 KLLDEFEKM 595


>gi|192293026|ref|YP_001993631.1| oligoendopeptidase, pepF/M3 family [Rhodopseudomonas palustris
           TIE-1]
 gi|192286775|gb|ACF03156.1| oligoendopeptidase, pepF/M3 family [Rhodopseudomonas palustris
           TIE-1]
          Length = 638

 Score =  463 bits (1191), Expect = e-128,   Method: Composition-based stats.
 Identities = 286/592 (48%), Positives = 389/592 (65%), Gaps = 6/592 (1%)

Query: 36  LPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGA-AIAEY 94
           LP WNL DLYP+  S E++ D++ ++ E  +F+  ++G LA  T +       A A+  Y
Sbjct: 51  LPEWNLMDLYPAIGSPEVAADLDRLDAECASFEADFKGRLAEETAKDGGALWLAGAVKRY 110

Query: 95  ERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALL 154
           E I +L GR+ SYA L +  +   P   KFY D++ +L      L+FF LE+N +D+A+L
Sbjct: 111 EAIEDLAGRLGSYAGLVHAGDSVDPVKSKFYGDVSERLTAASVHLLFFTLELNRVDDAVL 170

Query: 155 EQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRF 214
           E +  Q P    Y  WI+++RK K + L + +E L  + SQ G  A  R F + I SLRF
Sbjct: 171 ETAM-QTPELGHYRPWIEDLRKDKPYQLEDRIEQLFHEKSQTGYGAFNRLFDQTISSLRF 229

Query: 215 KINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWR 274
           ++  +++ +        D     RK+AA+AL+ TF  +   F+ ITNTLAKD+EI DRWR
Sbjct: 230 RVGGKELAIEPTLNLMQDRAPAKRKAAAEALAKTFKANERTFALITNTLAKDKEISDRWR 289

Query: 275 KYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPL 334
            +E +ADSRHL+N VE  V++AL+ SV+  YPK SHRYY+LK  W K   + +WDR APL
Sbjct: 290 GFEDVADSRHLANRVEREVVDALVASVRAAYPKLSHRYYKLKASWFKKKKLPYWDRNAPL 349

Query: 335 PGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIP 394
           P  +   I +  AR++VL +Y  FSP+M+ IAE+FFT  WIDAP   GK  GAF+H T P
Sbjct: 350 PFAATGSIAWPDARNMVLTAYKAFSPEMAQIAERFFTDRWIDAPVRPGKAPGAFSHPTTP 409

Query: 395 SVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLT 454
           S HPY+L+NY GKP+DVMTLAHELGHG+H VL+++  G L   + LTLAETAS+FGE LT
Sbjct: 410 SAHPYVLMNYQGKPRDVMTLAHELGHGVHQVLAAKN-GALMAPTPLTLAETASVFGEMLT 468

Query: 455 FDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEI 514
           F  LL     +++R+ LLA K+EDM+N++VRQI+FY FE  +HTERRS   +   RI EI
Sbjct: 469 FRRLLTQTKDRKQRQALLAGKVEDMINTVVRQIAFYSFERAVHTERRSGE-LTAQRIGEI 527

Query: 515 WLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVD 574
           WL  Q ESLGPA ++    Y SFWM +PHFI S FYVYAYAFG+CLVNSLY +Y  +  +
Sbjct: 528 WLSVQGESLGPAIEIK-PGYESFWMYIPHFIHSPFYVYAYAFGDCLVNSLYAVY-EHAQE 585

Query: 575 CFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            F E+YL +L AG +KHYSELL P  ++  +P+FW+ GL  +  MID++E M
Sbjct: 586 GFAERYLAMLAAGGTKHYSELLAPFGLDAKNPSFWDGGLSVIAGMIDELEAM 637


>gi|167037394|ref|YP_001664972.1| oligoendopeptidase F [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|320115808|ref|YP_004185967.1| oligoendopeptidase F [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|166856228|gb|ABY94636.1| oligoendopeptidase F [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|319928899|gb|ADV79584.1| oligoendopeptidase F [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
          Length = 596

 Score =  463 bits (1191), Expect = e-128,   Method: Composition-based stats.
 Identities = 152/609 (24%), Positives = 264/609 (43%), Gaps = 20/609 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           M  +  +  + +  +W LED+Y + +  E   D    +        +++G +  + N   
Sbjct: 1   MEVLKDRSEIEDKYKWRLEDIYENENLWE--EDYNKTKELLKEIV-KFKGKINTSRN--- 54

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
              L   +   ++I     +I +YA +  + + ++P  +           +      F A
Sbjct: 55  ---LLEVLKLNDQIGMTASKIFAYARMRRDEDNTNPKYQALTDKAMRLNIEVMSATSFIA 111

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            EI ++D   L +          Y  +++++ + K H+LS++ E +L++   +       
Sbjct: 112 PEILSIDTQKLMEMIEGLEELKIYKQYLEDLIRFKPHVLSSEEEKILAEAETLAESVSNV 171

Query: 204 FFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           +   N   +RF     +      +      +     DR VRK+A  A+  T+ K  + F+
Sbjct: 172 YTMLNNADMRFSTIKDEEGKEVELTHGNFVRFMQSKDRNVRKAAFNAMYDTYKKFINTFA 231

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
                  K +    + RKY    ++    +NV   V   L+    +      HRY  LKK
Sbjct: 232 STMAGNVKKDIFYAKTRKYNSSLEASLFEDNVSVEVYNNLI-ETVHSRLDVLHRYVRLKK 290

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           K L LD ++ +D   PL         +E A +LVL+       +   +  K F   W+D 
Sbjct: 291 KLLGLDELHMYDLYVPLIQEYDKKFTYEEAINLVLEGLQPLGDEYINLLRKGFNSRWVDV 350

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK SGA++ GT    HPY+LLNY GK  DV T+AHE+GH +H   S+ TQ  +   
Sbjct: 351 YENRGKTSGAYSWGT-YGTHPYVLLNYQGKLNDVFTIAHEMGHSLHTYYSNATQPYVYAG 409

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
             + +AE AS   E L  D LL+ +  ++ER  LL +  E+   ++ RQ+ F +FE  +H
Sbjct: 410 YKIFVAEVASTCNEALLMDYLLKNSKDEKERLYLLNHFFEEFRGTVYRQVMFAEFEKLIH 469

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
                   +    +N+ + E  K   G    + D      W  +PHF   +FYVY YA G
Sbjct: 470 EMAERGEPLTAEVLNKKYYELNKLYYGDDIVV-DEGISYEWARIPHFYR-NFYVYKYATG 527

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                ++  +  +       E+Y   L++G+S +   LL    ++L+ P      L   E
Sbjct: 528 FSAAIAISQMILNEGEKAV-ERYKEFLKSGSSDYPLNLLKKAGVDLTTPKPVNDALDVFE 586

Query: 618 KMIDDVEKM 626
           K++D+ EKM
Sbjct: 587 KLLDEFEKM 595


>gi|152974721|ref|YP_001374238.1| oligoendopeptidase F [Bacillus cereus subsp. cytotoxis NVH 391-98]
 gi|152023473|gb|ABS21243.1| oligoendopeptidase F [Bacillus cytotoxicus NVH 391-98]
          Length = 608

 Score =  463 bits (1191), Expect = e-128,   Method: Composition-based stats.
 Identities = 139/608 (22%), Positives = 272/608 (44%), Gaps = 18/608 (2%)

Query: 25  TTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC 84
             +  +  +     W LED++ + ++ E   + + I+         ++G L       + 
Sbjct: 8   KVLPDRSEIEEKNTWRLEDIFQTDEAWE--KEFQAIKELLPKLNE-FKGKLGD-----SA 59

Query: 85  HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL 144
            SL AA+   + I   +G++ +YA + Y+ + ++ T +          +       +   
Sbjct: 60  ESLLAALQYEDEISMRLGKLYTYAHMRYDQDTTNSTYQALNDRAMNLYSQVSSSTAYIVP 119

Query: 145 EINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRF 204
           EI  + + LL+    ++     Y   ++ I + + H+LS   E LL++ ++V   +   F
Sbjct: 120 EILKISQELLQSFLQENKELRVYEHALEEITRQRPHVLSEAEESLLAEAAEVMSSSSNTF 179

Query: 205 FCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSF 258
              N   L+F     +      +   +  +     DR VR  A  A+  T+ K  + F+ 
Sbjct: 180 GMLNNADLKFPSIKDENGEEVEVTHGRYIQFLESDDRRVRHDAFHAVYETYGKFKNTFAS 239

Query: 259 ITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKK 318
             +   K      R RKY+    +   +N++   V + L+    + +    HRY +++K+
Sbjct: 240 TLSGAVKRNNFNARVRKYDSARQAALSNNHIPETVYDQLI-ETVHNHLHLLHRYIDIRKR 298

Query: 319 WLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAP 378
            LKLD ++ +D   PL    +  + +E A++++L+S      +   I ++ + + W+D  
Sbjct: 299 ALKLDELHMYDLYTPLVPEVKMNVKYEEAQEILLKSLHVLGDEYVDILKEAYENRWVDVY 358

Query: 379 QYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNS 438
           +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  +  + 
Sbjct: 359 ENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVYGDY 417

Query: 439 SLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHT 498
           S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  +H 
Sbjct: 418 SIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHIIHQ 477

Query: 499 ERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGN 558
           + +    +    + EI+ +  K   G A  + D E G  W  +PHF  + +     A G 
Sbjct: 478 KVQEGHAVTPDMLTEIYYDLNKTYFGDAVVI-DKEIGLEWSRIPHFYYNYYVYQY-ATGF 535

Query: 559 CLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
               +L            +      L+AG+S +  E+L    ++++ P   +  LQ  E+
Sbjct: 536 SAATALSKQILEEGKPAVERYINEFLKAGSSDYPIEVLKKAGVDMTSPEPVKEALQVFEE 595

Query: 619 MIDDVEKM 626
            ++++E +
Sbjct: 596 KLNELEAL 603


>gi|253573281|ref|ZP_04850624.1| oligoendopeptidase F [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251846809|gb|EES74814.1| oligoendopeptidase F [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 612

 Score =  463 bits (1190), Expect = e-128,   Method: Composition-based stats.
 Identities = 148/622 (23%), Positives = 269/622 (43%), Gaps = 23/622 (3%)

Query: 12  NAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEI-SNDMECIEHESLAFKTR 70
            + F    R   M+T+  +  +     W L+DL+P   + +   ND++ ++ ++  F   
Sbjct: 5   ASSFYPVQRRIPMSTVMKRSEVPKEHTWQLQDLFPDQAAWDKSYNDLKKLKDKAAEF--- 61

Query: 71  WEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINA 130
            EG L       +   + A     + +   I R+  YA L ++ + ++PT +        
Sbjct: 62  -EGKLT------DAEHIKAVFELEDELSLQIERLYVYAHLHHDEDTTNPTYQALVQKAKK 114

Query: 131 KLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLL 190
              +  + L F   EI  L E  L++    DP+   Y   ++ I++ K H+LS   E LL
Sbjct: 115 LSVEVSEALSFITPEILALPEQELDKLI-NDPVLADYKFTLQEIKREKAHVLSKTEEALL 173

Query: 191 SDTSQVGREALKRFFCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKA 244
           +    + +   + F   N   ++F            +      +   + +REVR+ A KA
Sbjct: 174 AQVGNLSQAPQQIFGMINNADMKFPKIKDENGNEVDLTHGSYIQFLENPNREVRERAFKA 233

Query: 245 LSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNY 304
           +  T+ K  +  +   +          R RKY  + +     +N+   V   L+ +V   
Sbjct: 234 VYETYRKQKNTIAATLSANVNKNMFYSRVRKYPSVLEMSLYGDNIPKEVYTNLIDAVHES 293

Query: 305 YPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSI 364
                 RY +L+KK L +D ++ +D  APL    +  IP+E A+ +V +       +   
Sbjct: 294 -LPLLQRYMKLRKKLLGVDELHMYDLFAPLVEEYKWEIPYEDAKKMVEEGLKPLGEEYLK 352

Query: 365 IAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHF 424
           +  + F + WID  + +GK +GA++ G     HPY+LLN+      + TLAHE+GH +H 
Sbjct: 353 VLREGFENRWIDVYENEGKRTGAYSWG-AYGTHPYVLLNHKDNLNSMFTLAHEMGHALHS 411

Query: 425 VLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIV 484
             S E         ++ LAE AS   E L  D LL+ ++  +++  LL    +    ++ 
Sbjct: 412 YFSDEALKYRDAQYTIFLAEVASTTNEALLMDYLLKKSTDPKQKLYLLTYYADQFRTTLF 471

Query: 485 RQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHF 544
           RQ  F +FE  +H    +   +    ++EI+ +   +  G    + D +    W  +PHF
Sbjct: 472 RQTMFAEFEKLIHERAEAGESLTPQELSEIYYDLNVKYHGKDMVV-DQDIEMEWARIPHF 530

Query: 545 IESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLS 604
             S FYVY YA G     S              ++YL  L++G S +   +L    +++S
Sbjct: 531 YTS-FYVYKYATGFSAATSFSKQILEEGKPAV-DRYLGFLKSGGSDYSINILKKAGVDMS 588

Query: 605 DPNFWERGLQTVEKMIDDVEKM 626
            P      +   E +I+ +E++
Sbjct: 589 SPQPIREAMSVFENVIEQMEQL 610


>gi|295697024|ref|YP_003590262.1| oligoendopeptidase F [Bacillus tusciae DSM 2912]
 gi|295412626|gb|ADG07118.1| oligoendopeptidase F [Bacillus tusciae DSM 2912]
          Length = 600

 Score =  462 bits (1188), Expect = e-128,   Method: Composition-based stats.
 Identities = 139/608 (22%), Positives = 254/608 (41%), Gaps = 19/608 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           MTT+ S+  +     W LEDLYP   + E   + + ++         + G +      ++
Sbjct: 1   MTTVRSRAEIPVEDTWKLEDLYPDDQAWE--REFQDVQSRLGE-VEAFRGRV-----LES 52

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
             +L A +   + +   + R+ +Y+ +  + + ++ T            A       F  
Sbjct: 53  AETLLAVLRLEDDLSLKLERLYAYSHMRKDEDTTNSTYLALADRAQGLAARLAGAFSFVV 112

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            EI   D  +++           Y   + +I + K H+LS   E +L+  S++ +     
Sbjct: 113 PEILAGDAGVVQGYIDSHSDLALYRHKLDDILRRKPHVLSAAEEAILAQVSEIAQGPTTI 172

Query: 204 FFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           F   +   LR      +      +   +  +     DR VR+ A  A    + +  +  S
Sbjct: 173 FSMVDDADLRLPTIRDEHGREVELTKGRYSQFLESQDRRVRQDAFTAFYAAYKERLNTLS 232

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
              +   K +    R RKY    ++    + V   V ++L+ +  + +    HRY  L+K
Sbjct: 233 ATYHASVKKDVFYARVRKYSSSLEAALDDDRVPVEVYDSLI-AAVHEFLPALHRYLRLRK 291

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           K L L+ ++ +D   PL       + F+ A+  VL+  A    +   +    F   WID 
Sbjct: 292 KVLGLNDLHMYDLYVPLVPEIHREVSFDEAKKTVLEGLAPMGEEYLGVMRDAFASRWIDV 351

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK  GA++ G     HPY+LLN+     +V TLAHE+GH +H   +   Q  +   
Sbjct: 352 HENRGKRGGAYSWG-AYGTHPYVLLNWQPNIDNVFTLAHEMGHAMHSHYTYAHQPYVYGG 410

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
            S+ +AE AS   E+L    LL+    +  R+ LL + +E    ++ RQ+ F +FE   H
Sbjct: 411 YSIFVAEVASTCNESLLLHHLLKNTPDEAMRRYLLNHHLEQFRTTVFRQVMFAEFEKLTH 470

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
               +   + +H + + +    +   G    + D +    W  +PHF  + FYVY YA G
Sbjct: 471 EAVEAGHALTSHWMCDTYRRLNETYYGAEAVI-DEQIAWEWARIPHFYTA-FYVYKYATG 528

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                +L              +YL+ L AG+S +  E+L    +++  P    + LQ  E
Sbjct: 529 FSAATALSRRILEEGEPAV-RRYLDFLSAGSSDYPLEVLAKAGVDMRSPEPVRQALQVFE 587

Query: 618 KMIDDVEK 625
           + + ++EK
Sbjct: 588 ETVAELEK 595


>gi|269791717|ref|YP_003316621.1| oligoendopeptidase F [Thermanaerovibrio acidaminovorans DSM 6589]
 gi|269099352|gb|ACZ18339.1| oligoendopeptidase F [Thermanaerovibrio acidaminovorans DSM 6589]
          Length = 619

 Score =  461 bits (1186), Expect = e-127,   Method: Composition-based stats.
 Identities = 142/606 (23%), Positives = 270/606 (44%), Gaps = 22/606 (3%)

Query: 27  MDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS 86
           + S++ +    RW LED+YP+  S E   +   ++ +    +  + G L+      +   
Sbjct: 24  LPSRDQVPQELRWRLEDIYPTDASWE--EEFRAVQEQLPRLEA-FRGKLS------SPKE 74

Query: 87  LGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEI 146
           L A +   +++   +G++ +YA++  + + ++PT +      ++          F   E+
Sbjct: 75  LAACLKLRDQLSIAVGKLYAYAVMRSHEDTANPTYQALSDRASSLATLLGAKTSFIEPEL 134

Query: 147 NTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFC 206
             L   LL      +P    +  ++  + +   H+LS + E L++   +V     + F  
Sbjct: 135 VQLPRELLRSFL-DEPSLKDHRFFLSEVIRKSPHVLSREAEELVASMGEVLEVPERSFEM 193

Query: 207 ENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFIT 260
                + F     +      +   + Y+     DR VR+ A ++L   ++   +      
Sbjct: 194 LTNADMTFAPIRDEKGKRVEMSEERYYRFLRSKDRRVRREAYESLYDAYSAHENTLGATF 253

Query: 261 NTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWL 320
             + K      + RKY  +       + +   V   L+ +      K  HRY +L+ K L
Sbjct: 254 GGMLKASSFLAKTRKYPSVLAMELFDDAIPEEVYRQLVDT-VESNLKPLHRYIDLRAKAL 312

Query: 321 KLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQY 380
           KLD +  +D   PL       IP++ A+++VL++ +         A +     W+D  + 
Sbjct: 313 KLDQLAPYDLHVPLAEEIHRDIPWDRAKEMVLEALSPLGEDYVRKAREGLASGWVDVVEN 372

Query: 381 DGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSL 440
            GK  GA++ G+    HPYIL+NY G   DV TLAHELGH +H + S  TQ   T++ S+
Sbjct: 373 RGKRGGAYSWGS-YGTHPYILMNYNGTISDVFTLAHELGHSMHTLYSHSTQPYPTSDYSI 431

Query: 441 TLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTER 500
            +AE AS   E L  + L++ A   +E+  L+  +++ + +++ RQ  F  FE ++H   
Sbjct: 432 FVAEVASTVNEMLLLEHLIRNAKDPKEKLYLINYQLDQIRSTLYRQTMFASFEREVHRRH 491

Query: 501 RSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCL 560
           +         + ++W +  +   GP F + D      W  +PHF  S FYV+ YA G   
Sbjct: 492 QEGEPTSPRELRDLWGKLNRRYHGPNFQV-DQRITMEWARIPHFY-SPFYVFQYATGISA 549

Query: 561 VNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMI 620
             SL +    +     +++YLN+L  G S H  ELL    ++++ P      +   ++ +
Sbjct: 550 AISLSEAILKDP--SARDRYLNMLSRGGSAHPIELLKDAGVDMTSPRPVLDAIGLFDRRL 607

Query: 621 DDVEKM 626
            ++E +
Sbjct: 608 GEMETL 613


>gi|289435529|ref|YP_003465401.1| hypothetical protein lse_2168 [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289171773|emb|CBH28319.1| pepF [Listeria seeligeri serovar 1/2b str. SLCC3954]
          Length = 601

 Score =  460 bits (1184), Expect = e-127,   Method: Composition-based stats.
 Identities = 137/611 (22%), Positives = 270/611 (44%), Gaps = 19/611 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           S    +  +E +     W+L  +Y + ++ E       +  +     T+++G LA     
Sbjct: 2   SKTNALPLREEVPENLTWDLTSIYANDEAWE--EAFVQL-QKIAEESTKFKGRLAD---- 54

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            N  +L  A+   ++  +LI  +  YA L  + + ++   +  ++   + +      L +
Sbjct: 55  -NSQTLYEALQFRDKAYDLISNLYVYAHLKMDQDTANAKYQGLHSRAGSLVTKLMSALSY 113

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
           +  EI  +DE++L+Q   ++     YS  ++ +   + ++LS   E LL++  +V   + 
Sbjct: 114 YDPEILAMDESVLKQFLEENQDLQLYSHLLEELNLSRPYILSEKEEALLANAGEVLGSSS 173

Query: 202 KRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   ++F     +      I   +  K    +   VR+ A   +   +    + 
Sbjct: 174 NTFNTLNNADMKFPTIKNEDGEEIEITHGRYGKLLESNLLRVRREAFLGVYSVYEGLKNT 233

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
            +   N   K        R Y+   ++   +N++   V ++L++S  N      HRY +L
Sbjct: 234 LASTLNGQVKKSNFYASTRGYKSAREAALSNNHIPETVYDSLLKS-VNENANLLHRYVKL 292

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L L+ ++ +D   PL         ++ A++LVL++      +   I ++ F   WI
Sbjct: 293 RKELLGLEELHMYDLYTPLSDDVNLEFSYDEAKELVLEALKPLGEEYQSILKEAFDSRWI 352

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK           S +PYILLN+     +V TLAHELGH +H   + E Q  + 
Sbjct: 353 DVMENKGKR-SGAYSSGSYSTNPYILLNWQDNINNVYTLAHELGHSVHSYYTRENQPFVY 411

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ LAE AS   E L  D LL+     + R  LL + ++    ++ RQ  F +FE  
Sbjct: 412 GDYSIFLAEVASTTNENLLTDYLLKKYDDPKVRAYLLNHYLDGFKGTVFRQTQFAEFEHA 471

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H   ++   +    + E + +  K+  G      D E G  W  +PHF   ++YV+ YA
Sbjct: 472 VHQADQNGVALTADYLTETYFDINKKYYGEEMVY-DEEIGYEWSRIPHFY-MNYYVFQYA 529

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G    ++L     +         Y++ L+AG+S +  ++L    ++++ P+  +  L+ 
Sbjct: 530 TGFSAASALSAKILTEGQPAITA-YIDFLKAGSSDYPIDVLKKAGVDMATPDPVDDALKV 588

Query: 616 VEKMIDDVEKM 626
             + +D++EK+
Sbjct: 589 FAQRLDELEKL 599


>gi|154496475|ref|ZP_02035171.1| hypothetical protein BACCAP_00767 [Bacteroides capillosus ATCC
           29799]
 gi|150274558|gb|EDN01635.1| hypothetical protein BACCAP_00767 [Bacteroides capillosus ATCC
           29799]
          Length = 600

 Score =  460 bits (1183), Expect = e-127,   Method: Composition-based stats.
 Identities = 154/607 (25%), Positives = 255/607 (42%), Gaps = 19/607 (3%)

Query: 26  TMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCH 85
           T+ ++  +     W + DLYPS  +       E +          + G L      ++  
Sbjct: 4   TLPTRSQVDPANTWAITDLYPSDQAWR--EACENVRGLVRDLAA-YRGRLG-----ESAA 55

Query: 86  SLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALE 145
           +L A +   + I     R+ SYA    + +  +P  ++        L +  + L F   E
Sbjct: 56  TLLAFLRLQDEIDLQGDRMISYAFRKSDEDTRNPVYQEMSAQAQNFLVELSQALSFQTPE 115

Query: 146 INTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFF 205
           +  +++A LE  Y Q+P    Y   +K IR  K H LS D E LL+   ++G+     F 
Sbjct: 116 LLAIEDATLESFYEQEPALAHYRLMLKRIRSRKDHTLSPDCEALLASAERMGQAPDDIFS 175

Query: 206 CENIESLRFKI------NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFI 259
             N   + +            +           +DR +R+SA ++L   + +  +  + I
Sbjct: 176 LLNDADMTYPDATDSKGETHPVTHGNYVALLQSADRTLRQSAFQSLYSVYGQFRNTCAAI 235

Query: 260 TNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKW 319
                K  +     R+Y     +      V+P +   L+Q+  +      HRY  L+KK 
Sbjct: 236 LGAQMKQLQFFADARRYPSALHAALAETEVDPQIYHNLIQT-VHDNLDAMHRYVRLRKKL 294

Query: 320 LKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQ 379
           L +D ++++D   P+       IPFE A+D+  ++          I  + F + WID  +
Sbjct: 295 LGVDKLHYYDLYTPIVADEDASIPFEQAKDMAREALKPLGEDYLKILNEGFDNRWIDVYE 354

Query: 380 YDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSS 439
             GK SGA++ G    VHPY+LLNY     DV TL HE+GH +H  LS+ TQ +      
Sbjct: 355 NQGKRSGAYSAGV-YGVHPYVLLNYTDTLDDVFTLVHEMGHALHSYLSNHTQSVTYAGYK 413

Query: 440 LTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTE 499
           + +AE AS   E L    LL   +  + R  L+ + +E    ++ RQ  F +FEL    +
Sbjct: 414 IFVAEVASTCNEALLMQHLLSKTTEPKCRAYLINHFLEQFRGTLYRQTMFAEFELWCSEQ 473

Query: 500 RRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNC 559
            R    +    +NE + E  +   G   +  D E    W  +PHF   +FYVY YA G  
Sbjct: 474 TRKGQPLTAESLNEKYAELNRLYYGEDIE-PDPEIALEWARIPHFY-YNFYVYQYATGFT 531

Query: 560 LVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKM 619
              +L             E YL  L  G S     LL    +++S P      L+  + +
Sbjct: 532 SAIALSQRILKEGRPAV-EDYLRFLSGGCSADPVSLLKGAGVDISSPAPIVDALKLFDTL 590

Query: 620 IDDVEKM 626
           I ++E++
Sbjct: 591 IGEMEQL 597


>gi|319646548|ref|ZP_08000777.1| YjbG protein [Bacillus sp. BT1B_CT2]
 gi|317391136|gb|EFV71934.1| YjbG protein [Bacillus sp. BT1B_CT2]
          Length = 681

 Score =  460 bits (1182), Expect = e-127,   Method: Composition-based stats.
 Identities = 134/615 (21%), Positives = 274/615 (44%), Gaps = 19/615 (3%)

Query: 18  ALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAH 77
                    + S+E +     W LED++PS D+   + + + ++       + ++G L H
Sbjct: 73  VAEEKKSKKLPSREEVKQEDTWRLEDIFPSDDAW--NEEFQAVKELLPKL-SEFKGKLGH 129

Query: 78  ATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEK 137
                +   L  A+   +++ E +G++ +YA + Y+ +  +   +               
Sbjct: 130 -----SADDLYEALTYQDKVMERLGKLYTYAHMRYDQDTGNSFYQGLNDKAANLYTQAAS 184

Query: 138 VLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVG 197
              +   EI ++ E  L+Q   +      YS  ++ I K + H+LS + E +L++ S V 
Sbjct: 185 ATAYMVPEILSIQEEKLQQFLLEKEELKLYSHALEEINKERPHVLSEEEEGILAEASDVL 244

Query: 198 REALKRFFCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNK 251
                 F   N   + F           ++            +R+VR++A KA+  T+ +
Sbjct: 245 SSPSNTFGMLNNADMEFPEITDENGEKVQLTHGNYITFLESENRDVRRAAFKAVYETYGR 304

Query: 252 SSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHR 311
             +  +   +   K +    + + Y+   ++    N++   V + L+ ++  +     HR
Sbjct: 305 FKNTLASTLSGAVKKDNFYAKVKHYKSAREAALSRNSIPEEVYDNLVSTINKH-LPLLHR 363

Query: 312 YYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFT 371
           Y E++KK L+LD ++ +D   PL   S   + +E A+D +L+  A    + S I ++   
Sbjct: 364 YVEIRKKVLELDEVHMYDLYTPLVKDSGMKVTYEQAKDYMLKGLAPLGEEYSSILKEGLN 423

Query: 372 HNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQ 431
           + W+D  +  GK SGA++ GT    +PYIL+N+     ++ TL HE GH +H   + + Q
Sbjct: 424 NRWVDVYENKGKRSGAYSSGT-YGTNPYILMNWQDNVNNLFTLVHEFGHSVHSYYTRKYQ 482

Query: 432 GILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYD 491
                N S+ +AE AS   E L  + LL     +++R  +L + +E    ++ RQ  F +
Sbjct: 483 PYPYGNYSIFVAEVASTTNEALLGEYLLNTIEDEKQRLYILNHMLEGFKGTVFRQTMFAE 542

Query: 492 FELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYV 551
           FE ++H + +    +    +  I+ +  K+  G   ++ D E G  W  +PHF  + +  
Sbjct: 543 FEHEIHVKAQEGEPLTPELLTSIYYDLNKKYFGDNIEI-DKEIGLEWSRIPHFYYNYYVY 601

Query: 552 YAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWER 611
              A G     +L             ++Y+  L+AG+S +  E+L    ++++     E 
Sbjct: 602 QY-ATGFSAAQALSQQILKEG-KSAVDRYIEFLKAGSSDYPIEVLKKAGVDMTSSEPIEA 659

Query: 612 GLQTVEKMIDDVEKM 626
             +  E+ ++++E++
Sbjct: 660 ACKKFEEQLNEMEEL 674


>gi|125974937|ref|YP_001038847.1| oligopeptidase F [Clostridium thermocellum ATCC 27405]
 gi|256003806|ref|ZP_05428793.1| oligoendopeptidase F [Clostridium thermocellum DSM 2360]
 gi|281418598|ref|ZP_06249617.1| oligoendopeptidase F [Clostridium thermocellum JW20]
 gi|125715162|gb|ABN53654.1| oligopeptidase F, Metallo peptidase, MEROPS family M03B
           [Clostridium thermocellum ATCC 27405]
 gi|255992144|gb|EEU02239.1| oligoendopeptidase F [Clostridium thermocellum DSM 2360]
 gi|281407682|gb|EFB37941.1| oligoendopeptidase F [Clostridium thermocellum JW20]
 gi|316939146|gb|ADU73180.1| oligoendopeptidase F [Clostridium thermocellum DSM 1313]
          Length = 602

 Score =  460 bits (1182), Expect = e-127,   Method: Composition-based stats.
 Identities = 153/614 (24%), Positives = 278/614 (45%), Gaps = 19/614 (3%)

Query: 19  LRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHA 78
           +  S    +  ++ + +  +W LE +Y   D  E   D   ++        +++G L   
Sbjct: 1   MAESKTNALPKRDEIDSKYKWKLEHIYAGIDDWE--RDFSKVKEYISQIV-KFKGTLG-- 55

Query: 79  TNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKV 138
              K+ ++L   +     +     R+  YA +  + + S+ T +      +A + +    
Sbjct: 56  ---KDSNTLLECLKLSNELMSTNDRVFVYARMKKDEDNSNSTYQSLADRASALMTEAYAA 112

Query: 139 LIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGR 198
             F   EI T+ E  L +   ++     Y  + + I + K+H+LS   E LL+  S++  
Sbjct: 113 TSFIVPEILTIPEEKLNKYLEENKDLQLYRQFFREILRQKEHVLSEKEEELLALASEMAG 172

Query: 199 EALKRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKS 252
              + F   N   ++F     +      +   +  K     DR VRK A +AL  T+ K 
Sbjct: 173 SPREIFTMFNNADIKFPFIKDEDGEEVELTKGRYIKFLESKDRRVRKDAFQALYSTYAKF 232

Query: 253 SHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRY 312
            +  +       K  +      KY+   ++   ++N+   V + L+    N      HRY
Sbjct: 233 KNTIAASLVGSIKASKFYATAAKYDSSLEASLDADNISVDVYDNLI-ETVNKNLHLLHRY 291

Query: 313 YELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTH 372
            +L+KK LKLD ++ +D   P+   S+  IP+E A  +V         +     ++ FT+
Sbjct: 292 LKLRKKALKLDELHMYDLYVPIVEESKKNIPYEEALKMVEAGLRPLGEEYISHLKEGFTN 351

Query: 373 NWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQG 432
            WID  +  GK SGA++ G   + HPY+LLNY G   DV T+AHE+GH +H   +++TQ 
Sbjct: 352 GWIDVYENQGKTSGAYSWG-AYTTHPYVLLNYQGTINDVFTIAHEMGHALHSYYTNKTQP 410

Query: 433 ILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDF 492
            + +   + +AE AS   E L  + LL     K E+  LL + +E    ++ RQ+ F +F
Sbjct: 411 YVYSEYKIFVAEVASTVNEALLMNYLLDKTKDKTEKAYLLNHYLEQFRGTVYRQVMFAEF 470

Query: 493 ELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVY 552
           E  +H + ++   +    ++ I+ +  K+      ++ D E    W  +PHF  S FYVY
Sbjct: 471 EKTVHMKHKNGEPLTADILSNIYYDLNKKYFEAEVNV-DEEISMEWARIPHFYTS-FYVY 528

Query: 553 AYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERG 612
            YA G     ++ D+          ++Y+  L++G+S +  ELL    ++LS P   +  
Sbjct: 529 KYATGFSSAIAISDMILKEGQPAV-DRYIKFLKSGSSDYPLELLKIAGVDLSTPKPVQDA 587

Query: 613 LQTVEKMIDDVEKM 626
           L   EK++ ++E +
Sbjct: 588 LDVFEKILGELEAL 601


>gi|156743523|ref|YP_001433652.1| oligoendopeptidase F [Roseiflexus castenholzii DSM 13941]
 gi|156234851|gb|ABU59634.1| oligoendopeptidase F [Roseiflexus castenholzii DSM 13941]
          Length = 605

 Score =  459 bits (1181), Expect = e-127,   Method: Composition-based stats.
 Identities = 141/611 (23%), Positives = 258/611 (42%), Gaps = 19/611 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           ++M  +  ++ +    RW+L  +YP   + E   D+  IE          +G +A     
Sbjct: 2   TEMQKIPRRDEIPEQYRWDLTTIYPDDAAWE--QDIAAIESMLGD-VAALQGRVAR---- 54

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            +   L AA+   +++   + ++  YA   ++ + + P  +          A     L F
Sbjct: 55  -SADDLLAALRMRDQVSMRLWQVYVYANRRFDSDTTDPVGQALAERAGTLAAKVSAALAF 113

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI    E  +       P    Y   +  + + + H+ S ++E +L+  S + R   
Sbjct: 114 IDPEILVAPEEQIRAWLRDHPDLAVYEYALDQLLRQRDHVRSAEVEAILAQFSDITRAPG 173

Query: 202 KRFFCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
           + F       L F   +       ++   +  +     DR VR+ A       F    + 
Sbjct: 174 EIFEVLTNADLSFPTIEDEHGQTVQLSHGRYMRLLRSPDRRVRRDAFIGYYSAFQGIRNT 233

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
                    +   +  R R Y    ++    N++   V   L+ +  N      HRY  L
Sbjct: 234 LGASLAAQVRTHVLNARVRNYTSSLEAALTPNDIPVEVYHNLI-ATVNANLSRLHRYLRL 292

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +++ + LD ++F+D  APL   +   +P+     LV  ++     +      + F + WI
Sbjct: 293 RRRIMGLDELHFYDLYAPLVPEADVAVPYAEGERLVRAAFEPLGEEYGAAIAEAFGNRWI 352

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G   +  P++LLNY  +  DV TLAHELGH +H   + +TQ  + 
Sbjct: 353 DVYENVGKRSGAYSDG-AYTTAPFMLLNYQDRLNDVFTLAHELGHAMHSYFTRKTQPYVY 411

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + ++ +AE AS   E L  D LLQ       R+ L+  ++ED+  ++ RQ  F +FEL+
Sbjct: 412 GDYTIFVAEVASTLNEALLTDYLLQTRDDPTLRRYLIVEQLEDIRTTLFRQTMFAEFELE 471

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H    +   + T   + I+        G    L D +    W  +PHF   +FYVY YA
Sbjct: 472 IHRRAEAGEPLTTELFSTIYRNLVARYHGSDVML-DEQIALEWARIPHFY-YNFYVYQYA 529

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L+    +       E+YL  LR+G+S+   ELL    +++  P   +  +  
Sbjct: 530 TGLSAALALHARIVNEGRPA-IERYLRFLRSGSSRPSIELLRDAGVDMLSPAPIQAAMDH 588

Query: 616 VEKMIDDVEKM 626
            + ++ ++E+M
Sbjct: 589 FDALLGELEQM 599


>gi|219669074|ref|YP_002459509.1| oligoendopeptidase F [Desulfitobacterium hafniense DCB-2]
 gi|219539334|gb|ACL21073.1| oligoendopeptidase F [Desulfitobacterium hafniense DCB-2]
          Length = 599

 Score =  459 bits (1181), Expect = e-127,   Method: Composition-based stats.
 Identities = 145/610 (23%), Positives = 265/610 (43%), Gaps = 19/610 (3%)

Query: 23  DMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           +   + ++  +    +W+LED++PS  + E   +    E         ++G+L       
Sbjct: 2   EQAKLKTRSEIPEQYKWHLEDIFPSDQAWE--EEFLKAEKLLER-AESFQGHLGD----- 53

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
           +  +L       + + + +G I +YA +  + +  +   +       A        L F 
Sbjct: 54  SAEALLTCFDWMDEVGQSVGEIYTYARMRRDEDNRNAHYQALTDRAGALSVRVGSALAFV 113

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
             EI  L E  L++    +     Y   +++I + ++H+LS+  E LL++  ++      
Sbjct: 114 VPEILALPEGRLQEFRQANEKMALYDHALEDILRKREHVLSSQEEKLLAEMGEIAEGPST 173

Query: 203 RFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIF 256
            F   N   L+F     +      +      +     +R VR+ A + L  T+ K  + +
Sbjct: 174 IFGMANNADLKFPSIKNEQDEEVELTKGNYIQFMESENRRVRQEAFETLYGTYQKQINTW 233

Query: 257 SFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELK 316
           + I N+  K +    R R+Y    ++    + V   V +AL+ +V+ +     HRY +L+
Sbjct: 234 AAILNSNIKGDVFFARARRYPSAIEASLHDDKVPLGVYDALIDTVREF-LPEMHRYVKLR 292

Query: 317 KKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWID 376
           KK L LD ++ +D   P+    +  IP++ A  +  +           + E+ FT +WID
Sbjct: 293 KKALGLDELHMYDIYVPIVSEVKMTIPYQEAVAMCREGLKPLGSDYGKVLEEGFTSHWID 352

Query: 377 APQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTN 436
             +  GK SGA++ GT    HPY+LLN+      + T+AHE+GH +H   S+ TQ  +  
Sbjct: 353 VYENQGKTSGAYSWGT-YRSHPYVLLNHQDTLDSMFTIAHEMGHSLHTYFSNRTQPHIYA 411

Query: 437 NSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKL 496
              + +AE AS   E L  D LL+     +    LL + +E    ++ RQ  F +FE K 
Sbjct: 412 GYKIFVAEVASTLNEALVMDHLLKTTEDPKLLAYLLNHYLEQFRGTVFRQTMFAEFEKKT 471

Query: 497 HTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAF 556
           H        +    ++  +L+  ++  GP   + D +    W  +PHF  + FYVY YA 
Sbjct: 472 HALVEQGEALTAELLSSTYLKLNEDYYGPDVVM-DPQIAIEWARIPHFYNA-FYVYKYAT 529

Query: 557 GNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTV 616
           G     +L             E+YL  L +G+S +  ELL    +++  P      LQ  
Sbjct: 530 GFSAATALARKILDEGEPAV-ERYLRFLSSGSSDYPIELLREAGVDMETPVPVREALQVF 588

Query: 617 EKMIDDVEKM 626
             ++D +E +
Sbjct: 589 TSLLDRLEGL 598


>gi|89894637|ref|YP_518124.1| hypothetical protein DSY1891 [Desulfitobacterium hafniense Y51]
 gi|89334085|dbj|BAE83680.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 601

 Score =  459 bits (1181), Expect = e-127,   Method: Composition-based stats.
 Identities = 145/610 (23%), Positives = 265/610 (43%), Gaps = 19/610 (3%)

Query: 23  DMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           +   + ++  +    +W+LED++PS  + E   +    E         ++G+L       
Sbjct: 4   EQAKLKTRSEIPEQYKWHLEDIFPSDQAWE--EEFLKAEKLLER-AESFQGHLGD----- 55

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
           +  +L       + + + +G I +YA +  + +  +   +       A        L F 
Sbjct: 56  SAEALLTCFDWMDEVGQSVGEIYTYARMRRDEDNRNAHYQALTDRAGALSVRVGSALAFV 115

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
             EI  L E  L++    +     Y   +++I + ++H+LS+  E LL++  ++      
Sbjct: 116 VPEILALPEGRLQEFRQANEKMALYDHALEDILRKREHVLSSQEEKLLAEMGEIAEGPST 175

Query: 203 RFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIF 256
            F   N   L+F     +      +      +     +R VR+ A + L  T+ K  + +
Sbjct: 176 IFGMANNADLKFPSIKNEQDEEVELTKGNYIQFMESENRRVRQEAFETLYGTYQKQINTW 235

Query: 257 SFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELK 316
           + I N+  K +    R R+Y    ++    + V   V +AL+ +V+ +     HRY +L+
Sbjct: 236 AAILNSNIKGDVFFARARRYPSAIEASLHDDKVPLGVYDALIDTVREF-LPEMHRYVKLR 294

Query: 317 KKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWID 376
           KK L LD ++ +D   P+    +  IP++ A  +  +           + E+ FT +WID
Sbjct: 295 KKALGLDELHMYDIYVPIVSEVKMTIPYQEAVAMCREGLKPLGSDYGKVLEEGFTSHWID 354

Query: 377 APQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTN 436
             +  GK SGA++ GT    HPY+LLN+      + T+AHE+GH +H   S+ TQ  +  
Sbjct: 355 VYENQGKTSGAYSWGT-YRSHPYVLLNHQDTLDSMFTIAHEMGHSLHTYFSNRTQPHIYA 413

Query: 437 NSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKL 496
              + +AE AS   E L  D LL+     +    LL + +E    ++ RQ  F +FE K 
Sbjct: 414 GYKIFVAEVASTLNEALVMDHLLKTTEDPKLLAYLLNHYLEQFRGTVFRQTMFAEFEKKT 473

Query: 497 HTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAF 556
           H        +    ++  +L+  ++  GP   + D +    W  +PHF  + FYVY YA 
Sbjct: 474 HALVEQGEALTAELLSSTYLKLNEDYYGPDVVM-DPQIAIEWARIPHFYNA-FYVYKYAT 531

Query: 557 GNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTV 616
           G     +L             E+YL  L +G+S +  ELL    +++  P      LQ  
Sbjct: 532 GFSAATALARKILDEGEPAV-ERYLRFLSSGSSDYPIELLREAGVDMETPVPVREALQVF 590

Query: 617 EKMIDDVEKM 626
             ++D +E +
Sbjct: 591 TSLLDRLEGL 600


>gi|319649958|ref|ZP_08004108.1| oligoendopeptidase F [Bacillus sp. 2_A_57_CT2]
 gi|317398396|gb|EFV79084.1| oligoendopeptidase F [Bacillus sp. 2_A_57_CT2]
          Length = 605

 Score =  459 bits (1181), Expect = e-127,   Method: Composition-based stats.
 Identities = 139/612 (22%), Positives = 272/612 (44%), Gaps = 18/612 (2%)

Query: 21  SSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
            + +  + ++  +     W LED++PS +      +   ++        +++G L     
Sbjct: 4   ETTVKKLPARNEISPEDTWRLEDIFPSDEDW--DKEYNEVQKLIPN-AGKYQGRLG---- 56

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
            ++  +L  A+   + I   +G++ +YA + Y+ + ++   +     I    ++   VL 
Sbjct: 57  -ESAETLYEALQFQDHILSRLGKLYTYAHMRYDQDTTNSFYQSMDDKIKNLYSEAASVLA 115

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           +   E+   DEA +     +      Y   ++ I   + H+LS + E LL+  S+V   +
Sbjct: 116 YIVPELLAEDEAKIAGFLEEKTELQLYKHSLEEINLQRPHVLSAEQESLLAQASEVLGAS 175

Query: 201 LKRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              F   N   L F     +      I   +  +     ++ VR  A KA+  T+ K  +
Sbjct: 176 SNTFGMLNNADLEFPSIKDENGEDVEITHGRFIRFLESDEQRVRHDAFKAVYETYGKFRN 235

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
            F+   +   K +    + R YE    +   +NN+   V E L+ ++ N      HRY +
Sbjct: 236 TFASTLSGNIKKDNFNAKIRNYESARHAALAANNIPESVYENLVNTI-NDNLHLLHRYVK 294

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+KK L ++ ++ +D   PL    +  IP++ A+DL+L+           I ++ F + W
Sbjct: 295 LRKKVLGVEELHMYDLYTPLVKEVKMEIPYKEAKDLILKGLKPLGGDYLNILKEGFENRW 354

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D  +  GK SGA++ GT    +PYIL+N+     ++ TLAHE GH +H   + + Q   
Sbjct: 355 VDVHENKGKRSGAYSSGT-YGTNPYILMNWQDNVNNLFTLAHEFGHSVHSYYTRKYQPYP 413

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
             N S+ +AE AS   E L  D LL+     ++R  LL + +E    ++ RQ  F +FE 
Sbjct: 414 YGNYSIFVAEVASTCNEALLNDYLLKTIDDDKKRLYLLNHYLEGFRGTVFRQTMFAEFEH 473

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
            +H + ++   +    + + + E  K+  G    + D E G  W  +PHF  + +     
Sbjct: 474 LIHKKAQNNEALTADSLTKEYYELNKKYFGEEDIVIDEEIGLEWSRIPHFYYNYYVYQY- 532

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     +L             ++Y+  L++G+S +  E+L    ++++     E   +
Sbjct: 533 ATGFSAATALSKQILQEGQPAV-DRYIEFLKSGSSDYPIEVLKKAGVDMTSSKPIEDACK 591

Query: 615 TVEKMIDDVEKM 626
             E+ ++++E +
Sbjct: 592 VFEEKLNEMESL 603


>gi|326389801|ref|ZP_08211365.1| oligoendopeptidase F [Thermoanaerobacter ethanolicus JW 200]
 gi|325994069|gb|EGD52497.1| oligoendopeptidase F [Thermoanaerobacter ethanolicus JW 200]
          Length = 596

 Score =  458 bits (1178), Expect = e-126,   Method: Composition-based stats.
 Identities = 149/609 (24%), Positives = 265/609 (43%), Gaps = 20/609 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           M  +  +  + +  +W LED+Y + +  E   D    +        +++G +  + N   
Sbjct: 1   MEVLKDRSEIEDKYKWRLEDIYENENLWE--EDYNKTKELLKEIV-KFKGKINTSRN--- 54

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
              L   +   ++I     +I +YA +  + + ++P  +           +      F A
Sbjct: 55  ---LLEVLKLNDQIGMTASKIFAYARMRRDEDNTNPKYQALTDKAMRLNVEVMSATSFIA 111

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            EI ++D   L +   +      Y  +++++ + K H+LS++ E +L++   +       
Sbjct: 112 PEILSIDTQKLMEMIEELEELKIYKQYLEDLIRFKPHVLSSEEEKILAEAETLAESVSNV 171

Query: 204 FFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           +   N   +RF     +      +      +     DR VRK+A  A+  T+ K  + F+
Sbjct: 172 YTMLNNADMRFPTIKDEEGKEVEVTHGNFVRFMQSKDRNVRKAAFNAMYDTYKKFINTFA 231

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
                  K +    + RKY    ++    +NV   V   L+    +      HRY  LKK
Sbjct: 232 STMAGNVKKDIFYAKTRKYNSSLEASLFEDNVSVEVYNNLI-ETVHSRLDVLHRYVRLKK 290

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           K L LD ++ +D   PL         +E A +LVL+       +   +  K F   W+D 
Sbjct: 291 KLLGLDELHMYDLYVPLIQEYDKKFTYEEAINLVLEGLQPLGDEYINLLRKGFNSRWVDV 350

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK SGA++ GT    HPY+LLNY GK  DV T+AHE+GH +H   S+ TQ  +   
Sbjct: 351 YENRGKTSGAYSWGT-YGTHPYVLLNYQGKLNDVFTIAHEMGHSLHTYYSNATQPYVYAG 409

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
             + +AE AS   E +  + LL+ +  ++E+  LL +  E+   ++ RQ+ F +FE  +H
Sbjct: 410 YKIFVAEVASTCNEAILMNYLLKNSKDEKEKLYLLNHFFEEFRGTVYRQVMFAEFEKLIH 469

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
                   +    +N+ + E  K   G    + D      W  +PHF   +FYVY YA G
Sbjct: 470 EMAERGEPLTAEVLNKKYYELNKLYYGDDIVV-DEGISYEWARIPHFYR-NFYVYKYATG 527

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                ++  +  +       E+Y   L++G+S +   LL    ++L+ P      L   E
Sbjct: 528 FSAAIAISQMILNEGEKAV-ERYKEFLKSGSSDYPLNLLKKAGVDLTTPKPVNEALDVFE 586

Query: 618 KMIDDVEKM 626
           K++D+ EKM
Sbjct: 587 KLLDEFEKM 595


>gi|315122737|ref|YP_004063226.1| oligoendopeptidase F [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313496139|gb|ADR52738.1| oligoendopeptidase F [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 621

 Score =  457 bits (1176), Expect = e-126,   Method: Composition-based stats.
 Identities = 428/626 (68%), Positives = 509/626 (81%), Gaps = 7/626 (1%)

Query: 1   MTKYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECI 60
           MT     + F+   F       D T       LG+LPRWNL+DLYPSHDS+EI  DME +
Sbjct: 3   MTYKSPTDDFAPKIFFSPDIKKDSTEY-----LGDLPRWNLKDLYPSHDSKEILTDMERL 57

Query: 61  EHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPT 120
           +HESLAF+TRW+GNL +ATNQ     LGAAI+EYE++ +L GRI SYA L Y+ +LS  T
Sbjct: 58  DHESLAFRTRWKGNLENATNQTGSTGLGAAISEYEKLSDLAGRIYSYAYLLYSTHLSDQT 117

Query: 121 IRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKH 180
           I KF+TD NAK+ D E+ LIFF LEIN LD  LLE+SY QD L LKYS WIKNIRK KKH
Sbjct: 118 ICKFHTDTNAKITDLEQRLIFFTLEINDLDNTLLEKSYNQDLLALKYSPWIKNIRKYKKH 177

Query: 181 LLSNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKS 240
           LLS+++ECL SDT+Q G EALK FF E +E+LRFK+NDQK+PL KA     + DR++R+S
Sbjct: 178 LLSDELECLFSDTAQTGSEALKHFFSETLETLRFKVNDQKLPLEKASTLLLNPDRKIRES 237

Query: 241 AAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQS 300
           + KA+S TF K+SHIFSFITNTLAKD EIQD+WRKYE ++DSRHLSN++EPYVIE+L+QS
Sbjct: 238 SGKAISKTFEKNSHIFSFITNTLAKDREIQDKWRKYENVSDSRHLSNDIEPYVIESLVQS 297

Query: 301 VKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSP 360
           VKNYYPK SHRYY LKK+WLKLD MYFWDR APL  +S+ IIPFE ARD+ L SYAKFSP
Sbjct: 298 VKNYYPKISHRYYSLKKQWLKLDKMYFWDRSAPLLDSSEVIIPFEKARDITLASYAKFSP 357

Query: 361 QMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGH 420
           QMS IAEKFF++NWIDAPQ +GKG GAF+HGT+PS HPYI LNY GK +DV TLAHELGH
Sbjct: 358 QMSEIAEKFFSNNWIDAPQCEGKGIGAFSHGTVPSSHPYISLNYSGKSRDVTTLAHELGH 417

Query: 421 GIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDML 480
           GIH VLS++ QG L  N+ L LAETASIFGE LTFDSL+ + S++ +RKILL +KIED L
Sbjct: 418 GIHQVLSAQ-QGALMANAPLILAETASIFGEALTFDSLIDSISNEHDRKILLTHKIEDSL 476

Query: 481 NSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMM 540
           +SI+RQI+FYDFEL++HTERR TG IP  RINEIWLETQKESLGPAF+L +  Y +FWMM
Sbjct: 477 SSIIRQIAFYDFELRIHTERR-TGSIPIQRINEIWLETQKESLGPAFELDNSGYDNFWMM 535

Query: 541 VPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLN 600
           +PHFI SSFYVY+Y+FGNCLVNSLY+IYKSNTVD F++KYLNILRAGNSK++SELL PLN
Sbjct: 536 IPHFIHSSFYVYSYSFGNCLVNSLYEIYKSNTVDQFQKKYLNILRAGNSKNHSELLQPLN 595

Query: 601 INLSDPNFWERGLQTVEKMIDDVEKM 626
           I+LSDPNFW RGLQ VE+MIDD+E+M
Sbjct: 596 IDLSDPNFWNRGLQAVERMIDDLEQM 621


>gi|52079656|ref|YP_078447.1| oligoendopeptidase F,Pz peptidase [Bacillus licheniformis ATCC
           14580]
 gi|52785018|ref|YP_090847.1| YjbG [Bacillus licheniformis ATCC 14580]
 gi|52002867|gb|AAU22809.1| oligoendopeptidase F,Pz peptidase [Bacillus licheniformis ATCC
           14580]
 gi|52347520|gb|AAU40154.1| YjbG [Bacillus licheniformis ATCC 14580]
          Length = 667

 Score =  457 bits (1175), Expect = e-126,   Method: Composition-based stats.
 Identities = 134/615 (21%), Positives = 274/615 (44%), Gaps = 19/615 (3%)

Query: 18  ALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAH 77
                    + S+E +     W LED++PS D+   + + + ++       + ++G L H
Sbjct: 59  VAEEKKSKKLPSREEVKQEDTWRLEDIFPSDDAW--NEEFQAVKELLPKL-SEFKGKLGH 115

Query: 78  ATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEK 137
                +   L  A+   +++ E +G++ +YA + Y+ +  +   +               
Sbjct: 116 -----SADDLYEALTYQDKVMERLGKLYTYAHMRYDQDTGNSFYQGLNDKAANLYTQAAS 170

Query: 138 VLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVG 197
              +   EI ++ E  L+Q   +      YS  ++ I K + H+LS + E +L++ S V 
Sbjct: 171 ATAYMVPEILSIQEEKLQQFLLEKEELKLYSHALEEINKERPHVLSEEEEGILAEASDVL 230

Query: 198 REALKRFFCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNK 251
                 F   N   + F           ++            +R+VR++A KA+  T+ +
Sbjct: 231 SSPSNTFGMLNNADMEFPEITDENGEKVQLTHGNYITFLESENRDVRRAAFKAVYETYGR 290

Query: 252 SSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHR 311
             +  +   +   K +    + + Y+   ++    N++   V + L+ ++  +     HR
Sbjct: 291 FKNTLASTLSGAVKKDNFYAKVKHYKSAREAALSRNSIPEEVYDNLVSTINKH-LPLLHR 349

Query: 312 YYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFT 371
           Y E++KK L+LD ++ +D   PL   S   + +E A+D +L+  A    + S I ++   
Sbjct: 350 YVEIRKKVLELDEVHMYDLYTPLVKDSGMKVTYEQAKDYMLKGLAPLGEEYSSILKEGLN 409

Query: 372 HNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQ 431
           + W+D  +  GK SGA++ GT    +PYIL+N+     ++ TL HE GH +H   + + Q
Sbjct: 410 NRWVDVYENKGKRSGAYSSGT-YGTNPYILMNWQDNVNNLFTLVHEFGHSVHSYYTRKYQ 468

Query: 432 GILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYD 491
                N S+ +AE AS   E L  + LL     +++R  +L + +E    ++ RQ  F +
Sbjct: 469 PYPYGNYSIFVAEVASTTNEALLGEYLLNTIEDEKQRLYILNHMLEGFKGTVFRQTMFAE 528

Query: 492 FELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYV 551
           FE ++H + +    +    +  I+ +  K+  G   ++ D E G  W  +PHF  + +  
Sbjct: 529 FEHEIHVKAQEGEPLTPELLTSIYYDLNKKYFGDNIEI-DKEIGLEWSRIPHFYYNYYVY 587

Query: 552 YAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWER 611
              A G     +L             ++Y+  L+AG+S +  E+L    ++++     E 
Sbjct: 588 QY-ATGFSAAQALSQQILKEG-KSAVDRYIEFLKAGSSDYPIEVLKKAGVDMTSSEPIEA 645

Query: 612 GLQTVEKMIDDVEKM 626
             +  E+ ++++E++
Sbjct: 646 ACKKFEEQLNEMEEL 660


>gi|303240135|ref|ZP_07326656.1| oligoendopeptidase F [Acetivibrio cellulolyticus CD2]
 gi|302592404|gb|EFL62131.1| oligoendopeptidase F [Acetivibrio cellulolyticus CD2]
          Length = 602

 Score =  456 bits (1173), Expect = e-126,   Method: Composition-based stats.
 Identities = 153/610 (25%), Positives = 278/610 (45%), Gaps = 19/610 (3%)

Query: 23  DMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           +   +  ++ +    +WNL D+Y S D  E  ND++ ++        +++G L +     
Sbjct: 5   NSKALPKRDEIDEKYKWNLGDMYQSIDKWE--NDLKTVKQLIEQIV-KYKGTLVN----- 56

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
               L   +     +  L   I  YA +  + +  +PT +      +    +    + F 
Sbjct: 57  GPEILLECLKASNEMMALNDMIYVYARMKRDEDNGNPTYQALSDRASTLSTEVYASISFI 116

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
             +I ++ + +LE   +       Y  +   I + K+H+LS   E +L+ +S++   +  
Sbjct: 117 VPKITSIPQDVLESFISSSEGLKVYRQFFNEIVRQKEHILSEKEEEILALSSEMASSSRD 176

Query: 203 RFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIF 256
            F   N   L+F     +      +   +  K     DR VRK A  AL  T+ K S+  
Sbjct: 177 IFTMFNNADLKFPFIKDENGEDIELTKGRYTKFLESEDRRVRKDAFTALYDTYGKFSNTL 236

Query: 257 SFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELK 316
           +       K  +      KY+   ++   ++N+   V + L+ +  N      HRY +L+
Sbjct: 237 ATSLTGNMKANKFYSTVSKYKSSLEASLDADNISQEVYDNLIDT-VNNNLPLLHRYLKLR 295

Query: 317 KKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWID 376
           +K LKL+ ++ +D   P+   S+  IP+E A  LV Q  +    +     ++ F   W+D
Sbjct: 296 RKALKLEELHMYDLYVPIVKESKKNIPYEEALKLVEQGLSPMGDEYIGYLKEGFNSGWVD 355

Query: 377 APQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTN 436
             +  GK SGA++ G   S HPY+LLNY G   DV T+AHE+GH +H   +++TQ  + +
Sbjct: 356 VFENQGKTSGAYSWGAYKS-HPYVLLNYQGTINDVFTIAHEMGHALHSYYTNKTQPYVYS 414

Query: 437 NSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKL 496
              + +AE AS   E+L  + LL+  SSKEE+  LL + +E    +I RQ+ F +FE   
Sbjct: 415 EYKIFVAEVASTVNESLLMEHLLKNTSSKEEKAYLLNHYLEQFRGTIFRQVMFAEFEKIT 474

Query: 497 HTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAF 556
           H+  +    +    ++ I+L+  K+       + D      W  +PHF  S FYVY YA 
Sbjct: 475 HSNLQDGEALTADVLSNIYLDLNKKYFEAEVSVDD-AIKMEWARIPHFYTS-FYVYKYAT 532

Query: 557 GNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTV 616
           G     ++ ++  +       ++Y   L+ G+S +  +LL    ++L  P   +  L   
Sbjct: 533 GFSSAVAISNMILNEGKPA-IDRYKEFLKGGSSDYPLDLLKRAGVDLYTPKPVQDALDVF 591

Query: 617 EKMIDDVEKM 626
           EK++ ++E +
Sbjct: 592 EKILTELEAL 601


>gi|228926335|ref|ZP_04089408.1| Oligoendopeptidase F [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228833327|gb|EEM78891.1| Oligoendopeptidase F [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
          Length = 608

 Score =  455 bits (1171), Expect = e-126,   Method: Composition-based stats.
 Identities = 143/611 (23%), Positives = 274/611 (44%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +   T+  +  +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NTAKTLPDRNEIEESSTWRLEDIFQTDTEWE--KEFQAIKELLPKL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            + ++L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     DR VR+ A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+    N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLI-ESVNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+D++L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLHVLGDEYVDILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHI 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+ +  K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 VHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVI-DEEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|229090241|ref|ZP_04221487.1| Oligoendopeptidase F [Bacillus cereus Rock3-42]
 gi|228693087|gb|EEL46802.1| Oligoendopeptidase F [Bacillus cereus Rock3-42]
          Length = 608

 Score =  455 bits (1171), Expect = e-126,   Method: Composition-based stats.
 Identities = 143/611 (23%), Positives = 274/611 (44%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +   T+  +  +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NTAKTLPDRNEIEESSTWRLEDIFQTDTEWE--KEFQAIKELLPKL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            + ++L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSISEDTLQTFLKENRDLSVYQHALEEITRQRPHVLSEAEEALLAEASEVMSASS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     DR VR+ A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+    N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLI-ESVNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+D++L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLHVLGDEYVDILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHI 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+ +  K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVI-DEEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|196036202|ref|ZP_03103601.1| oligoendopeptidase F [Bacillus cereus W]
 gi|195991177|gb|EDX55146.1| oligoendopeptidase F [Bacillus cereus W]
          Length = 608

 Score =  455 bits (1171), Expect = e-126,   Method: Composition-based stats.
 Identities = 143/611 (23%), Positives = 274/611 (44%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +   T+  +  +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NTAKTLPDRNEIEESSTWRLEDIFQTDTEWE--KEFQAIKELLPKL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            + ++L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     DR VR+ A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+    N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLV-ESVNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+D++L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLNVLGDEYVDILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHI 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+ +  K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 VHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVI-DEEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|298242156|ref|ZP_06965963.1| oligoendopeptidase F [Ktedonobacter racemifer DSM 44963]
 gi|297555210|gb|EFH89074.1| oligoendopeptidase F [Ktedonobacter racemifer DSM 44963]
          Length = 598

 Score =  455 bits (1171), Expect = e-126,   Method: Composition-based stats.
 Identities = 134/609 (22%), Positives = 273/609 (44%), Gaps = 19/609 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           M T  ++  + +  +WNLE +Y +++  E   D + I+          +G LA      +
Sbjct: 1   MQTFKNRNEIPSDFKWNLESIYATNEEWE--QDFKRIQGNVSELAA-LQGTLA-----LS 52

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
             +L   + + + + E++ R+  Y  +  + + ++   +                + +  
Sbjct: 53  GEALLHVLRKRDEVGEVLERLYVYTSMRRDEDTTNSLYQGMADRAMQLYVQVVTAISYIE 112

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            E+  L +  LE+   +      Y   + ++ + + H+ S ++E +L+ + ++       
Sbjct: 113 PELLALPQDTLERYIKEVSGLALYRHQLDDLNRKRPHIRSAEVEAVLAASEEMATSPDTI 172

Query: 204 FFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           F       ++      +      +            DR VRK A + L ++F K  +  +
Sbjct: 173 FSMLENADMKLPKIRNEQGEEVELTQGNYLVFVRSKDRRVRKEAFEGLHNSFLKQRNTIA 232

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
              ++  K +    R R +E        ++N+   V + L+Q+  + +    +RY +L+K
Sbjct: 233 ATLSSQVKSDAFYTRQRNFESTRQRALSAHNIPESVYDNLIQT-VHDHIPLINRYLQLRK 291

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           + LKLD M+ +D   P+    QD + ++ A D+++++ +    +     +K  +  WID 
Sbjct: 292 RVLKLDEMHMYDLYVPIVEEQQDKLTYQEASDIIVEALSPLGKRYISALKKGLSERWIDV 351

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK SGA++ G+  S +P+ILLN+      + TLAHELGH +H   +   Q     +
Sbjct: 352 YETPGKRSGAYSGGS-YSTNPFILLNFQENRDSMFTLAHELGHSLHSYFTRTNQPYQYGD 410

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
            ++ +AE AS   E L  + LL+  S K +R  +L + +ED+  ++ RQ  F +FE ++H
Sbjct: 411 YTIFVAEVASTLNEGLLTNYLLKHTSDKGKRLAILNHALEDLRGTLYRQTMFAEFEKEIH 470

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
                   +    ++ ++ +  ++  G    + DL  G  W  +PHF  S FYVY YA G
Sbjct: 471 KRAGEGEPLTADTLSALYKQLNEKYYGGETFVDDL-IGIEWGRIPHFYSS-FYVYQYATG 528

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
               ++L             ++YLN L +G+S++  +LL    ++++ P    +  Q  E
Sbjct: 529 ISASSALVQKILHEGQPAV-DRYLNFLSSGSSQYSIDLLKNAGVDMTQPEPVHQAFQLFE 587

Query: 618 KMIDDVEKM 626
             +  +E +
Sbjct: 588 SYLSQIEDL 596


>gi|42780388|ref|NP_977635.1| oligoendopeptidase F [Bacillus cereus ATCC 10987]
 gi|42736307|gb|AAS40243.1| oligoendopeptidase F [Bacillus cereus ATCC 10987]
          Length = 608

 Score =  455 bits (1170), Expect = e-125,   Method: Composition-based stats.
 Identities = 145/611 (23%), Positives = 276/611 (45%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +   T+  +  +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NTAKTLPDRNEIEESSTWRLEDIFQTDAEWE--QEFQAIKELLPKL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            + ++L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSISEDTLQTFLKENRELSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     DR VR+ A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+QS  N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLVQS-VNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+D++L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLHVLGDEYVDILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHI 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+ +  K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVI-DEEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|206977677|ref|ZP_03238569.1| oligoendopeptidase F [Bacillus cereus H3081.97]
 gi|217958774|ref|YP_002337322.1| oligoendopeptidase F [Bacillus cereus AH187]
 gi|222094922|ref|YP_002528982.1| oligoendopeptidase f [Bacillus cereus Q1]
 gi|229137985|ref|ZP_04266583.1| Oligoendopeptidase F [Bacillus cereus BDRD-ST26]
 gi|229195494|ref|ZP_04322262.1| Oligoendopeptidase F [Bacillus cereus m1293]
 gi|206744105|gb|EDZ55520.1| oligoendopeptidase F [Bacillus cereus H3081.97]
 gi|217063588|gb|ACJ77838.1| oligoendopeptidase F [Bacillus cereus AH187]
 gi|221238980|gb|ACM11690.1| oligoendopeptidase F [Bacillus cereus Q1]
 gi|228588034|gb|EEK46084.1| Oligoendopeptidase F [Bacillus cereus m1293]
 gi|228645330|gb|EEL01564.1| Oligoendopeptidase F [Bacillus cereus BDRD-ST26]
          Length = 608

 Score =  455 bits (1170), Expect = e-125,   Method: Composition-based stats.
 Identities = 145/611 (23%), Positives = 276/611 (45%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +   T+  +  +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NTAKTLPDRNEIEESSTWRLEDIFQTDAEWE--QEFQAIKELLPKL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            + ++L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     DR VR+ A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+QS  N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLVQS-VNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+D++L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLHVLGDEYVDILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHI 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+ +  K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVI-DEEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|49480009|ref|YP_035433.1| oligoendopeptidase F [Bacillus thuringiensis serovar konkukian str.
           97-27]
 gi|118476772|ref|YP_893923.1| oligopeptidase F [Bacillus thuringiensis str. Al Hakam]
 gi|196037251|ref|ZP_03104562.1| oligoendopeptidase F [Bacillus cereus NVH0597-99]
 gi|196044300|ref|ZP_03111536.1| oligoendopeptidase F [Bacillus cereus 03BB108]
 gi|218902394|ref|YP_002450228.1| oligoendopeptidase F [Bacillus cereus AH820]
 gi|225863148|ref|YP_002748526.1| oligoendopeptidase F [Bacillus cereus 03BB102]
 gi|228932572|ref|ZP_04095452.1| Oligoendopeptidase F [Bacillus thuringiensis serovar andalousiensis
           BGSC 4AW1]
 gi|228944905|ref|ZP_04107267.1| Oligoendopeptidase F [Bacillus thuringiensis serovar monterrey BGSC
           4AJ1]
 gi|229120820|ref|ZP_04250062.1| Oligoendopeptidase F [Bacillus cereus 95/8201]
 gi|229183499|ref|ZP_04310723.1| Oligoendopeptidase F [Bacillus cereus BGSC 6E1]
 gi|49331565|gb|AAT62211.1| oligoendopeptidase F [Bacillus thuringiensis serovar konkukian str.
           97-27]
 gi|118415997|gb|ABK84416.1| oligopeptidase F, Metallo peptidase, MEROPS family M03B [Bacillus
           thuringiensis str. Al Hakam]
 gi|196024939|gb|EDX63610.1| oligoendopeptidase F [Bacillus cereus 03BB108]
 gi|196031493|gb|EDX70089.1| oligoendopeptidase F [Bacillus cereus NVH0597-99]
 gi|218538528|gb|ACK90926.1| oligoendopeptidase F [Bacillus cereus AH820]
 gi|225789118|gb|ACO29335.1| oligoendopeptidase F [Bacillus cereus 03BB102]
 gi|228599909|gb|EEK57505.1| Oligoendopeptidase F [Bacillus cereus BGSC 6E1]
 gi|228662480|gb|EEL18078.1| Oligoendopeptidase F [Bacillus cereus 95/8201]
 gi|228814773|gb|EEM61032.1| Oligoendopeptidase F [Bacillus thuringiensis serovar monterrey BGSC
           4AJ1]
 gi|228827090|gb|EEM72844.1| Oligoendopeptidase F [Bacillus thuringiensis serovar andalousiensis
           BGSC 4AW1]
          Length = 608

 Score =  455 bits (1170), Expect = e-125,   Method: Composition-based stats.
 Identities = 143/611 (23%), Positives = 274/611 (44%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +   T+  +  +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NTAKTLPDRNEIEESSTWRLEDIFQTDTEWE--KEFQAIKELLPKL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            + ++L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     DR VR+ A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+    N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLI-ESVNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+D++L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLHVLGDEYVDILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHI 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+ +  K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVI-DEEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|30261304|ref|NP_843681.1| oligoendopeptidase F [Bacillus anthracis str. Ames]
 gi|47526469|ref|YP_017818.1| oligoendopeptidase F [Bacillus anthracis str. 'Ames Ancestor']
 gi|49184134|ref|YP_027386.1| oligoendopeptidase F [Bacillus anthracis str. Sterne]
 gi|65318570|ref|ZP_00391529.1| COG1164: Oligoendopeptidase F [Bacillus anthracis str. A2012]
 gi|165872833|ref|ZP_02217459.1| oligoendopeptidase F [Bacillus anthracis str. A0488]
 gi|167636107|ref|ZP_02394412.1| oligoendopeptidase F [Bacillus anthracis str. A0442]
 gi|167641208|ref|ZP_02399462.1| oligoendopeptidase F [Bacillus anthracis str. A0193]
 gi|170686705|ref|ZP_02877925.1| oligoendopeptidase F [Bacillus anthracis str. A0465]
 gi|170708892|ref|ZP_02899326.1| oligoendopeptidase F [Bacillus anthracis str. A0389]
 gi|177654403|ref|ZP_02936300.1| oligoendopeptidase F [Bacillus anthracis str. A0174]
 gi|190569134|ref|ZP_03022032.1| oligoendopeptidase F [Bacillus anthracis Tsiankovskii-I]
 gi|227815957|ref|YP_002815966.1| oligoendopeptidase F [Bacillus anthracis str. CDC 684]
 gi|229604019|ref|YP_002865724.1| oligoendopeptidase F [Bacillus anthracis str. A0248]
 gi|254682635|ref|ZP_05146496.1| oligoendopeptidase F [Bacillus anthracis str. CNEVA-9066]
 gi|254734053|ref|ZP_05191767.1| oligoendopeptidase F [Bacillus anthracis str. Western North America
           USA6153]
 gi|254740799|ref|ZP_05198488.1| oligoendopeptidase F [Bacillus anthracis str. Kruger B]
 gi|254753642|ref|ZP_05205678.1| oligoendopeptidase F [Bacillus anthracis str. Vollum]
 gi|254758739|ref|ZP_05210766.1| oligoendopeptidase F [Bacillus anthracis str. Australia 94]
 gi|30255158|gb|AAP25167.1| oligoendopeptidase F [Bacillus anthracis str. Ames]
 gi|47501617|gb|AAT30293.1| oligoendopeptidase F [Bacillus anthracis str. 'Ames Ancestor']
 gi|49178061|gb|AAT53437.1| oligoendopeptidase F [Bacillus anthracis str. Sterne]
 gi|164711410|gb|EDR16961.1| oligoendopeptidase F [Bacillus anthracis str. A0488]
 gi|167510849|gb|EDR86241.1| oligoendopeptidase F [Bacillus anthracis str. A0193]
 gi|167528461|gb|EDR91226.1| oligoendopeptidase F [Bacillus anthracis str. A0442]
 gi|170126208|gb|EDS95101.1| oligoendopeptidase F [Bacillus anthracis str. A0389]
 gi|170669228|gb|EDT19971.1| oligoendopeptidase F [Bacillus anthracis str. A0465]
 gi|172080687|gb|EDT65769.1| oligoendopeptidase F [Bacillus anthracis str. A0174]
 gi|190559717|gb|EDV13704.1| oligoendopeptidase F [Bacillus anthracis Tsiankovskii-I]
 gi|227007763|gb|ACP17506.1| oligoendopeptidase F [Bacillus anthracis str. CDC 684]
 gi|229268427|gb|ACQ50064.1| oligoendopeptidase F [Bacillus anthracis str. A0248]
          Length = 608

 Score =  455 bits (1170), Expect = e-125,   Method: Composition-based stats.
 Identities = 143/611 (23%), Positives = 274/611 (44%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +   T+  +  +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NTAKTLPDRNEIEESSTWRLEDIFQTDTEWE--KEFQAIKELLPKL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            + ++L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSTSS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     DR VR+ A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+    N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLI-ESVNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+D++L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLHVLGDEYVDILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHI 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+ +  K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVI-DEEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|324325314|gb|ADY20574.1| oligoendopeptidase F [Bacillus thuringiensis serovar finitimus
           YBT-020]
          Length = 608

 Score =  455 bits (1170), Expect = e-125,   Method: Composition-based stats.
 Identities = 144/611 (23%), Positives = 277/611 (45%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +   T+  ++ +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NTAKTLPDRKEIEESSTWRLEDIFQTDAEWE--KEFQAIKELLPKL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            + ++L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     DR VR+ A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+QS  N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLVQS-VNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+D++L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLHVLGDEYVDILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHM 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+ +  K+  G +  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTEIYYDLNKKYFGDSLVI-DEEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|228913871|ref|ZP_04077496.1| Oligoendopeptidase F [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
 gi|228845810|gb|EEM90836.1| Oligoendopeptidase F [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
          Length = 608

 Score =  455 bits (1170), Expect = e-125,   Method: Composition-based stats.
 Identities = 143/611 (23%), Positives = 274/611 (44%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +   T+  +  +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NTAKTLPDRNEIEESSTWRLEDIFQTDTEWE--KEFQAIKELLPKL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            + ++L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     DR VR+ A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+    N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLV-ESVNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+D++L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLHVLGDEYVDILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHI 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+ +  K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVI-DEEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|52144137|ref|YP_082691.1| oligoendopeptidase F [Bacillus cereus E33L]
 gi|51977606|gb|AAU19156.1| oligoendopeptidase F [Bacillus cereus E33L]
          Length = 608

 Score =  455 bits (1170), Expect = e-125,   Method: Composition-based stats.
 Identities = 143/611 (23%), Positives = 274/611 (44%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +   T+  +  +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NTAKTLPDRNEIEESSTWRLEDIFQTDTEWE--KEFQAIKELLPKL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            + ++L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     DR VR+ A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+    N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLV-ESVNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+D++L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLNVLGDEYVDILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHI 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+ +  K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVI-DEEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|285808281|gb|ADC35813.1| oligoendopeptidase F [uncultured bacterium 66]
          Length = 623

 Score =  454 bits (1168), Expect = e-125,   Method: Composition-based stats.
 Identities = 146/606 (24%), Positives = 263/606 (43%), Gaps = 19/606 (3%)

Query: 29  SQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG 88
            +  + +  +WNL ++YPS  +   + D   +  E  A +  ++G LA      +   L 
Sbjct: 22  ERSAIADRYKWNLAEIYPSDSAWRTAKD--ELVAELPAIRP-FKGTLAS-----SAQKLA 73

Query: 89  AAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINT 148
            A+    R+ +   R+  YA +  + +      +    ++    A+F     F   EI  
Sbjct: 74  DALELSSRLAKAFTRLYVYASMMSDQDTRVSLYQGMQQEMAQIGANFGAETSFVEPEILK 133

Query: 149 LDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCEN 208
           +D A ++   A +P    YS ++ +I + + H LS+  E LL+++S V       F   +
Sbjct: 134 MDAARVDSFIASEPRLKVYSFYLHDILRRRAHTLSDSEERLLANSSLVANAPSDIFGILS 193

Query: 209 IESLRFKIND----QKIPLTKAYKSFFD--SDREVRKSAAKALSHTFNKSSHIFSFITNT 262
                +        + + L  A  + +    +R  R+    A                N 
Sbjct: 194 NADFPYPSITLSDGKTVKLDNAGFNLYRAVPNRADREKVMSAFFGALGNFRGTLGSTLNG 253

Query: 263 LAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKL 322
             + +    + R YE        + N+   V   L+    N    T HRY  L+K+ + +
Sbjct: 254 QVQSDVFYAKARNYESALARSLDAANIPTTVYTRLI-DGVNRALPTFHRYLNLRKRMMGV 312

Query: 323 DTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDG 382
             ++++D  APL  ++      E A+  V+ +     P  +  A + F   WID     G
Sbjct: 313 SELHYYDLYAPLVASADLTYTAEEAQKHVMAALKPLGPDYAAAALRAFNERWIDLYPSPG 372

Query: 383 KGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTL 442
           K SGA+++G    VHPY+L+NY GK  DV T+AHELGH +   LS++TQ     +  + +
Sbjct: 373 KRSGAYSNGGAYDVHPYMLINYNGKYNDVSTVAHELGHTMQSYLSNKTQPYPLADYPIFV 432

Query: 443 AETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRS 502
           AE AS F E L  D +L+  +    +  LL N +E +  ++ RQ  F +FEL+ H     
Sbjct: 433 AEVASTFNEALLIDHMLKTITDDATKLSLLGNYLEGIKGTVFRQTQFAEFELRAHEMAEK 492

Query: 503 TGDIPTHRINEIWLETQKESLGPA--FDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCL 560
              +    +++++ +  K+  G      + D      W  VPHF   +FYV+ YA     
Sbjct: 493 GEPLTGDALSKLYADITKKYYGHDKKVCIVDDYIQHEWAFVPHFYR-NFYVFQYATSFTA 551

Query: 561 VNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMI 620
            ++L +            +YL  L AG SK+  +LL    ++++        +Q + +++
Sbjct: 552 SSALSEKVL-AGDAAATRRYLTFLSAGGSKYPIDLLKDAGVDMTSDEPLTLTMQKMNRVM 610

Query: 621 DDVEKM 626
           D++EK+
Sbjct: 611 DEMEKL 616


>gi|289578176|ref|YP_003476803.1| oligoendopeptidase F [Thermoanaerobacter italicus Ab9]
 gi|297544456|ref|YP_003676758.1| oligoendopeptidase F [Thermoanaerobacter mathranii subsp. mathranii
           str. A3]
 gi|289527889|gb|ADD02241.1| oligoendopeptidase F [Thermoanaerobacter italicus Ab9]
 gi|296842231|gb|ADH60747.1| oligoendopeptidase F [Thermoanaerobacter mathranii subsp. mathranii
           str. A3]
          Length = 596

 Score =  454 bits (1167), Expect = e-125,   Method: Composition-based stats.
 Identities = 147/609 (24%), Positives = 263/609 (43%), Gaps = 20/609 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           M  +  +  + +  +W LED+Y + +  E   D    +        +++G +  +     
Sbjct: 1   MEILKDRSEIEDKYKWRLEDIYENENLWE--EDYSKTKELLEEVL-KFKGKINTS----- 52

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
              L   +   ++I     +I +YA +  + + ++P  +           +      F A
Sbjct: 53  -RDLLEVLKLNDQIGMTASKIFAYARMRRDEDNTNPKYQALTDKAMRLNIEVMSATSFIA 111

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            EI ++D   L +   +      Y  +++++ + K H+LS + E +L++   +       
Sbjct: 112 PEILSIDTQKLMEMIEELEELKIYKQYLEDLIRFKPHVLSPEEEKILAEAKTLAESVSNI 171

Query: 204 FFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           +   N   +RF     +      +            DR VRK+A  A+  T+ K  + F+
Sbjct: 172 YTMLNNADMRFPTIKDEEGKEVELTHGNFIGFMQSKDRNVRKAAFNAMYDTYKKFINTFA 231

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
                  K +    + RKY    ++    +NV   V   L+    +      HRY  LKK
Sbjct: 232 STMAGNVKKDIFYAKTRKYNSSLEASLFEDNVGVEVYNNLI-ETVHSRLDVLHRYVRLKK 290

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           K L LD ++ +D   PL         +E A +LVL+       +   + ++ F   W+D 
Sbjct: 291 KLLGLDELHMYDLYVPLIQEYDKKFTYEEAIELVLEGLKPLGDEYINLLKQGFNSRWVDV 350

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK SGA++ GT    HPY+LLNY GK  DV T+AHE+GH +H   S+ TQ  +   
Sbjct: 351 YENRGKTSGAYSWGT-YGTHPYVLLNYHGKLSDVFTIAHEMGHSLHTYYSNATQPYVYAG 409

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
             + +AE AS   E +  D LL+ +  ++E+  LL +  E+   ++ RQ+ F +FE  +H
Sbjct: 410 YKIFVAEVASTCNEAILMDYLLKNSKDEKEKLYLLNHFFEEFRGTVYRQVMFAEFEKLIH 469

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
                   +    +N+ + E  K   G    + D      W  +PHF   +FYVY YA G
Sbjct: 470 EMAERGESLTAEVLNKKYYELNKLYYGDDIVV-DEGISYEWARIPHFYR-NFYVYKYATG 527

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                ++  +  +       E+Y   L++G+S +   LL    ++L+ P      L   E
Sbjct: 528 FSAAIAISQMILNEGKKAV-ERYKEFLKSGSSDYPLNLLKRAGVDLTTPKPVNEALDVFE 586

Query: 618 KMIDDVEKM 626
           K++D+ EK+
Sbjct: 587 KLLDEFEKL 595


>gi|229084291|ref|ZP_04216573.1| Oligoendopeptidase F [Bacillus cereus Rock3-44]
 gi|228699002|gb|EEL51705.1| Oligoendopeptidase F [Bacillus cereus Rock3-44]
          Length = 608

 Score =  454 bits (1167), Expect = e-125,   Method: Composition-based stats.
 Identities = 137/611 (22%), Positives = 274/611 (44%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +   T+ ++  +  +  W LED++ + +  E   + + ++         ++G L      
Sbjct: 5   TTAKTLPNRNEIEEMNTWRLEDIFQTDEEWE--KEFQAVKELLPKL-AEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            +  SL  A+   + +   +G++ +YA + Y+ + ++   +          +     + +
Sbjct: 58  -SADSLLEALQYEDEVSMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQASSGMAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI T+ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILTISEETLQSFLQENKELSIYEHALEEITRQRPHVLSEAEEALLAEASEVLSASS 176

Query: 202 KRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F     +      +   +  +     DR VR+ A  A+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPTIKDENGEEVEVTHGRYIQFLESDDRRVREDAFHAVYETYGKYKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+    N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPETVYDQLV-ETVNANLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A++++L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQEMLLKSLNVLGDEYVEILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E +  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEAILNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHI 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + E++ +  K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTELYYDLNKKYFGDALVI-DKEIGIEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|228920017|ref|ZP_04083368.1| Oligoendopeptidase F [Bacillus thuringiensis serovar huazhongensis
           BGSC 4BD1]
 gi|228839642|gb|EEM84932.1| Oligoendopeptidase F [Bacillus thuringiensis serovar huazhongensis
           BGSC 4BD1]
          Length = 608

 Score =  454 bits (1167), Expect = e-125,   Method: Composition-based stats.
 Identities = 143/611 (23%), Positives = 272/611 (44%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +   T+  +  +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NKAKTLPDRNEIEEASTWRLEDIFQTDAEWE--KEFQAIKELLPKL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            +  +L   +   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SADNLLETLQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSGTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSSSS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     DR VR+ A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEIEITHGRYIQFLESDDRRVREDAFKAVYETYGKFKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+    N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLV-ETVNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+DL+L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDLLLKSLNVLGDEYVGILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHT 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+ +  K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVI-DEEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEERLNELEAL 603


>gi|229171942|ref|ZP_04299507.1| Oligoendopeptidase F [Bacillus cereus MM3]
 gi|228611285|gb|EEK68542.1| Oligoendopeptidase F [Bacillus cereus MM3]
          Length = 608

 Score =  454 bits (1167), Expect = e-125,   Method: Composition-based stats.
 Identities = 143/611 (23%), Positives = 274/611 (44%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +   T+ ++  +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NTTKTLPNRSEIEESNTWRLEDIFQTDAEWE--KEFQAIKGLLPKL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            +  +L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SADNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSIAEDTLQTFLTENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     DR VR+ A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+    N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLV-ESVNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+D++L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLNVLGDEYVDILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHI 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+ +  K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVI-DEEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|30019347|ref|NP_830978.1| oligoendopeptidase F [Bacillus cereus ATCC 14579]
 gi|206968398|ref|ZP_03229354.1| oligoendopeptidase F [Bacillus cereus AH1134]
 gi|218232674|ref|YP_002365980.1| oligoendopeptidase F [Bacillus cereus B4264]
 gi|228951677|ref|ZP_04113779.1| Oligoendopeptidase F [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
 gi|229043043|ref|ZP_04190773.1| Oligoendopeptidase F [Bacillus cereus AH676]
 gi|229108757|ref|ZP_04238365.1| Oligoendopeptidase F [Bacillus cereus Rock1-15]
 gi|229126605|ref|ZP_04255618.1| Oligoendopeptidase F [Bacillus cereus BDRD-Cer4]
 gi|229143906|ref|ZP_04272324.1| Oligoendopeptidase F [Bacillus cereus BDRD-ST24]
 gi|229149500|ref|ZP_04277735.1| Oligoendopeptidase F [Bacillus cereus m1550]
 gi|229177711|ref|ZP_04305086.1| Oligoendopeptidase F [Bacillus cereus 172560W]
 gi|229189385|ref|ZP_04316404.1| Oligoendopeptidase F [Bacillus cereus ATCC 10876]
 gi|29894890|gb|AAP08179.1| Oligoendopeptidase F [Bacillus cereus ATCC 14579]
 gi|206737318|gb|EDZ54465.1| oligoendopeptidase F [Bacillus cereus AH1134]
 gi|218160631|gb|ACK60623.1| oligoendopeptidase F [Bacillus cereus B4264]
 gi|228594096|gb|EEK51896.1| Oligoendopeptidase F [Bacillus cereus ATCC 10876]
 gi|228605766|gb|EEK63212.1| Oligoendopeptidase F [Bacillus cereus 172560W]
 gi|228633973|gb|EEK90567.1| Oligoendopeptidase F [Bacillus cereus m1550]
 gi|228639567|gb|EEK95979.1| Oligoendopeptidase F [Bacillus cereus BDRD-ST24]
 gi|228656842|gb|EEL12667.1| Oligoendopeptidase F [Bacillus cereus BDRD-Cer4]
 gi|228674696|gb|EEL29932.1| Oligoendopeptidase F [Bacillus cereus Rock1-15]
 gi|228726284|gb|EEL77511.1| Oligoendopeptidase F [Bacillus cereus AH676]
 gi|228807962|gb|EEM54479.1| Oligoendopeptidase F [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
          Length = 608

 Score =  454 bits (1167), Expect = e-125,   Method: Composition-based stats.
 Identities = 143/611 (23%), Positives = 271/611 (44%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +    +  +  +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NKAKALPDRNEIEEASTWRLEDIFQTDAEWE--KEFQAIKELLPKL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            +  +L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SADNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSSSS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     D  VRK A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEIEITHGRYIQFLESDDPRVRKDAFKAVYETYGKFKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+    N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLV-ETVNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+DL+L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDLLLKSLNVLGDEYVDILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHI 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+ +  K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVI-DEEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|229028967|ref|ZP_04185066.1| Oligoendopeptidase F [Bacillus cereus AH1271]
 gi|228732247|gb|EEL83130.1| Oligoendopeptidase F [Bacillus cereus AH1271]
          Length = 608

 Score =  453 bits (1166), Expect = e-125,   Method: Composition-based stats.
 Identities = 143/611 (23%), Positives = 275/611 (45%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +   T+  ++ +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NTAKTLPDRKEIEESSTWRLEDIFQTDAEWE--KEFQAIKELLPKL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            + ++L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     DR VR+ A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+    N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLV-ESVNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+D++L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLNVLGDEYVDILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLYTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHI 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+ +  K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVI-DEEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|301052839|ref|YP_003791050.1| oligoendopeptidase F [Bacillus anthracis CI]
 gi|300375008|gb|ADK03912.1| oligoendopeptidase F [Bacillus cereus biovar anthracis str. CI]
          Length = 608

 Score =  453 bits (1166), Expect = e-125,   Method: Composition-based stats.
 Identities = 143/611 (23%), Positives = 274/611 (44%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +   T+  +  +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NTAKTLPDRNEIEESSTWRLEDIFQTDTEWE--KEFQGIKELLPKL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            + ++L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     DR VR+ A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+    N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLI-ESVNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+D++L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLHVLGDEYVGILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHI 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+ +  K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTEIYYDLNKKYFGNALVI-DEEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|228996377|ref|ZP_04156019.1| Oligoendopeptidase F [Bacillus mycoides Rock3-17]
 gi|229004040|ref|ZP_04161843.1| Oligoendopeptidase F [Bacillus mycoides Rock1-4]
 gi|228757193|gb|EEM06435.1| Oligoendopeptidase F [Bacillus mycoides Rock1-4]
 gi|228763340|gb|EEM12245.1| Oligoendopeptidase F [Bacillus mycoides Rock3-17]
          Length = 608

 Score =  453 bits (1166), Expect = e-125,   Method: Composition-based stats.
 Identities = 139/609 (22%), Positives = 271/609 (44%), Gaps = 18/609 (2%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
             T+  +  +  +  W LED++ + +  E   + + ++       T ++G L       +
Sbjct: 7   AKTLPDRSEIEEMNTWRLEDVFQTDEEWE--KEFQAVKELLPKL-TEFKGKLGD-----S 58

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
             SL  A+   + +   +G++ +YA + Y+ + ++   +          +     + +  
Sbjct: 59  ADSLLEALQYEDEVSMRLGKLYTYAHMRYDQDTTNSAYQALNDRATNLYSQASSSMAYIV 118

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            EI T+ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   +   
Sbjct: 119 PEILTISEEQLQSFLQENKELSVYEHSLEEITRQRPHVLSEAEEALLAEASEVMSASSNT 178

Query: 204 FFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           F   N   L+F     +      +   +  +     DR VR  A  A+  T+ K  + F+
Sbjct: 179 FGMLNNADLKFPSIKDENGEEVEVTHGRYIQFLESDDRRVRHDAFHAVFETYGKYKNTFA 238

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
              +   K      R RKY+    +   +NN+   V + L+    N      HRY +++K
Sbjct: 239 STLSGAVKRNNFNARVRKYDSARQAALSNNNIPETVYDQLV-ETVNDNLHLLHRYIDIRK 297

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           + L LD ++ +D   PL    +  + +E A++++L+S      +   I ++ + + W+D 
Sbjct: 298 RALGLDELHMYDLYTPLVPEVKMNVKYEEAQEILLKSLNVLGDEYVEILKEAYENRWVDV 357

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  +  +
Sbjct: 358 YENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVYGD 416

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
            S+ +AE AS   E +  D LL+    K+ER  LL + +E    ++ RQ  F +FE  +H
Sbjct: 417 YSIFVAEVASTCNEAILNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHIIH 476

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
            + +    +    + EI+ +  K   G A  + D E G  W  +PHF  + +     A G
Sbjct: 477 KKVQEGHAVTPDMLTEIYYDLNKRYFGDALVI-DKEIGLEWSRIPHFYYNYYVYQY-ATG 534

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                +L            +      L+AG+S +  E+L    ++++ P   +  LQ  E
Sbjct: 535 FSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQVFE 594

Query: 618 KMIDDVEKM 626
           + ++++E +
Sbjct: 595 EKLNELEAL 603


>gi|228984368|ref|ZP_04144547.1| Oligoendopeptidase F [Bacillus thuringiensis serovar tochigiensis
           BGSC 4Y1]
 gi|228775337|gb|EEM23724.1| Oligoendopeptidase F [Bacillus thuringiensis serovar tochigiensis
           BGSC 4Y1]
          Length = 608

 Score =  453 bits (1166), Expect = e-125,   Method: Composition-based stats.
 Identities = 142/611 (23%), Positives = 272/611 (44%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +    +  +  +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NTAKALPDRNEIEESSTWRLEDIFQTDAEWE--KEFQAIKELLPKL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            + ++L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSSSS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     DR VR+ A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+    N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLV-ESVNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+D++L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLHVLGDEYVDILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHM 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+    K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTEIYYNLNKKYFGDALVI-DEEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|311029794|ref|ZP_07707884.1| oligoendopeptidase F [Bacillus sp. m3-13]
          Length = 604

 Score =  453 bits (1165), Expect = e-125,   Method: Composition-based stats.
 Identities = 144/601 (23%), Positives = 269/601 (44%), Gaps = 19/601 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           + +  +  ++++     W LED++ S ++ E   + + ++      K  +EG L+     
Sbjct: 5   TAVKKLQERKDISVEDTWRLEDIFSSDEAWE--KEFQDVKGMIGKIK-DYEGKLS----- 56

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
           ++  SL  A+   + I   +G++ +YA + Y+ + ++   +                L F
Sbjct: 57  ESADSLFEALQYQDSISSRLGKLYTYAHMRYDQDTTNSFYQGLNDRATNLYTQVASALSF 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI T+ E  + +   ++     Y   +  I + + H+LS   E LL++ S+V   + 
Sbjct: 117 VVPEILTMKEEDITKFLQENKELALYEHSLDEINRQRPHVLSAKEEALLAEASEVLSASS 176

Query: 202 KRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   + F     +      I   +  +     D+EVRK+A KA+  T+    + 
Sbjct: 177 NTFGMLNNADITFPSVKDENGEEIEITHGRYIRFLESEDQEVRKNAFKAVYETYGGYRNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           FS       K +  Q + R Y+    +   +NN+   V + L+ ++        HRY +L
Sbjct: 237 FSSTLGGAVKKDNFQAKVRNYDSARQAALSNNNIPETVYDNLVNTINKN-LHLLHRYVDL 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +KK L ++ ++ +D   PL   +   + +E A+D +L+  A    +   I ++ F + W+
Sbjct: 296 RKKVLGVEELHMYDLYTPLIKEANMKVSYEEAKDYLLKGLAPLGQEYLDIVKEGFDNRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ GT    +PYIL+N+     ++ TLAHE GH +H   + +TQ    
Sbjct: 356 DVQENKGKRSGAYSSGT-YGTNPYILMNWQDNVNNLFTLAHEFGHSVHSYYTRKTQPYPY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            N S+ +AE AS   E L  D LL+     ++R  LL + +E    ++ RQ  F +FE K
Sbjct: 415 GNYSIFVAEVASTCNEALLNDYLLKTVDDDKKRLYLLNHYLEGFRGTVFRQTMFAEFEHK 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H   ++   +    + E + E  K+  G    + D E G  W  +PHF  + +     A
Sbjct: 475 IHELAQNGEALTADLLTETYYELNKKYFGENITI-DEEIGLEWARIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L             ++YL  L+AG+S +  E+L    ++++  N  E   + 
Sbjct: 533 TGYSAATALSKQILEEGQPAV-DRYLEFLKAGSSDYPIEVLKKAGVDMTQSNPIEEACKV 591

Query: 616 V 616
            
Sbjct: 592 F 592


>gi|229095781|ref|ZP_04226760.1| Oligoendopeptidase F [Bacillus cereus Rock3-29]
 gi|229114732|ref|ZP_04244146.1| Oligoendopeptidase F [Bacillus cereus Rock1-3]
 gi|228668797|gb|EEL24225.1| Oligoendopeptidase F [Bacillus cereus Rock1-3]
 gi|228687614|gb|EEL41513.1| Oligoendopeptidase F [Bacillus cereus Rock3-29]
          Length = 608

 Score =  453 bits (1165), Expect = e-125,   Method: Composition-based stats.
 Identities = 143/611 (23%), Positives = 275/611 (45%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +   T+  +  +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NKAKTLPDRNEIEEASTWRLEDIFQTDAEWE--KEFQAIKELLPQL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            + ++L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSISEDTLQAFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSSSS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     DR VR+ A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEIEITHGRYIQFLESDDRRVREDAFKAVFETYGKFKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+    N +    HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARIRKYDSARQAALSNNNIPEAVYDQLV-ETVNDHLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+D++L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVQEVKMNVKYEEAQDMLLKSLNVLGDEYVEILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHI 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+ +  K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVI-DEEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|312112859|ref|YP_004010455.1| oligoendopeptidase, pepF/M3 family [Rhodomicrobium vannielii ATCC
           17100]
 gi|311217988|gb|ADP69356.1| oligoendopeptidase, pepF/M3 family [Rhodomicrobium vannielii ATCC
           17100]
          Length = 619

 Score =  453 bits (1164), Expect = e-125,   Method: Composition-based stats.
 Identities = 257/593 (43%), Positives = 385/593 (64%), Gaps = 8/593 (1%)

Query: 34  GNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAE 93
             +P WNL DLYP  D  ++++D+E  +  +  FK  + G LA    + +   L  A+A 
Sbjct: 31  EEIPGWNLGDLYP--DEAKLASDIETAKARAGEFKAAYAGKLADLAER-DPAGLAGALAA 87

Query: 94  YERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEAL 153
           YE I +L+GR+ SY+ L+Y  +   P   K + D+  KL      L+FF LE+N +D+A+
Sbjct: 88  YEGISDLMGRVGSYSYLNYVTDTGDPARAKLFGDVRDKLTVIGTELLFFELELNRIDDAV 147

Query: 154 LEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLR 213
           ++++ A D     Y  W+ ++RK + + L++D+E L  + +  G  A  R F E + SLR
Sbjct: 148 MDKAIANDK-LGHYRPWLTDLRKERPYQLADDIERLFHEKAMTGPAAWSRLFNETLTSLR 206

Query: 214 FKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRW 273
           F ++ + + L  A     D++   R +AA+++     ++  +F+ + NTLAKD+EI DRW
Sbjct: 207 FDVDGEILTLEPALNLLSDANPVRRAAAAQSIGKVLKENVRLFTLVMNTLAKDKEISDRW 266

Query: 274 RKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAP 333
           R +  +A SRHL+N VEP V++AL+++V+  YP+ SHRYY LK KWL +DT+ +WDR AP
Sbjct: 267 RGFPDVASSRHLANRVEPEVVDALVEAVRASYPRLSHRYYALKAKWLGVDTLNYWDRNAP 326

Query: 334 LPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTI 393
           +    + +I ++ A   V+ +Y +FSP+M+ +A+ FF  NWIDAP  DGK  GAF+H T+
Sbjct: 327 ISRDPEPVIAWKDAHSTVIAAYHRFSPKMAEVADGFFKKNWIDAPVRDGKSPGAFSHPTV 386

Query: 394 PSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETL 453
           PS HPYI++NYLGKP+DVMTLAHELGHG+H VL+   QG L   + LTLAETAS+FGE L
Sbjct: 387 PSAHPYIMMNYLGKPRDVMTLAHELGHGVHQVLA-NAQGALMAYTPLTLAETASVFGEML 445

Query: 454 TFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINE 513
           TF +LL    +  E++ LLA K+ED +N++VRQI+FY FE  +H  RR    + + ++  
Sbjct: 446 TFKALLNQTENPREKRALLAQKVEDKINTVVRQIAFYQFERLVHEARRQGE-LTSDQLGA 504

Query: 514 IWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTV 573
            WL+ Q ESLGPA  +++  Y ++W  V HF+ S FYVYAYAFG+CLVNSLY  Y+    
Sbjct: 505 FWLQVQTESLGPAIIMNE-GYDTYWTYVSHFVHSPFYVYAYAFGDCLVNSLYAAYERAP- 562

Query: 574 DCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           + F+ +YL++LRAG +KH++ELL P  ++ +DP FW  GL  +E MI ++E +
Sbjct: 563 EGFEGRYLDMLRAGGTKHHTELLAPFGLDATDPGFWSMGLSVIEDMISELETL 615


>gi|47568400|ref|ZP_00239101.1| oligoendopeptidase F [Bacillus cereus G9241]
 gi|47554948|gb|EAL13298.1| oligoendopeptidase F [Bacillus cereus G9241]
          Length = 608

 Score =  453 bits (1164), Expect = e-125,   Method: Composition-based stats.
 Identities = 142/611 (23%), Positives = 272/611 (44%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +    +  +  +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NTAKALPDRNEIEESSTWRLEDIFQTDAEWE--KEFQAIKELLPKL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            + ++L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     DR VR+ A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+    N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLV-ESVNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+D++L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLHVLGDEYVDILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHM 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+    K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTEIYYNLNKKYFGDALVI-DEEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|229068852|ref|ZP_04202147.1| Oligoendopeptidase F [Bacillus cereus F65185]
 gi|229078491|ref|ZP_04211051.1| Oligoendopeptidase F [Bacillus cereus Rock4-2]
 gi|228704807|gb|EEL57233.1| Oligoendopeptidase F [Bacillus cereus Rock4-2]
 gi|228714270|gb|EEL66150.1| Oligoendopeptidase F [Bacillus cereus F65185]
          Length = 608

 Score =  453 bits (1164), Expect = e-125,   Method: Composition-based stats.
 Identities = 143/611 (23%), Positives = 273/611 (44%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           + +  +  +  +     W LED++ +    E   + + I+       T ++G L+     
Sbjct: 5   NKVKALPDRNEIEEASTWRLEDIFQTDAEWE--KEFQAIKELLPKL-TEFKGKLSD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            +  +L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SADNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSSSS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     D  VRK A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEIEITHGRYIQFLESDDPRVRKDAFKAVYETYGKFKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+    N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLV-ETVNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+DL+L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDLLLKSLNVLGDEYVDILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHI 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+ +  K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVI-DEEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|228964243|ref|ZP_04125363.1| Oligoendopeptidase F [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|228795438|gb|EEM42925.1| Oligoendopeptidase F [Bacillus thuringiensis serovar sotto str.
           T04001]
          Length = 608

 Score =  453 bits (1164), Expect = e-125,   Method: Composition-based stats.
 Identities = 143/611 (23%), Positives = 272/611 (44%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +   T+  +  +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NKAKTLPDRNEIEEASTWRLEDIFQTDAEWE--KEFQAIKELLPKL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            +  +L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SADNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSVSEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSSSS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     D  VR+ A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEIEITHGRYIQFLESDDPRVREDAFKAVYETYGKFKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+    N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLV-ETVNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+DL+L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDLLLKSLNVLGDEYVDILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHI 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+ +  K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVI-DEEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|229101879|ref|ZP_04232593.1| Oligoendopeptidase F [Bacillus cereus Rock3-28]
 gi|228681462|gb|EEL35625.1| Oligoendopeptidase F [Bacillus cereus Rock3-28]
          Length = 608

 Score =  453 bits (1164), Expect = e-125,   Method: Composition-based stats.
 Identities = 143/611 (23%), Positives = 275/611 (45%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +   T+  +  +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NKTKTLPDRNEIEEASTWRLEDIFQTDAEWE--KEFQAIKELLPQL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            + ++L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSISEDTLQAFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSSSS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     DR VR+ A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEIEITHGRYIQFLESDDRRVREDAFKAVFETYGKFKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+    N +    HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARIRKYDSARQAALSNNNIPEAVYDQLV-ETVNDHLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+D++L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVQEVKMNVKYEEAQDMLLKSLNVLGDEYVEILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHI 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+ +  K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVI-DEEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|285808492|gb|ADC36016.1| oligoendopeptidase F [uncultured bacterium 259]
          Length = 641

 Score =  453 bits (1164), Expect = e-125,   Method: Composition-based stats.
 Identities = 151/607 (24%), Positives = 272/607 (44%), Gaps = 19/607 (3%)

Query: 28  DSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSL 87
             +  + +  +WNL DLY S ++   + D   +  E       ++G LA      +   L
Sbjct: 42  RDRAKIDDKFKWNLTDLYASDEAWRSAKD--ELVPEIAK-AAAFKGTLAT-----SPAKL 93

Query: 88  GAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEIN 147
             A+    R+ + + R   YA L  + +      +    ++    A F + + +   EI 
Sbjct: 94  AEALDTVNRLGKELQRAYLYASLISDQDTRVSKYQGMQQEMQQLGAKFGEAIAYIEPEIL 153

Query: 148 TLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCE 207
            +D+A L+   AQ+P    Y  ++ ++++ + H LS++ E LL+ +S V       +   
Sbjct: 154 KIDKATLDTWAAQEPKLKIYRHYLDDLQRRRPHTLSDNEERLLAASSVVTATGSSVYNIL 213

Query: 208 NIESLRFKI----NDQKIPLTKAYKSFFD--SDREVRKSAAKALSHTFNKSSHIFSFITN 261
           +     +      + + + L  +  S +    +RE RK    A  +T       F    N
Sbjct: 214 SNADFPYPSVTLSDGKTVKLDASAFSLYRGVPNREDRKKVMAAFFNTLGDYKGTFGATLN 273

Query: 262 TLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLK 321
              +  E     R Y+   ++   + N+   V  +L+    N    T  RY +L+KK + 
Sbjct: 274 GQVQANEFYANARHYKTALEAALDAPNIPAAVYTSLV-DGVNQGLPTFQRYLQLRKKMMN 332

Query: 322 LDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYD 381
           L  ++++D  APL  ++      E A+  VL + A   P      ++ FT  WID    +
Sbjct: 333 LPDLHYYDLYAPLVASADLSYTPEEAQSNVLAALAPLGPDYIAAVKRAFTERWIDLLPTE 392

Query: 382 GKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLT 441
           GK SGA+++G    VHPY+L+N+ GK  D+ T AHELGH +   LS++ Q     N    
Sbjct: 393 GKKSGAYSNGAGYDVHPYMLINFNGKYADMSTEAHELGHTMQSYLSNKAQPFPLANYPTF 452

Query: 442 LAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERR 501
           +AE AS F E L  + +L+       R  LL N +E++  ++ RQ  F +FEL++H    
Sbjct: 453 VAEVASTFNEALLIEHMLKTIKDDNTRLSLLGNYLENIKGTVFRQTQFAEFELRIHQAAE 512

Query: 502 STGDIPTHRINEIWLETQKESLG--PAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNC 559
               I    +++++L+  ++  G      + D      W  +PHF    FYV+ YA    
Sbjct: 513 RGQPITGETLDQLYLDIVRKYYGHDKGVCVVDDYVAHEWAFIPHFYL-DFYVFQYATSFT 571

Query: 560 LVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKM 619
              +L +           ++YL  L AG SK+  ELL    ++++     +  +Q + ++
Sbjct: 572 ASAALSEKVL-AGDPAATKRYLAFLSAGGSKYPIELLKDAGVDMTTNEPLQLTVQKMNRI 630

Query: 620 IDDVEKM 626
           +D++EK+
Sbjct: 631 MDEMEKL 637


>gi|229160254|ref|ZP_04288253.1| Oligoendopeptidase F [Bacillus cereus R309803]
 gi|228623215|gb|EEK80042.1| Oligoendopeptidase F [Bacillus cereus R309803]
          Length = 608

 Score =  453 bits (1164), Expect = e-125,   Method: Composition-based stats.
 Identities = 146/611 (23%), Positives = 274/611 (44%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +   T+  +  +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NKAKTLPDRNEIEEANTWRLEDIFQTDAEWE--KEFQAIKELLPKL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            + ++L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI T+ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILTISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     DR VR+ A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEIEITHGRYIQFLESDDRRVREDAFKAVYETYGKFKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           FS   +   K      R RKY+    +   +NN+   V + L+    N      HRY ++
Sbjct: 237 FSSTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLV-ETVNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+DL+L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDLLLKSLNVLGDEYVEILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHI 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+ +  K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVI-DEEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKRAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|296501888|ref|YP_003663588.1| oligoendopeptidase F [Bacillus thuringiensis BMB171]
 gi|296322940|gb|ADH05868.1| oligoendopeptidase F [Bacillus thuringiensis BMB171]
          Length = 608

 Score =  453 bits (1164), Expect = e-125,   Method: Composition-based stats.
 Identities = 143/611 (23%), Positives = 271/611 (44%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +    +  +  +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NKAKALPDRNEIEEASTWRLEDIFQTDAEWE--KEFQAIKELLPKL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            +  +L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SADNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSSSS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     D  VRK A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEIEITHGRYIQFLESDDSRVRKDAFKAVYETYGKFKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+    N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLV-ETVNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+DL+L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDLLLKSLNVLGDEYVDILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHI 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+ +  K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVI-DEEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|329929407|ref|ZP_08283155.1| oligoendopeptidase F [Paenibacillus sp. HGF5]
 gi|328936494|gb|EGG32939.1| oligoendopeptidase F [Paenibacillus sp. HGF5]
          Length = 639

 Score =  452 bits (1163), Expect = e-125,   Method: Composition-based stats.
 Identities = 142/617 (23%), Positives = 255/617 (41%), Gaps = 21/617 (3%)

Query: 16  RKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNL 75
               R   M  +  + ++    +W LEDL+    +         +++        ++G L
Sbjct: 36  PYHSRRISMEQLLKRADVPKEHQWKLEDLFADQKAW--DASFAELKNLLKR-AADYQGKL 92

Query: 76  AHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADF 135
                  N  S+       + I     R+  YA + ++ + ++PT +           + 
Sbjct: 93  N------NAASIKECFELEDEISYHAERLYVYAHMHHDEDTANPTYQALTAKAKKLNVEA 146

Query: 136 EKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQ 195
            + L F   EI +L EA L++   +DP   ++   +  +++ K H+LS   E LL+    
Sbjct: 147 GEALSFITPEILSLSEAELDKLI-EDPSLKEFKFTLTEMKREKAHVLSKTEEALLAQVGN 205

Query: 196 VGREALKRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTF 249
           +       F   N   ++F     +      +      +     +REVR+ A KA+  T+
Sbjct: 206 LSSAPQTIFGMLNNADMKFPRIKNEDGKDVELTHGNYIQFLESPNREVRERAFKAVYETY 265

Query: 250 NKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTS 309
            K  +  +   N          R RKY  + +     +N+   V   L+ ++        
Sbjct: 266 GKQKNTIAATLNANVNKNMFYSRVRKYPSVLEMALYGDNIPKEVYTNLIDTIHES-LPLL 324

Query: 310 HRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKF 369
           HRY EL+KK L +D ++ +D  APL    +  I +E A+ +  +             ++ 
Sbjct: 325 HRYMELRKKLLGVDELHMYDLFAPLVEEYKWDITYEEAKQMTKEGLTPLGDDYLSSLQEG 384

Query: 370 FTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSE 429
           + + WID  + + K +GA++ G     HPY+LLN+      + TLAHE+GH +H   S  
Sbjct: 385 YDNGWIDVYENENKRTGAYSWG-AYGTHPYVLLNHKDNLNSMFTLAHEMGHALHSYYSDN 443

Query: 430 TQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISF 489
                    ++ LAE AS   E L  D LL+ A   +++  LL    +    ++ RQ  F
Sbjct: 444 ALKYRDAQYTIFLAEVASTTNEALLMDYLLKNAKDPKQKMYLLTYYADQFRTTVFRQTMF 503

Query: 490 YDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSF 549
            +FE  +H    S   +    +++I+ E   +  G    + D E G  W  +PHF  S F
Sbjct: 504 AEFEKIVHERVESGESLTPQDLSDIYYELNVKYHGKGMQV-DKEIGMEWARIPHFYNS-F 561

Query: 550 YVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFW 609
           YVY YA G     S              ++YL  L++G S +   +L    +++S P   
Sbjct: 562 YVYKYATGFSAATSFSKQILEEGQPAV-DRYLGFLKSGGSDYSINILKKAGVDMSSPEPI 620

Query: 610 ERGLQTVEKMIDDVEKM 626
              +   E +I+ +E++
Sbjct: 621 REAMSVFEDVINQMEQL 637


>gi|322384218|ref|ZP_08057928.1| oligoendopeptidase F-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321151110|gb|EFX44427.1| oligoendopeptidase F-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 596

 Score =  452 bits (1163), Expect = e-125,   Method: Composition-based stats.
 Identities = 139/609 (22%), Positives = 266/609 (43%), Gaps = 21/609 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           M+ + +++++    +W LEDL+    +     +   ++         + G L       N
Sbjct: 1   MSQIPARKDVPEQEKWKLEDLFADQKAW--DKEFNEVKQLLKK-VDDFHGKLN------N 51

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
            +++       ++I     R+  YA + ++ + + PT +           +  + L F +
Sbjct: 52  DNAIKQCFELEDKISLHTERLYVYAKMKHDEDAADPTYQALSEKARKLSVEVNQALSFIS 111

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            EI +L E  L    +  P    Y   ++ + + K H+LS   E LL+ T  +   A   
Sbjct: 112 PEILSLSEDQLRSFISH-PDLSLYKRTLEELLREKPHVLSKSEETLLAMTGNMAGSASNI 170

Query: 204 FFCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           F   N   ++F           ++      +   + DREVRK A +A+  T+    +  +
Sbjct: 171 FGMINNVDIQFPKIKNEKGEEVQLTHGSYIQFLENPDREVRKRAFQAVYETYRNQRNTIA 230

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
              +          R RKY  + +    ++N++P V   L+ ++ +      HRY++L+K
Sbjct: 231 ATLSANVNKNIFYARARKYPSVLEMSLHADNIDPSVYTNLISTIHDS-LPVLHRYFKLRK 289

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           K LK+D ++ +D  APL    +  I ++ A++ ++++      +   I ++ F + WID 
Sbjct: 290 KLLKVDELHMYDLFAPLVEEFKMDITYKQAQEKIIEALRPLGGKYIDILKEGFENRWIDV 349

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +   K SGA++ G     HPY+LLN+      + TLAHE+GH +H  LS   Q      
Sbjct: 350 HENKNKRSGAYSWG-AYGTHPYVLLNHKDNLNSMFTLAHEMGHAMHSYLSDANQEYRNAQ 408

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
            ++ LAE AS   E L  D +L+  +  +E+  LL    +    ++ RQ  F +FE  +H
Sbjct: 409 YTIFLAEVASTLNEALLMDYMLKHTTDPKEKLYLLTYYADQFRTTVFRQTMFAEFEKIVH 468

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
            +      +     ++++ +  K   G    + D +    W  +PHF  S FYVY YA G
Sbjct: 469 EKAEKGESLTPQEFSKVYYDLNKLYHGNDMVV-DQDIEMEWARIPHFYNS-FYVYKYATG 526

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                S              E+YL  L++G S     +L    +++S P   ++ +   +
Sbjct: 527 FSAATSFASQILEKGEPAV-ERYLGFLKSGGSDFSINILKKAGVDMSSPEPIKQSMDVFK 585

Query: 618 KMIDDVEKM 626
            +++ +E++
Sbjct: 586 SVVEQMEQL 594


>gi|228990280|ref|ZP_04150247.1| Oligoendopeptidase F [Bacillus pseudomycoides DSM 12442]
 gi|228769447|gb|EEM18043.1| Oligoendopeptidase F [Bacillus pseudomycoides DSM 12442]
          Length = 608

 Score =  452 bits (1162), Expect = e-125,   Method: Composition-based stats.
 Identities = 140/609 (22%), Positives = 272/609 (44%), Gaps = 18/609 (2%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
             T+  +  +  +  W LED++ + +  E   + + ++       T ++G L       +
Sbjct: 7   AKTLPDRSEIEEMNTWRLEDVFQTDEEWE--KEFQAVKELLPKL-TEFKGKLGD-----S 58

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
             SL AA+   + +   +G++ +YA + Y+ + ++   +          +     + +  
Sbjct: 59  ADSLLAALQYEDEVSMRLGKLYTYAHMRYDQDTTNSAYQALNDRATNLYSQASSSMAYIV 118

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            EI T+ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   +   
Sbjct: 119 PEILTISEEQLQSFLQENKELSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASSNT 178

Query: 204 FFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           F   N   L+F     +      +   +  +     DR VR  A  A+  T+ K  + F+
Sbjct: 179 FGMLNNADLKFPSIKDENGEEVEVTHGRYIQFLESDDRRVRHDAFHAVFETYGKYKNTFA 238

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
              +   K      R RKY+    +   +NN+   V + L+    N      HRY +++K
Sbjct: 239 STLSGAVKRNNFNARVRKYDSARQAALSNNNIPETVYDQLV-ETVNDNLHLLHRYIDIRK 297

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           + L LD ++ +D   PL    +  + +E A++++L+S      +   I ++ + + W+D 
Sbjct: 298 RALGLDELHMYDLYTPLVPEVKMNVKYEEAQEILLKSLNVLGDEYVEILKEAYENRWVDV 357

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  +  +
Sbjct: 358 YENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVYGD 416

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
            S+ +AE AS   E +  D LL+    K+ER  LL + +E    ++ RQ  F +FE  +H
Sbjct: 417 YSIFVAEVASTCNEAILNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHIIH 476

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
            + +    +    + EI+ +  K   G A  + D E G  W  +PHF  + +     A G
Sbjct: 477 KKVQEGHAVTPDMLTEIYYDLNKRYFGDALVI-DKEIGLEWSRIPHFYYNYYVYQY-ATG 534

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                +L            +      L+AG+S +  E+L    ++++ P   +  LQ  E
Sbjct: 535 FSAATALSKQILEEGQPAVERYTNEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQVFE 594

Query: 618 KMIDDVEKM 626
           + ++++E +
Sbjct: 595 EKLNELEAL 603


>gi|229016549|ref|ZP_04173489.1| Oligoendopeptidase F [Bacillus cereus AH1273]
 gi|229022756|ref|ZP_04179280.1| Oligoendopeptidase F [Bacillus cereus AH1272]
 gi|228738568|gb|EEL89040.1| Oligoendopeptidase F [Bacillus cereus AH1272]
 gi|228744725|gb|EEL94787.1| Oligoendopeptidase F [Bacillus cereus AH1273]
          Length = 608

 Score =  452 bits (1162), Expect = e-125,   Method: Composition-based stats.
 Identities = 142/611 (23%), Positives = 273/611 (44%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           + + ++  +  +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NTVKSLPDRNEIEEANTWRLEDIFQTDAEWE--KEFQAIKELLPKL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            +  +L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SADNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI  + E  L+    Q+     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILAISEDTLQTFLQQNRELSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     DR VR+ A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+    N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLV-ESVNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A++++L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQEMLLKSLNVLGDEYVEILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHI 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+ +  K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVI-DEEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|163939095|ref|YP_001643979.1| oligoendopeptidase F [Bacillus weihenstephanensis KBAB4]
 gi|163861292|gb|ABY42351.1| oligoendopeptidase F [Bacillus weihenstephanensis KBAB4]
          Length = 608

 Score =  452 bits (1162), Expect = e-125,   Method: Composition-based stats.
 Identities = 144/611 (23%), Positives = 273/611 (44%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +   T+  +  +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NKAKTLPDRNEIEEASTWRLEDIFQTDAEWE--KEFQAIKELLPKL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            +  +L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SADNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSISEDTLQTFLQENRELSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     DR VR+ A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVFETYGKFKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+    N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARIRKYDSARQAALSNNNIPEAVYDQLV-ETVNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+DL+L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVQEVKMNVTYEEAQDLLLKSLNVLGDEYVEILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLYTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHI 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+ +  K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVI-DKEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|75761255|ref|ZP_00741238.1| Oligoendopeptidase F [Bacillus thuringiensis serovar israelensis
           ATCC 35646]
 gi|218896231|ref|YP_002444642.1| oligoendopeptidase F [Bacillus cereus G9842]
 gi|228899877|ref|ZP_04064122.1| Oligoendopeptidase F [Bacillus thuringiensis IBL 4222]
 gi|74491263|gb|EAO54496.1| Oligoendopeptidase F [Bacillus thuringiensis serovar israelensis
           ATCC 35646]
 gi|218540871|gb|ACK93265.1| oligoendopeptidase F [Bacillus cereus G9842]
 gi|228859781|gb|EEN04196.1| Oligoendopeptidase F [Bacillus thuringiensis IBL 4222]
          Length = 608

 Score =  452 bits (1162), Expect = e-124,   Method: Composition-based stats.
 Identities = 143/611 (23%), Positives = 272/611 (44%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +   T+  +  +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NKAKTLPDRNEIEEASTWRLEDIFQTDAEWE--KEFQAIKELLPKL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            +  +L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SADNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSVSEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSSSS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     D  VR+ A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEIEITHGRYIQFLESDDGRVREDAFKAVYETYGKFKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+    N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLV-ETVNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+DL+L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDLLLKSLNVLGDEYVDILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHI 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+ +  K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVI-DEEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|228938413|ref|ZP_04101023.1| Oligoendopeptidase F [Bacillus thuringiensis serovar berliner ATCC
           10792]
 gi|228971292|ref|ZP_04131920.1| Oligoendopeptidase F [Bacillus thuringiensis serovar thuringiensis
           str. T01001]
 gi|228977903|ref|ZP_04138284.1| Oligoendopeptidase F [Bacillus thuringiensis Bt407]
 gi|228781820|gb|EEM30017.1| Oligoendopeptidase F [Bacillus thuringiensis Bt407]
 gi|228788442|gb|EEM36393.1| Oligoendopeptidase F [Bacillus thuringiensis serovar thuringiensis
           str. T01001]
 gi|228821275|gb|EEM67290.1| Oligoendopeptidase F [Bacillus thuringiensis serovar berliner ATCC
           10792]
 gi|326938922|gb|AEA14818.1| oligoendopeptidase F [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 608

 Score =  451 bits (1161), Expect = e-124,   Method: Composition-based stats.
 Identities = 140/611 (22%), Positives = 271/611 (44%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +    +  +  +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NKAKALPDRNEIEEASTWRLEDIFQTDAEWE--KEFQAIKELLPKL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            +  +L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SADNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  ++    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSISEDTMQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSSSS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     +  VR+ A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEIEITHGRYIQFLESDNPRVREDAFKAVYETYGKFKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+    N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLV-ETVNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+DL+L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDLLLKSLNVLGDEYVDILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHI 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+ +  K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVI-DEEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|20807490|ref|NP_622661.1| oligoendopeptidase F [Thermoanaerobacter tengcongensis MB4]
 gi|20516018|gb|AAM24265.1| Oligoendopeptidase F [Thermoanaerobacter tengcongensis MB4]
          Length = 596

 Score =  451 bits (1161), Expect = e-124,   Method: Composition-based stats.
 Identities = 149/609 (24%), Positives = 263/609 (43%), Gaps = 20/609 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           M  +  +  +    +W LED+Y + +  E   D   ++        +++G +  +     
Sbjct: 1   MGNLRERSEIDERYKWRLEDIYENEELWE--EDYRKVKELLKEIV-KFKGKIRTS----- 52

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
              L   +   ++I     +I +YA +  + + ++   +           +      F  
Sbjct: 53  -KDLLEVLKLNDQIGMTASKIFAYARMRRDEDNTNSKYQALSDKAMRLNIEVMSATSFIV 111

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            EI +++   L     +      Y  +I+++ + K H+LS + E +L++   +       
Sbjct: 112 PEILSIETEKLRNMIEELEELKIYKQYIEDLIRYKPHVLSPEEEKILAEAETLAESVSTI 171

Query: 204 FFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           +   N   LRF     +      +            DR VRK+A +AL  T+ K  + F+
Sbjct: 172 YSMLNHADLRFPTIKDENGNEVELTHGNFISFMQSKDRNVRKAAFEALYDTYKKFINTFA 231

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
                  K +    + R+Y    ++    +NV   V   L+    +      HRY  LKK
Sbjct: 232 STLAGSVKKDIFYAKARRYNSSLEASLFEDNVSVEVYNNLI-ETVHSRLDVLHRYVRLKK 290

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           K LKLD +Y +D   PL         +E A +LVL+       +   + +K F   W+D 
Sbjct: 291 KLLKLDELYMYDLYVPLIQEYDKEFTYEEAIELVLEGLKPLGEEYIDLLKKGFESRWVDV 350

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK SGA++ G     HPY+LLN+ GK  DV T+AHE+GH +H   S+ TQ  +   
Sbjct: 351 YENRGKTSGAYSWG-AYGTHPYVLLNFQGKLNDVFTIAHEMGHSLHTYYSNATQPYVYAG 409

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
             + +AE AS   E +  D LL+ +  ++ER  +L + +E+   ++ RQ+ F +FE  +H
Sbjct: 410 YKIFVAEVASTCNEAILMDYLLKNSKDEKERLYVLNHFLEEFRGTVFRQVMFAEFEKLIH 469

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
                   +    +N+ + E  K   G    + D E    W  +PHF   +FYVY YA G
Sbjct: 470 EMAERGEPLTAEVLNKKYYELNKLYYGDDIVV-DEEISYEWARIPHFYR-NFYVYKYATG 527

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                ++  +  +       E+Y   L++G+S +   LL    ++L+ P      L   E
Sbjct: 528 FSAAIAISQMILNEGEKAV-ERYKEFLKSGSSDYPLNLLKKAGVDLTTPKPVNDALDVFE 586

Query: 618 KMIDDVEKM 626
           K++D+ EKM
Sbjct: 587 KLLDEFEKM 595


>gi|228906930|ref|ZP_04070797.1| Oligoendopeptidase F [Bacillus thuringiensis IBL 200]
 gi|228852678|gb|EEM97465.1| Oligoendopeptidase F [Bacillus thuringiensis IBL 200]
          Length = 608

 Score =  451 bits (1161), Expect = e-124,   Method: Composition-based stats.
 Identities = 142/611 (23%), Positives = 271/611 (44%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +   T+  +  +     W LED++ +    E   + + I+         ++G L      
Sbjct: 5   NKAKTLPDRNEIEEASTWRLEDIFQTDAEWE--KEFQAIKELLPKLIE-FKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            +  +L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SADNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSVSEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSSSS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     D  VR+ A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEIEITHGRYIQFLESDDGRVREDAFKAVYETYGKFKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+    N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLV-ETVNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+DL+L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDLLLKSLNVLGDEYVDILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHI 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+ +  K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVI-DEEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|229166137|ref|ZP_04293898.1| Oligoendopeptidase F [Bacillus cereus AH621]
 gi|228617359|gb|EEK74423.1| Oligoendopeptidase F [Bacillus cereus AH621]
          Length = 608

 Score =  451 bits (1161), Expect = e-124,   Method: Composition-based stats.
 Identities = 144/611 (23%), Positives = 274/611 (44%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +   T+ ++  +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NKAKTLPNRNEIEEASTWRLEDIFQTDAEWE--KEFQAIKELLPKL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            +  +L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SADNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSISEDTLQTFLQENRELSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     DR VR+ A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVFETYGKFKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+    N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARIRKYDSARQAALSNNNIPEAVYDQLV-ETVNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+DL+L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVQEVKMNVKYEEAQDLLLKSLNVLGDEYVEILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLYTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHI 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+ +  K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVI-DKEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|89098113|ref|ZP_01170999.1| Oligoendopeptidase F [Bacillus sp. NRRL B-14911]
 gi|89087276|gb|EAR66391.1| Oligoendopeptidase F [Bacillus sp. NRRL B-14911]
          Length = 614

 Score =  451 bits (1160), Expect = e-124,   Method: Composition-based stats.
 Identities = 144/612 (23%), Positives = 272/612 (44%), Gaps = 18/612 (2%)

Query: 21  SSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
            + +  + S+  +     W LED++ + D+ E   + + ++         ++G L     
Sbjct: 9   ETAVKKLPSRSEIKPEDTWRLEDIFSTDDAWE--KEFQEVKQLLPD-AGGFQGKLGD--- 62

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
             +   L  A+   + + E +GR+ SYA + Y+ + ++   +     I    +     L 
Sbjct: 63  --SADKLYEALQYQDHLLERLGRLYSYAHMRYDQDTTNSFYQGLDDRIKNLYSQAASSLA 120

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           +   EI  +DE  +     +      Y   ++ I   + H+LS + E LL+  S+V    
Sbjct: 121 YIVPEILAIDEEKISSFLDEKEELRLYKHSLEEINLQRPHVLSAEAEALLAQASEVLDAP 180

Query: 201 LKRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              F   N   L F     +      +   +  +     D+ VR+ A KA+  T+ K  +
Sbjct: 181 GNTFGMLNNADLEFPSIKDENGEEVEVTHGRYIRFLESDDQRVRRDAFKAVYDTYGKFKN 240

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
            FS   ++  K +    R R Y+    +    NN+   V E L+ +  N      HRY +
Sbjct: 241 TFSSTLSSNVKKDNFYARVRNYDSARHAALSDNNIPESVYENLVNT-VNDNLHLLHRYIK 299

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+K+ L L+ ++ +D   PL    +  IP++ A+D VL+       +   + ++ F + W
Sbjct: 300 LRKEVLGLEKLHMYDLFTPLVKDVKMEIPYDEAKDYVLKGLEPLGEEYLSVLKEGFENRW 359

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ   
Sbjct: 360 VDVHENKGKRSGAYSSG-AYGTNPYILMNWQDNVNNLFTLAHEFGHSVHSYYTRKTQPYP 418

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
             N S+ +AE AS   E L  D LL+     ++R  LL + +E    ++ RQ  F +FE 
Sbjct: 419 YGNYSIFVAEVASTCNEALLNDYLLKTIDDDQKRLYLLNHYLEGFRGTVFRQTMFAEFEH 478

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
           ++H + ++   +    + + + E  K+  G    + D E G  W  +PHF  + +     
Sbjct: 479 QIHQKAQNNEALTAEALTQDYYELNKKYFGEEDIIIDEEIGLEWSRIPHFYYNYYVYQY- 537

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     +L             E+Y+N L+AG+S +  E+L    ++++ P       +
Sbjct: 538 ATGFSAATALSKQILEEGEPAV-ERYINFLKAGSSDYPIEVLKKAGVDMTSPAPIADACK 596

Query: 615 TVEKMIDDVEKM 626
             E+ ++++E++
Sbjct: 597 VFEEKLNEMEEL 608


>gi|114567434|ref|YP_754588.1| oligoendopeptidase F [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|114338369|gb|ABI69217.1| oligopeptidase F. Metallo peptidase. MEROPS family M03B
           [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
          Length = 600

 Score =  451 bits (1160), Expect = e-124,   Method: Composition-based stats.
 Identities = 147/606 (24%), Positives = 273/606 (45%), Gaps = 19/606 (3%)

Query: 26  TMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCH 85
               +E +G   +W LED+Y   +S E   D + +E +  A + +++G L  ++ Q    
Sbjct: 4   QSKKREEIGPEYKWKLEDIYADENSWE--EDYKKLEEQIPALE-KYKGVLGSSSTQ---- 56

Query: 86  SLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALE 145
            L   +     +     ++  YA +  + +  +   +  +  +     +      +   E
Sbjct: 57  -LLQVLEFSHELERKAEKLYVYARMRRDEDNGNSHYQALFDRVQRLSIELGSASAYIVPE 115

Query: 146 INTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFF 205
           I +L    +     ++     YS  +  + + K+H+LS + E +L+ ++ +   A   F 
Sbjct: 116 IISLAPEKIRAFLDENQDLQLYSRLLDELMRQKEHILSPEEERILAMSADLSLAAKNIFG 175

Query: 206 CENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFI 259
             N   ++F +   +      +   +       ++R VRK A  AL  ++ K  +  +  
Sbjct: 176 MLNNADIKFPVIQDEEGKAVELTKGRYGSFMESNERRVRKEAFTALYGSYGKVKNTLAMS 235

Query: 260 TNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKW 319
             +  K++    R RKY    ++    +N+ P V E L+++V N      +RY  L+KK 
Sbjct: 236 LASNVKNDIFYSRVRKYPSALEASLDQDNISPEVYERLVETVHNNMEP-MYRYLRLRKKA 294

Query: 320 LKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQ 379
           L LD ++ +D  APL    +  + +E ++++VL++      +   I        WID  +
Sbjct: 295 LGLDELHMYDIYAPLVKEFKSKVSYEKSQEMVLKALQPLGDEYLAILRGGLKGGWIDVYE 354

Query: 380 YDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSS 439
            +GK SGA++ G   S HPY+L+NY  K  DV TLAHE+GH +H   S++ Q  + +  S
Sbjct: 355 NEGKTSGAYSWGCYDS-HPYVLMNYDDKLDDVFTLAHEMGHALHSYYSNKNQPYVYSQYS 413

Query: 440 LTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTE 499
           + +AE AS   E L  D LL  +    E+  L+ + +E    ++ RQ  F +FE K+H +
Sbjct: 414 IFVAEVASTVNELLLIDYLLAQSREPREKAYLINHYLEQFRGTVYRQTMFAEFEKKIHEQ 473

Query: 500 RRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNC 559
                 +    + + + E  +   G    L D E    W  +PHF  + FYVY YA G  
Sbjct: 474 VEQGQTLTADGLCQSYRELNRLYYGTDTVL-DEEIDMEWARIPHFYSA-FYVYKYATGFS 531

Query: 560 LVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKM 619
              +L +            +YL  L++G+S +   LL    ++L+ P   E+ L    ++
Sbjct: 532 AAVALKEQILQEGKPAVA-RYLEFLKSGSSDYPLNLLKKAGVDLTTPEPVEKALHLFARL 590

Query: 620 IDDVEK 625
           + ++E 
Sbjct: 591 VAEMEA 596


>gi|229010588|ref|ZP_04167790.1| Oligoendopeptidase F [Bacillus mycoides DSM 2048]
 gi|228750786|gb|EEM00610.1| Oligoendopeptidase F [Bacillus mycoides DSM 2048]
          Length = 608

 Score =  451 bits (1159), Expect = e-124,   Method: Composition-based stats.
 Identities = 144/611 (23%), Positives = 273/611 (44%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +   T+  +  +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NKAKTLPDRNEIEEASTWRLEDIFQTDAEWE--KEFQAIKELLPKL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            +  +L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SADNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSISEDTLQTFLQENRELSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     DR VR+ A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVFETYGKFKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+    N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARIRKYDSARQAALSNNNIPEAVYDQLV-ETVNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+DL+L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVQEVKMNVKYEEAQDLLLKSLNVLGDEYVEILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLYTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHI 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+ +  K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVI-DKEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|228957569|ref|ZP_04119321.1| Oligoendopeptidase F [Bacillus thuringiensis serovar pakistani str.
           T13001]
 gi|228802161|gb|EEM49026.1| Oligoendopeptidase F [Bacillus thuringiensis serovar pakistani str.
           T13001]
          Length = 608

 Score =  450 bits (1158), Expect = e-124,   Method: Composition-based stats.
 Identities = 142/611 (23%), Positives = 270/611 (44%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +    +  +  +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NKAKALPDRNEIEEASTWRLEDIFQTDAEWE--KEFQAIKELLPKL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            +  +L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SADNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSLYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSSSS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     D  VRK A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEIEITHGRYIQFLESDDPRVRKDAFKAVYETYGKFKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+    N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLV-ETVNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+DL+L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDLLLKSLNVLGDEYVDILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHI 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+ +  K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVI-DEEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++     +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASSEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|229154863|ref|ZP_04282977.1| Oligoendopeptidase F [Bacillus cereus ATCC 4342]
 gi|228628421|gb|EEK85134.1| Oligoendopeptidase F [Bacillus cereus ATCC 4342]
          Length = 608

 Score =  450 bits (1158), Expect = e-124,   Method: Composition-based stats.
 Identities = 142/611 (23%), Positives = 272/611 (44%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +    +  +  +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NTAKALPDRNEIEESSTWRLEDIFQTDAEWE--KEFQAIKELLPKL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            + ++L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSSSS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     DR VR+ A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+    N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLV-ESVNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+D++L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLHVLGDEYVDILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHM 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+    K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGYAVTPDMLTEIYYNLNKKYFGDALVI-DEEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|288574304|ref|ZP_06392661.1| oligoendopeptidase F [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288570045|gb|EFC91602.1| oligoendopeptidase F [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 600

 Score =  450 bits (1158), Expect = e-124,   Method: Composition-based stats.
 Identities = 138/612 (22%), Positives = 267/612 (43%), Gaps = 21/612 (3%)

Query: 21  SSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
           +SD  ++  +  +    +W+L  +Y   +  E  N    +       ++ + G L    +
Sbjct: 2   ASDSRSIPVRSEIDESYKWDLSSIYGGIEEWE--NAWREVFESVDTLES-FSGKLGDGAS 58

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
                 L   + E +R+   +GR+  YA +  + + S    +       A        L 
Sbjct: 59  C-----LLGCLKEIDRVSLELGRVFVYATMKSHEDASDGEAKAMADRAMALNVRVSTALA 113

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           +   EI  ++E+ L   +   P    Y   I+ I + K H+LS   E LLS   ++    
Sbjct: 114 YVLPEILGIEESRLASFFDDLPELEMYRYHIEQIIRKKAHVLSAREEELLSGMGEIANAP 173

Query: 201 LKRFFCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              F       ++F           ++   + Y+     DR VR+ A K +  T+    +
Sbjct: 174 ELIFSMLTNGDMKFPSIRDERGEAVELSEERYYRLIRSKDRPVRERAFKGIHDTYESFRN 233

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
             +    +  K+     R  +Y    ++     ++   V + L+++V+       H Y  
Sbjct: 234 TLAASFGSAVKESVFDARVHRYGSSREAALDGGDIPLSVYDNLIKAVRE-GLPLLHDYVS 292

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+K  L LD ++ +D   P+    ++ I +E A+  VL   +        + ++ F   W
Sbjct: 293 LRKSSLGLDELHMYDLYVPIVEEPEEDISWEDAKKTVLAGLSPLGDGYLDVLKEGFDGRW 352

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D  +  GK  GA++ G+    +P++LLNY G  +DV TLAHE+GH +H   S + Q  +
Sbjct: 353 VDVYESQGKRKGAYSWGS-YGTNPFVLLNYNGTLRDVFTLAHEMGHALHSWHSHKFQPPV 411

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
             + ++ +AE AS   E L  + +L+     ++R  LL   +E +  ++ RQ  F +FEL
Sbjct: 412 YGDYTIFVAEVASTTNEVLLMEHMLENR--PKDRPFLLNYYLEQVRTTVFRQTMFAEFEL 469

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
           K+H        +    ++ IW +  ++  GP   + D      W  +PHF  S FYVY Y
Sbjct: 470 KVHGMAEEGTPLTPEILSSIWGDLNRDYYGPDIVV-DKGIEVEWARIPHFY-SPFYVYQY 527

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     +L +   +   +  +++Y++ L+ G+SK   +LL    ++++ P+     L+
Sbjct: 528 ATGYSAATALAEGILTGG-ESARDRYIDFLKGGSSKSSIDLLRGAGVDMTSPDPVRSALR 586

Query: 615 TVEKMIDDVEKM 626
              + I+++ ++
Sbjct: 587 LFGEKIEELREI 598


>gi|229056931|ref|ZP_04196327.1| Oligoendopeptidase F [Bacillus cereus AH603]
 gi|228720459|gb|EEL72032.1| Oligoendopeptidase F [Bacillus cereus AH603]
          Length = 608

 Score =  450 bits (1158), Expect = e-124,   Method: Composition-based stats.
 Identities = 142/611 (23%), Positives = 273/611 (44%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +   T+  +  +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NKAKTLPDRNEIEEASTWRLEDIFQTDAEWE--KEFQAIKELLPKL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            +  +L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SADNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSISEDTLQTFLQENRELSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     DR VR+ A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVFETYGKFKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+    N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARIRKYDSARQAALSNNNIPEAVYDQLV-ETVNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A++++L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVQEVKMNVKYEEAQEMLLKSLNVLGDEYVEILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLYTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHI 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+ +  K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVI-DKEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|229132093|ref|ZP_04260954.1| Oligoendopeptidase F [Bacillus cereus BDRD-ST196]
 gi|228651361|gb|EEL07335.1| Oligoendopeptidase F [Bacillus cereus BDRD-ST196]
          Length = 608

 Score =  450 bits (1158), Expect = e-124,   Method: Composition-based stats.
 Identities = 143/611 (23%), Positives = 275/611 (45%), Gaps = 18/611 (2%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           + + ++ ++  +     W LED++ +    E   + + I+       T ++G L      
Sbjct: 5   NTVKSLPNRNEIEEASTWRLEDIFQTDAEWE--KEFQAIKELLPKL-TEFKGKLGD---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            +  +L  A+   + I   +G++ +YA + Y+ + ++   +          +       +
Sbjct: 58  -SADNLLEALRYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+    ++     Y   ++ I + + H+LS   E LL++ S+V   + 
Sbjct: 117 IVPEILSISEDTLQTFLQENRELSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASS 176

Query: 202 KRFFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   L+F         + +I   +  +     DR VR+ A KA+  T+ K  + 
Sbjct: 177 NTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVFETYGKFKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K      R RKY+    +   +NN+   V + L+    N      HRY ++
Sbjct: 237 FASTLSGAVKRNNFNARIRKYDSARQAALSNNNIPEAVYDQLV-ETVNDNLHLLHRYIDI 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL    +  + +E A+DL+L+S      +   I ++ + + W+
Sbjct: 296 RKRALGLDELHMYDLYTPLVQEVKMNVKYEEAQDLLLKSLNVLGDEYVEILKEAYENRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + +TQ  + 
Sbjct: 356 DVYENKGKRSGAYSSG-AYGTNPYILMNWHDNVNNLYTLAHEFGHSVHSYYTRKTQPHVY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + S+ +AE AS   E L  D LL+    K+ER  LL + +E    ++ RQ  F +FE  
Sbjct: 415 GDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHI 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + EI+ +  K+  G A  + D E G  W  +PHF  + +     A
Sbjct: 475 IHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVI-DKEIGLEWSRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L            +      L+AG+S +  E+L    ++++ P   +  LQ 
Sbjct: 533 TGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQV 592

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 593 FEEKLNELEAL 603


>gi|229541378|ref|ZP_04430438.1| oligoendopeptidase F [Bacillus coagulans 36D1]
 gi|229325798|gb|EEN91473.1| oligoendopeptidase F [Bacillus coagulans 36D1]
          Length = 604

 Score =  450 bits (1157), Expect = e-124,   Method: Composition-based stats.
 Identities = 144/607 (23%), Positives = 273/607 (44%), Gaps = 19/607 (3%)

Query: 26  TMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCH 85
            + S++ +     W LED++PS D    + + + ++ +       ++G L      ++  
Sbjct: 9   ALPSRDEVREALTWRLEDIFPSDDDW--NKEYQAVKEKLAD-AASYQGKLG-----ESAE 60

Query: 86  SLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALE 145
            L  A+   + + E  G++ +YA + Y+ + ++   +   +   +  A       F   E
Sbjct: 61  QLYHALKFQDEVTERFGKLYTYAHMRYDQDTTNAFYQGIDSKAKSLAAQVGSAFAFVVPE 120

Query: 146 INTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFF 205
           I +++EA L Q          Y   ++ I +++ H+LS + E LL+  S+V   +   F 
Sbjct: 121 ILSIEEAKLNQFLEAYEPLQLYRHALEEINEMRPHILSKEEEALLAQVSEVLNTSSTTFG 180

Query: 206 CENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFI 259
             N   L F           +I   +  +     DR VRK A + L  T+ K ++ F+  
Sbjct: 181 MLNNADLEFPTVIDENGNEVQITHGRFTRLLESKDRRVRKEAFQKLYATYKKFTNTFAST 240

Query: 260 TNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKW 319
            +   K   +  + R Y    ++   +N++   V + L+    N +    HRY  L+KK 
Sbjct: 241 LSGQVKKNNVVAQIRHYHSAREAALSANHIPEKVYDQLV-ETVNKHLGLLHRYVALRKKA 299

Query: 320 LKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQ 379
           L+LD ++ +D   PL   +   + +E A+++VL        +   I ++ F + WID  +
Sbjct: 300 LQLDEVHMYDLYTPLVQDADMEVTYEKAKEIVLDGLHPLGEEYRSILQQAFENRWIDVVE 359

Query: 380 YDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSS 439
             GK SGA++ G     +PYILLN+     +V TLAHELGH +H   + + Q     + S
Sbjct: 360 NKGKRSGAYSSG-AYGTNPYILLNWQDNIDNVFTLAHELGHSVHSYYTRKNQPYPYGDYS 418

Query: 440 LTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTE 499
           + +AE AS   E L  D LL+    +++R  LL + +E    ++ RQ  F +FE  +H +
Sbjct: 419 IFVAEVASTCNEALLNDYLLKTIKDEKQRIYLLNHYLEGFRGTVFRQTMFAEFEHLIHQK 478

Query: 500 RRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNC 559
            +    +    + + + +  ++  G    + D E G  W  +PHF    +     A G  
Sbjct: 479 AQHGEALTAELLTDEYYKLNQKYYGTDTAI-DQEIGLEWARIPHFYYDYYVYQY-ATGFS 536

Query: 560 LVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKM 619
              +L             ++Y+  L AG+S++  E+L    ++++ P   E  L+  E+ 
Sbjct: 537 AATALSKQILEEGEPAV-KRYIGYLSAGSSEYPIEVLKKAGVDMTSPQPVEDALKVFEEK 595

Query: 620 IDDVEKM 626
           + ++E +
Sbjct: 596 LTEMENL 602


>gi|23098671|ref|NP_692137.1| thimet oligopeptidase [Oceanobacillus iheyensis HTE831]
 gi|22776898|dbj|BAC13172.1| thimet oligopeptidase [Oceanobacillus iheyensis HTE831]
          Length = 602

 Score =  450 bits (1157), Expect = e-124,   Method: Composition-based stats.
 Identities = 139/612 (22%), Positives = 267/612 (43%), Gaps = 19/612 (3%)

Query: 21  SSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
           S     +  ++ +     W LED++ S D+     +++ +  E     T ++G L     
Sbjct: 2   SKATKQLPKRDEIPTDLTWKLEDIFASDDAW--KEELKSLREEFPKI-TEFKGKLH---- 54

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
            ++  +L +     + + + +G + +YA + Y+ + ++   +         +      L 
Sbjct: 55  -ESADTLYSLFKMQDELSQRLGMLYTYAHMRYDQDTTNSFYQGLNAQAENLITIASSNLS 113

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           +   EI +++E  L+Q         +Y   +++I + + H+LS   E LL+  S+     
Sbjct: 114 YIVPEILSIEENKLQQFLDDHEGLQQYKKVLEDINRQRPHVLSEKEEALLAQASEPMSTG 173

Query: 201 LKRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
            + F   N   L F     +      +   +        DR VRK+A +A+  T+    +
Sbjct: 174 SQTFGMLNNADLTFPSVTNEDGEEVEVTHGRYSTFLESKDRNVRKNAFEAVYQTYESFKN 233

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
            F+   +   K      + R YE    S    NN+   V + L+++  N      HRY +
Sbjct: 234 TFASTLSGTVKAHNFSAKVRNYESARQSALDDNNIPEEVYDNLVEA-VNERLPLLHRYTK 292

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+KK L+LD ++ +D   PL    +  + ++ A+D VL+           + +  F + W
Sbjct: 293 LRKKVLELDELHMYDLYTPLVKDVKMKVSYDQAQDFVLKGLEPLGDDYKKVLKSAFENRW 352

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           ID  +  GK SGA++ G     +PYIL+N+     +  TLAHELGH +H   S + Q   
Sbjct: 353 IDVEENKGKRSGAYSSG-AYGTNPYILMNWQDDINNTFTLAHELGHSVHSYYSRKHQPFR 411

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
             N S+ +AE AS   E L  D LL     ++E+  +L + +E    ++ RQ  F +FE 
Sbjct: 412 YGNYSIFVAEVASTTNEALLNDYLLNHLEDEKEKLYILNHFLEGFRGTVFRQTMFAEFEH 471

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
           ++H   +    +   +  +I+ E  K+  G    +SD   G  W  +PHF  + +     
Sbjct: 472 EIHKLDQEGEALTAEKFTQIYYELNKKYFGEDV-VSDEYIGLEWARIPHFYYNYYVYQY- 529

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     +L         +   ++YL  L++G+S+   ++L    ++++        L 
Sbjct: 530 ATGYSAATALAHNILE-GKEGAVDRYLQFLQSGSSEDPIDVLKKAGVDMTSKQPILDALD 588

Query: 615 TVEKMIDDVEKM 626
             E+ + ++E++
Sbjct: 589 VFEEKLAEMEQL 600


>gi|308068464|ref|YP_003870069.1| oligoendopeptidase F [Paenibacillus polymyxa E681]
 gi|305857743|gb|ADM69531.1| Oligoendopeptidase F-like protein [Paenibacillus polymyxa E681]
          Length = 639

 Score =  449 bits (1155), Expect = e-124,   Method: Composition-based stats.
 Identities = 141/613 (23%), Positives = 255/613 (41%), Gaps = 21/613 (3%)

Query: 20  RSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHAT 79
           R   M+ +  + +      W LEDL+P+  +     + E ++  +     +++G L    
Sbjct: 38  RRLSMSEIVKRADAPVENTWKLEDLFPNRKAW--DQEYEEVKQLAKK-AEQFQGKLN--- 91

Query: 80  NQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVL 139
              +  S+G+     + +     R+  YA L ++ + + PT +           +  + L
Sbjct: 92  ---SAESIGSCFKLEDELSLKTERVYVYAHLHHDEDTAEPTYQGLSQKAKKLGVEVSESL 148

Query: 140 IFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGRE 199
            F   EI  L +  L+    +DP    Y   ++ +++ K H+L    E LL+    + + 
Sbjct: 149 SFVTPEILALPDHQLDAFI-EDPKLADYRFTLQEMKREKAHILGKTEEALLAQVGNLAQA 207

Query: 200 ALKRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSS 253
               F   N   L+F     +      +      +      REVR+ A KA+  T+ K+ 
Sbjct: 208 PQTIFGMLNNADLKFPKIKDENGKEVELTHGSYIQFLESPHREVRERAFKAVYDTYAKNK 267

Query: 254 HIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY 313
           +  +   +          R RKY  + +     +N+   V   L+ ++        HRY 
Sbjct: 268 NTIASTLSANVNKNIFYSRVRKYPSVLEMSLYGDNIPKEVYTNLIDTIHES-LPLLHRYI 326

Query: 314 ELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHN 373
           +L+KK L +D ++ +D  APL    +  I +E A+    +             +K +   
Sbjct: 327 KLRKKLLGVDELHMYDLFAPLVDEYKMDITYEDAKKQTKEGLKPLGEDYLASLQKGYDER 386

Query: 374 WIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGI 433
           WID  + + K +GA++ G     HPY+LLN+      + TLAHE+GH +H   S      
Sbjct: 387 WIDVYENENKRTGAYSWG-AYGTHPYVLLNHKDNLNSMFTLAHEMGHALHSYYSDNALKF 445

Query: 434 LTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFE 493
                ++ LAE AS   E L  D LL  ++  +E+  LL    +    ++ RQ  F +FE
Sbjct: 446 RDAQYTIFLAEVASTTNEALLMDYLLNKSTDPKEKMYLLTYYADQFRTTVFRQTMFAEFE 505

Query: 494 LKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYA 553
             +H        +    ++EI+ +   +  GP   + D +    W  +PHF  S FYVY 
Sbjct: 506 KIVHERAEQGESLTPQLLSEIYYDLNVKYHGPGMKV-DKDIEMEWARIPHFYNS-FYVYK 563

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGL 613
           YA G     S              ++YL  L++G S +   +L    +++S P      +
Sbjct: 564 YATGFSAATSFSKQILEEGQPAV-DRYLGFLKSGGSDYSINILKKAGVDMSSPQPIREAM 622

Query: 614 QTVEKMIDDVEKM 626
              E++I ++EK+
Sbjct: 623 SVFEEVITEMEKL 635


>gi|311067644|ref|YP_003972567.1| oligoendopeptidase F [Bacillus atrophaeus 1942]
 gi|310868161|gb|ADP31636.1| oligoendopeptidase F [Bacillus atrophaeus 1942]
          Length = 670

 Score =  449 bits (1155), Expect = e-124,   Method: Composition-based stats.
 Identities = 132/631 (20%), Positives = 284/631 (45%), Gaps = 19/631 (3%)

Query: 2   TKYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIE 61
           +++ ++                   +  +        W LED++PS ++   + + + ++
Sbjct: 46  SRFFNWLELKKTRGITMTEEKKANQLPDRSEAKAEDTWKLEDIFPSDEAW--NKEFQAVK 103

Query: 62  HESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTI 121
                  + ++G L H     +  +L  A+   +++ E +G++ +YA +  + +  +   
Sbjct: 104 ELIPNL-SEFKGTLDH-----SADNLYEALTYQDKVMERLGKLYTYAHMRSDQDTGNSFY 157

Query: 122 RKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHL 181
           +                  +   EI ++ E  L+Q   +      YS  I+ I K + H+
Sbjct: 158 QGLNDKAANLYTQAASATAYMVPEILSIQEEKLQQFLLEKEELKLYSHAIEEITKERPHV 217

Query: 182 LSNDMECLLSDTSQVGREALKRFFCENIESLRFKI------NDQKIPLTKAYKSFFDSDR 235
           LS   E LL++ S+    +   F   N   + F         +++I            +R
Sbjct: 218 LSEKEEALLAEASEALSSSSNTFSVLNNADITFPSIKDENGQEKQITHGNFINFLESENR 277

Query: 236 EVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIE 295
           EVRK+A +A+  T+ +  +  +   +   K +    R +KY+   ++   +N++   V +
Sbjct: 278 EVRKNAFEAVYKTYGQYKNTMATTLSGTVKKDNFYARVKKYKSAREAALSNNSIPEEVYD 337

Query: 296 ALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSY 355
            L++++  +     HRY EL+KK L+LD ++ +D   PL   +   + ++ A++ +L+  
Sbjct: 338 NLIKTINKH-LPLLHRYIELRKKVLELDEVHIYDLYTPLVKDAGMKVTYDEAKEYMLKGL 396

Query: 356 AKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLA 415
           A    + + I ++   + W+D  +  GK SGA++ GT    +PYIL+N+     ++ TL 
Sbjct: 397 APLGDEYASILKEGLENRWVDVYENKGKRSGAYSSGT-YGTNPYILMNWHDNVNNLFTLV 455

Query: 416 HELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANK 475
           HE GH +H   + + Q     N S+ +AE AS   E L  + +L     +++R  LL + 
Sbjct: 456 HEFGHSVHSYYTRKHQPYQYGNYSIFVAEVASTTNEALLGEYMLNNLKDEKQRLYLLNHM 515

Query: 476 IEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYG 535
           +E    ++ RQ  F +FE ++H + +    +    ++ ++ +  K+  G    + D E G
Sbjct: 516 LEGFRGTVFRQTMFAEFEHQIHMKAQEGEPLTPELLSSMYYDLNKKYFGDNMVI-DKEIG 574

Query: 536 SFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSEL 595
             W  +PHF  + +     A G     +L             ++Y++ L+AG+S++  ++
Sbjct: 575 LEWSRIPHFYYNYYVYQY-ATGYSAAQALSSQILKEGKPAV-DRYVDFLKAGSSEYPIDI 632

Query: 596 LLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           L    ++++ P   E   +  E+ +D++E++
Sbjct: 633 LKKAGVDMTSPEPIEAACKMFEEKLDEMEEL 663


>gi|253681906|ref|ZP_04862703.1| oligoendopeptidase F [Clostridium botulinum D str. 1873]
 gi|253561618|gb|EES91070.1| oligoendopeptidase F [Clostridium botulinum D str. 1873]
          Length = 596

 Score =  448 bits (1153), Expect = e-123,   Method: Composition-based stats.
 Identities = 148/608 (24%), Positives = 276/608 (45%), Gaps = 20/608 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +++  + +++ + +  +WN+E +Y +    E  ND   ++ ++  F+ +++G L+     
Sbjct: 2   TEVKRLKTRDEIKSEDKWNIEKIYSNVGEWE--NDFYKLKEKAKEFE-KYKGKLS----- 53

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            N   L   +   E +  L  ++  YA L  + + S+   +   T I    ++   +  F
Sbjct: 54  -NPDELLGFLRLDEEVSRLGEKLLVYAFLKGDEDTSNNVNQALRTKIEMYFSELSSLSAF 112

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
           F  EI + D+ ++E +  + P    Y   ++ I K K H L+ +ME +L+  S       
Sbjct: 113 FVPEILSYDKKVIEDAINKLPELKVYEVMLERILKRKPHTLTTEMEEMLAAVSDNLNAPS 172

Query: 202 KRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F       + F +   +      +            D  VR +A KAL +T+    + 
Sbjct: 173 NIFSILTNADMTFPVIKDEEGKDVELTEGNYSIFIKSKDIRVRMAAFKALFNTYKHFKNT 232

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
            +    +  K+     + RKY    +S    N++   V + +++++      + HRY ++
Sbjct: 233 LATSLTSSIKNFSFIAKTRKYNSSIESSLEPNDIPIEVYDNVIKTINEN-LDSLHRYVKI 291

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           KKK L LD ++ +D   P+  T ++ I F  A ++V ++      +   I        WI
Sbjct: 292 KKKLLGLDEIHMYDLYVPVIDTPKEHIEFSKAVEMVNEALKPLGDEYIKIFNNGIKDRWI 351

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK  GA++ GT  ++ PY+LLNY  +  DV TLAHE+GH IH   S + Q  + 
Sbjct: 352 DIYENKGKRKGAYSWGTYDTM-PYVLLNYNYELNDVSTLAHEMGHSIHSYYSRKEQPYIY 410

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            N +L  AE AS   E L  ++L++  + K ++  L+  ++E +  ++ RQ+ F +FE  
Sbjct: 411 ANYTLFCAEVASTVNENLLINNLIKNETDKNKKLYLINTQLEQIRTTVFRQVMFAEFEKI 470

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
            H +  +   + +  + +I+ E   +  GP   + D E    W  +PHF  S FYVY YA
Sbjct: 471 THEKIDNGEPLTSDDLCKIYHELNVKYFGPDMII-DEEIDMEWARIPHFY-SDFYVYQYA 528

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G    NS          +   EKY   L+AG S     +L    ++++ P   E  +  
Sbjct: 529 TGYSAANSFVKQILDGGEESV-EKYKGFLKAGGSDSPINILKKAGVDMTTPKPIEDTINR 587

Query: 616 VEKMIDDV 623
             +++D +
Sbjct: 588 FNELLDML 595


>gi|126654177|ref|ZP_01725984.1| oligoendopeptidase F [Bacillus sp. B14905]
 gi|126589348|gb|EAZ83501.1| oligoendopeptidase F [Bacillus sp. B14905]
          Length = 605

 Score =  448 bits (1151), Expect = e-123,   Method: Composition-based stats.
 Identities = 143/612 (23%), Positives = 267/612 (43%), Gaps = 18/612 (2%)

Query: 21  SSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
           +S+   +  +  +     W LED++ S    E  ++ + +   +    + + G L     
Sbjct: 2   ASNSNQILVRNEVPEELTWRLEDIFASDALWE--DEFKEVAELAKK-ASSFAGTL----- 53

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
                +L AA+  ++ I E   ++ +YA + Y+ + ++   +   + I          L 
Sbjct: 54  NNGAQALLAALHYHDHIYERAMKLYTYAHMRYDQDTTNSFYQDMNSRIQTLATSISAGLS 113

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           F   EI  L+E  +E   A++     Y   +K I   + H+L  + E LL+  S+V   A
Sbjct: 114 FLTPEILALNEETIESYLAENQDLQLYKQSLKEITMARPHVLPAEQEALLAQMSEVTGTA 173

Query: 201 LKRFFCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              F   N   L F           ++      K     DR VR+ A KA+  T+ K  +
Sbjct: 174 SNTFSMLNNADLEFPYVKNEDGEEVQLTHGNYIKFLESKDRSVREGAFKAMYATYGKFKN 233

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
            FS       K   +  R R Y+   ++   +N +   V + L++++  +      RY  
Sbjct: 234 TFSSTLTGNVKKHNVSARIRHYDSAREAAMSNNFIPENVYDQLVETIHKH-LPAMQRYIS 292

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+KK L +D ++ WD  APL    +  + ++ A+D+++++ A    +   I +    + W
Sbjct: 293 LRKKLLGVDELHMWDLFAPLVKEVEMKVTYDEAKDILVKALAPLGEEYQNIVQNGLDNRW 352

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   S   Q  +
Sbjct: 353 VDVLENKGKRSGAYSSG-AYGTNPYILMNWQDNVNNLFTLAHEFGHSVHSYYSRNNQPFV 411

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
             + S+ +AE AS   E L  D LL+     +++  LL + ++   +++ RQ  F +FE 
Sbjct: 412 YGDYSIFVAEVASTCNEELLNDYLLKTIDDPQQKIYLLNHWLDGFRSTVFRQTMFAEFEH 471

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
            +H   ++   +   R+ E++ E  K+  G    + D E G  W  +PHF  + +     
Sbjct: 472 LIHQMDKNGESLTADRLTEVYYELNKKYFGDDMVV-DEEIGLEWARIPHFYYNYYVYQY- 529

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     +L            +    N L+AG S    E+L    ++++     E   +
Sbjct: 530 ATGKSAATALSKQILEEGEPAVERYINNFLKAGCSDFPIEVLKAAGVDMNVAKPIEDACK 589

Query: 615 TVEKMIDDVEKM 626
             E+ + ++EK+
Sbjct: 590 VFEERLIELEKL 601


>gi|157691864|ref|YP_001486326.1| M03 oligoendopeptidase F [Bacillus pumilus SAFR-032]
 gi|157680622|gb|ABV61766.1| M03 oligoendopeptidase F [Bacillus pumilus SAFR-032]
          Length = 686

 Score =  448 bits (1151), Expect = e-123,   Method: Composition-based stats.
 Identities = 140/602 (23%), Positives = 271/602 (45%), Gaps = 19/602 (3%)

Query: 21  SSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
            S+   +  +  +    +W LED++ S D+   + + E ++ E      +++G LAH   
Sbjct: 82  ESNNNHLPDRSEVKEENKWRLEDIFESVDAW--NKEFEAVKKEIPKL-AQFKGKLAH--- 135

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
             +   L  A+   +++ E +G++ +YA + Y+ + ++ + +      +           
Sbjct: 136 --SADVLYEALTFQDQLSEKLGKLYTYAHMKYDEDTTNSSFQALNDKASNLFTQLSSTSA 193

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           +   EI ++ E  L+Q   +      YS  ++ I K + H+LS + E LL++ S+    +
Sbjct: 194 YIVPEILSIQEDKLQQFILEKEELKLYSHALEEINKERPHILSEEQEALLAEASEPLSTS 253

Query: 201 LKRFFCENIESLRFKI------NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              F   N   + F         ++KI            DREVRK+A KA+  T+++  +
Sbjct: 254 STTFSMFNNADISFPSVKDENGEEKKITHGNFITFLNSDDREVRKNAFKAVYKTYDQYKN 313

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
             +   +   K +    + R Y+   +S    N++   V + L+ +  + Y    HRY E
Sbjct: 314 TLASTLSGSIKKDNFYAKVRNYKSARESALSRNSIPEEVYDNLIDT-VHQYLPLLHRYIE 372

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+KK LKLD ++ +D   PL   +   + ++ A+D +L+  A    +   + ++   + W
Sbjct: 373 LRKKVLKLDEVHNYDLYTPLVKDAGMKLTYDEAKDYMLKGLAPLGEEYVSVLKEGLNNRW 432

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D  +  GK SGA++ G+    +PYIL+N+     ++ TLAHE GH +H   + + Q   
Sbjct: 433 VDVYENKGKRSGAYSSGS-YGTNPYILMNWQNNIDNLFTLAHEFGHSVHSYYTRKHQPYP 491

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
             N S+ +AE AS   E L  + LL     K++R  +L + +E    ++ RQ  F +FE 
Sbjct: 492 YGNYSIFVAEVASTTNEALLGEYLLNHLDDKKQRLYVLNHLLEGFRGTVFRQTMFAEFEH 551

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
            +H + +    +    +  ++ +  K+  G    + D E G  W  +PHF  + +     
Sbjct: 552 LIHVKAQEGEALTPEFMTNLYYDLNKKYFGDGMVV-DKEIGLEWTRIPHFYYNYYVYQY- 609

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     +L             E+Y + L+AG+S +   +L    ++++     E   Q
Sbjct: 610 ATGYSAAQALSKQILEEGKPAV-ERYTDFLKAGSSDYPINVLKKAGVDMASKEPIEAACQ 668

Query: 615 TV 616
             
Sbjct: 669 LF 670


>gi|194014857|ref|ZP_03053474.1| oligoendopeptidase F [Bacillus pumilus ATCC 7061]
 gi|194013883|gb|EDW23448.1| oligoendopeptidase F [Bacillus pumilus ATCC 7061]
          Length = 608

 Score =  448 bits (1151), Expect = e-123,   Method: Composition-based stats.
 Identities = 140/601 (23%), Positives = 271/601 (45%), Gaps = 19/601 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           S+   +  +  +    +W LED++ S D+   + + E ++ E      +++G LAH    
Sbjct: 5   SNNNHLPDRSEVKEENKWRLEDIFESVDAW--NKEFEAVKKEIPKL-AQFKGKLAH---- 57

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            +   L  A+   +++ E +G++ +YA + Y+ + ++ + +      +           +
Sbjct: 58  -SADVLYEALTFQDQLSEKLGKLYTYAHMKYDEDTTNSSFQALNDKASNLFTQISSTSAY 116

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI ++ E  L+Q   +      YS  ++ I K + H+LS + E LL++ S+    + 
Sbjct: 117 IVPEILSIQEDKLQQFILEKEELKLYSHALEEINKERPHILSEEQEALLAEASEPLSTSS 176

Query: 202 KRFFCENIESLRFKI------NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F   N   + F         ++KI            DREVRK+A KA+  T+++  + 
Sbjct: 177 TTFSMFNNADISFPSVKDEDGEEKKITHGNFITFLNSDDREVRKNAFKAVYKTYDQYKNT 236

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
            +   +   K +    + R Y+   +S    N++   V + L+ +  + Y    HRY EL
Sbjct: 237 LASTLSGSIKKDNFYAKVRNYKSARESALSRNSIPEEVYDNLIDT-VHQYLPLLHRYIEL 295

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +KK LKLD ++ +D   PL   +   + ++ A+D +L+  A    +   + ++   + W+
Sbjct: 296 RKKVLKLDEVHNYDLYTPLVKDAGMKLTYDEAKDYMLKGLAPLGEEYVSVLKEGLNNRWV 355

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G+    +PYIL+N+     ++ TLAHE GH +H   + + Q    
Sbjct: 356 DVYENKGKRSGAYSSGS-YGTNPYILMNWQNNIDNLFTLAHEFGHSVHSYYTRKHQPYPY 414

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            N S+ +AE AS   E L  + LL     K++R  +L + +E    ++ RQ  F +FE  
Sbjct: 415 GNYSIFVAEVASTTNEALLGEYLLNHLDDKKQRLYVLNHLLEGFRGTVFRQTMFAEFEHL 474

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    +  ++ +  K+  G    + D E G  W  +PHF  + +     A
Sbjct: 475 IHVKAQEGEALTPEFMTNLYYDLNKKYFGDGMVV-DKEIGLEWTRIPHFYYNYYVYQY-A 532

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L             E+Y + L+AG+S +   +L    ++++     E   Q 
Sbjct: 533 TGYSAAQALSKQILEEGKPAV-ERYTDFLKAGSSDYPINVLKKAGVDMASKEPIEAACQL 591

Query: 616 V 616
            
Sbjct: 592 F 592


>gi|83952979|ref|ZP_00961706.1| oligoendopeptidase F [Roseovarius nubinhibens ISM]
 gi|83835641|gb|EAP74943.1| oligoendopeptidase F [Roseovarius nubinhibens ISM]
          Length = 567

 Score =  448 bits (1151), Expect = e-123,   Method: Composition-based stats.
 Identities = 255/576 (44%), Positives = 353/576 (61%), Gaps = 9/576 (1%)

Query: 14  FFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEG 73
                    D       +NLG+LP W+L DLY   D+ E+  D++ +E     F   +EG
Sbjct: 1   MISFPRPVRDANAQGGADNLGHLPEWDLSDLYKGEDAPELIRDLDWLESACAEFARDYEG 60

Query: 74  NLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLA 133
            L       +   L   I   E+I  + GRI S+A L Y    + P   KF +D   K+ 
Sbjct: 61  KLDTL----DAAGLLECIVRDEKISNIAGRIMSFASLRYYQLTTDPARTKFLSDCQEKIT 116

Query: 134 DFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDT 193
            +   L+FF LE+N + E  L   YA++    +Y   +  IR +K H LS++ME  L D 
Sbjct: 117 AYTTPLVFFTLELNRISEDKLTAMYAENADLARYKPSLNRIRAMKPHQLSDEMEKFLHDM 176

Query: 194 SQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSS 253
             VG +A +R F E I  L F++  + + +        + DR+ R++A + L+  F ++ 
Sbjct: 177 GVVG-DAWERLFDETIAGLSFEVAGETLTIEGTLNLLTEQDRDTREAATRELARVFGENI 235

Query: 254 HIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY 313
            IFS + NT AK++E+ DRWR        RHLSN+VE  V+EAL  +V   YP+ SHRYY
Sbjct: 236 RIFSRVHNTAAKEKEVMDRWRNMPSAQAGRHLSNDVEAEVVEALRDAVVAAYPRLSHRYY 295

Query: 314 ELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHN 373
           ELK+KWL LD M  WDR APLP   Q  + ++ ARD+V+++Y  F P+M  +AE FF+  
Sbjct: 296 ELKRKWLGLDRMQVWDRNAPLPMELQKTVDWDSARDIVMEAYNAFDPRMGELAEPFFSKG 355

Query: 374 WIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGI 433
           WIDA    GK  GAFAH T+ +VHPY++LNYLGKP+DVMTLAHELGHG+H  L+++ QG 
Sbjct: 356 WIDAGVKPGKAPGAFAHPTVTTVHPYVMLNYLGKPRDVMTLAHELGHGVHQRLAAD-QGE 414

Query: 434 LTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFE 493
             +++ LTLAETAS+FGE LTF  +L  A+S +ERK+LLA K+EDM+N++VRQI+FYDFE
Sbjct: 415 WLSSTPLTLAETASVFGEMLTFRKMLDKAASPQERKVLLAGKVEDMINTVVRQIAFYDFE 474

Query: 494 LKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYA 553
            KLH  RR    +    I  +W+  Q ESLGPAFD  +  Y +FW  +PHF+ S FYVYA
Sbjct: 475 CKLHAARREGE-LTPEDIGALWMSVQGESLGPAFDFME-GYDTFWAYIPHFVHSPFYVYA 532

Query: 554 YAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNS 589
           YAFG+ LVN+LY +Y+ N  D F++KY ++LRAG S
Sbjct: 533 YAFGDGLVNALYAVYEENP-DGFQDKYFDMLRAGGS 567


>gi|307265857|ref|ZP_07547407.1| oligoendopeptidase F [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306919132|gb|EFN49356.1| oligoendopeptidase F [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 596

 Score =  447 bits (1149), Expect = e-123,   Method: Composition-based stats.
 Identities = 148/609 (24%), Positives = 266/609 (43%), Gaps = 20/609 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           M  +  +  + +  +W LED+Y + +  E   D    +        +++G +  + N   
Sbjct: 1   MEVLKDRSEIEDKYKWRLEDIYENENLWE--EDYNKTKELLKEIV-KFKGKINTSRN--- 54

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
              L   +   ++I     +I +YA +  + + ++P  +           +      F A
Sbjct: 55  ---LLEVLKLNDQIGMTASKIFAYARMRRDEDNTNPKYQALTDKAMRLNVEVMSTTSFIA 111

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            EI ++D   L +   +      Y  +++++ + K H+LS++ E +L++   +       
Sbjct: 112 PEILSIDTQKLMEMIEELEELKIYKQYLEDLIRFKPHVLSSEEEKILAEAETLAESVSNV 171

Query: 204 FFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           +   N   +RF     +      +      +     DR VRK+A  A+  T+ K  + F+
Sbjct: 172 YTMLNNADMRFPTIKDEEGKEVEVTHGNFVRFMQSKDRNVRKAAFNAMYDTYKKFINTFA 231

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
                  K +    + RKY    ++    +NV   V   L+    +      HRY +LKK
Sbjct: 232 STMAGNVKKDIFYAKTRKYNSSLEASLFEDNVSVEVYNNLI-ETVHSRLDVLHRYVKLKK 290

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           K L LD ++ +D   PL         +E A +LVL+       +   +  K F   W+D 
Sbjct: 291 KLLGLDELHMYDLYVPLIQEYDKKFTYEEAINLVLEGLQPLGDEYINLLRKGFNSRWVDV 350

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK SGA++ GT    HPY+LLNY GK  DV T+AHE+GH +H   S+ TQ  +   
Sbjct: 351 YENRGKTSGAYSWGT-YGTHPYVLLNYQGKLNDVFTIAHEMGHSLHTYYSNATQPYVYAG 409

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
             + +AE AS   E +  + LL+ +  ++E+  LL +  E+   ++ RQ+ F +FE  +H
Sbjct: 410 YKIFVAEVASTCNEAILMNYLLKNSKDEKEKLYLLNHFFEEFRGTVYRQVMFAEFEKLIH 469

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
                   +    +N+ + E  K   G    + D      W  +PHF   +FYVY YA G
Sbjct: 470 EMAERGEPLTAEVLNKKYYELNKLYYGDDIVV-DEGISYEWARIPHFYR-NFYVYKYATG 527

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                ++  +  +       E+Y   L++G+S +   LL    ++L+ P      L   E
Sbjct: 528 FSAAIAISQMILNEGEKAV-ERYKEFLKSGSSDYPLNLLKKAGVDLTTPKPVNEALDVFE 586

Query: 618 KMIDDVEKM 626
           K++D+ EK+
Sbjct: 587 KLLDEFEKI 595


>gi|229918463|ref|YP_002887109.1| oligoendopeptidase F [Exiguobacterium sp. AT1b]
 gi|229469892|gb|ACQ71664.1| oligoendopeptidase F [Exiguobacterium sp. AT1b]
          Length = 600

 Score =  447 bits (1149), Expect = e-123,   Method: Composition-based stats.
 Identities = 137/609 (22%), Positives = 265/609 (43%), Gaps = 18/609 (2%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           M+ + +++ +     WNLE +Y + ++ E  +D + ++ +  A    ++G L      ++
Sbjct: 1   MSEVLTRQQVPVEETWNLETIYSNDEAWE--SDFQALKEKVPALIG-FKGRLG-----ES 52

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
             +L  A+   + +   + ++ +YA + Y+ + ++   +       +  +     L F  
Sbjct: 53  AETLYEALQLRDDLSRQLHKLYTYAHMRYDEDTANSHYQALNDRAGSLASQVSAQLAFMT 112

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            E+ ++DE  +E    Q+     Y      +   + H+L+   E +L+    V  ++   
Sbjct: 113 PELLSIDENQIEAFMEQNESLRVYRHAFDELALERPHVLTEAEEAILAQAGDVLGQSSST 172

Query: 204 FFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           F   N   L+F     +      +   +       +DR VR+ A KA+  T+ +  + F+
Sbjct: 173 FGMLNNADLKFPKVKNEKGEEVELTHGRYITFLESADRSVREGAFKAMYGTYAQYLNTFA 232

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
              +   K +      RK+E    S    N +   V + L+++  N      HRY  L+K
Sbjct: 233 STLSGSVKKDNFYATVRKFESARQSALHHNAIPESVYDGLVEA-VNERLDLLHRYVALRK 291

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           + L LD ++ +D   PL    +  + +E A+  ++   A    +   I +      W+D 
Sbjct: 292 RALGLDELHMYDLYTPLVKDVEMKVSYEEAKQWMVDGLAPLGEEYVQIVKDGLESRWVDV 351

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK SGA++ G      P+IL+N+     ++ TLAHE GH +H   +  +Q     +
Sbjct: 352 RETRGKRSGAYSSGAYD-TQPFILMNWQDNVNNLFTLAHEFGHSVHSHYTRTSQPYPYGD 410

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
            S+ +AE AS   E L  D LL+  ++KEER  LL N++E    ++ RQ  F +FE  +H
Sbjct: 411 YSIFVAEVASTTNEALLNDHLLKTRTAKEERLYLLNNQLETFRGTLFRQTMFAEFEHMIH 470

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
              +    +    +NE +LE  K   G    + D E    W  +PHF  + +     A G
Sbjct: 471 QAAQEGVSLTPEYLNETYLELNKRYFGDEIVI-DEEISYEWARIPHFYYNYYVYQY-ATG 528

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                +L            +    N L+AG+S +  E+L    ++++      + L   E
Sbjct: 529 ISASAALSQQIMEEGEPAVRRYIDNFLKAGSSDYPIEVLKAAGVDMTTKEPVLKALDQFE 588

Query: 618 KMIDDVEKM 626
            ++D++E +
Sbjct: 589 AVLDEMESL 597


>gi|332652577|ref|ZP_08418322.1| oligoendopeptidase F [Ruminococcaceae bacterium D16]
 gi|332517723|gb|EGJ47326.1| oligoendopeptidase F [Ruminococcaceae bacterium D16]
          Length = 600

 Score =  446 bits (1148), Expect = e-123,   Method: Composition-based stats.
 Identities = 140/611 (22%), Positives = 259/611 (42%), Gaps = 20/611 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           S   ++  ++ +     WN  DLYP+  +     + + ++  +   +  + G L      
Sbjct: 2   SKQKSIPQRDAIPQEYTWNTADLYPTDKAW--KEEFQTLKSLTQKLEG-YAGRLG----- 53

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
           ++  +L   +   ++  E++ ++  YA    + +    T +     I+ +  +  +   F
Sbjct: 54  ESAQTLYDFVTLEQQAGEMLSKLMDYAQRKSDEDTRVATYQAMVGQISTQYVELVRATAF 113

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              E+  L E  LE+ YAQ P    Y  +  NI++ + H L+   E LL+   ++ +   
Sbjct: 114 EVPELLALPEERLEEFYAQLPELTLYRRYFHNIQRRRPHTLTQAEEQLLAAAGELSQAPD 173

Query: 202 KRFFCENIESLRFKI------NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F       L F            +            DR +RKSA + L   +    + 
Sbjct: 174 DIFSKLTDADLTFPDAVDSQGQAHPLSNGSYTLLMSSPDRALRKSAFENLYSVYGGMKNT 233

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
            +       K  +   + R+Y     +     +V   V   L+ +         HRY  L
Sbjct: 234 LAATLAAQVKQLQFFSKARRYPSALAASLDGTHVPEEVYHNLIST-VRANLDKMHRYVRL 292

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +KK L ++ ++ +D  AP+    +  IP+E A++ V Q+ A    +   I  +   + WI
Sbjct: 293 RKKLLGVEELHMYDVYAPMVSGVEAEIPYEQAKETVYQAVAPLGAEYQAIIRQALDNRWI 352

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SG +  G +  VHPYILLNY      + TLAHELGH +H  LS+ TQ  + 
Sbjct: 353 DVYENVGKRSGGYMSGAL--VHPYILLNYQDDLDSMFTLAHELGHAVHSYLSNRTQPTVY 410

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            +  + +AE AS   E L  + LL+    K  R  L+ + +E    ++ RQ  F +FEL+
Sbjct: 411 RDYVIFVAEVASTCNEALLMEHLLKQTDDKRRRAWLINHFLEQFKGTLYRQTMFAEFELR 470

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +         +    +   +    +   GP   +SD +    W  +PHF   ++YV+ YA
Sbjct: 471 MGELVAQGETLTEELLCREYKALNEAYFGPDM-VSDPQIALEWSRIPHFY-YNYYVFQYA 528

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L +   +      ++ YL  L  G S+   +LL    ++++ P   +  L  
Sbjct: 529 TGYSAAIALANRILTGGPQAVQD-YLTFLSGGCSQDPIDLLKGAGVDMASPQPIQDALDQ 587

Query: 616 VEKMIDDVEKM 626
             +++D++E++
Sbjct: 588 FGRLLDEMEEL 598


>gi|149182738|ref|ZP_01861203.1| oligoendopeptidase F [Bacillus sp. SG-1]
 gi|148849552|gb|EDL63737.1| oligoendopeptidase F [Bacillus sp. SG-1]
          Length = 605

 Score =  446 bits (1147), Expect = e-123,   Method: Composition-based stats.
 Identities = 137/612 (22%), Positives = 273/612 (44%), Gaps = 18/612 (2%)

Query: 21  SSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
            + + ++ +++++     W LED++ S D  E   + + ++         ++G L+    
Sbjct: 4   ETTVKSLPNRKDIKEELTWRLEDIFASDDLWE--KEYKEVQELIKQ-AGSYQGTLS---- 56

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
            ++   L  A+   + + E +GR+ +Y+ + Y+ + ++   +       +          
Sbjct: 57  -ESADHLYKALKFQDEVSERMGRLYTYSHMRYDQDTTNSYYQGLDDRAKSLYTQLSSSFA 115

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           +   EI T++E+ L     ++     Y   ++ I   + H+LS + E LL+  S+V   +
Sbjct: 116 YLVPEILTIEESKLNSFLEENKDLGLYKHALEEINLQRPHILSAEQEALLAQASEVLSSS 175

Query: 201 LKRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              F   N   + F     +      I   +  +     DR VR+ A KA+  T+ K  +
Sbjct: 176 ANTFGMLNNADMEFPSIKDENGEEVEITHGRYIRFLESDDRRVREEAFKAVYKTYGKFQN 235

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
            FS   +   K +      R ++    +   +NN+   V E L+++  N      HRY +
Sbjct: 236 TFSSTLSGTVKKDNFSAEVRNFDSARHAALSANNIPETVYENLVKT-VNDNLHLLHRYIK 294

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+KK L L+ ++ +D   PL    +  I ++ A+D++L        +   + ++ F + W
Sbjct: 295 LRKKVLGLEKLHMYDLYTPLVKEVKMEISYDEAKDMILDGLTPLGDEYINLLKEGFENRW 354

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + + Q   
Sbjct: 355 VDVVENKGKRSGAYSSG-AYGTNPYILMNWQDNVNNLFTLAHEFGHSVHSYYTRKFQPYP 413

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
             N S+ +AE AS   E L    LL     +++R  LL + +E    ++ RQ  F +FE 
Sbjct: 414 YGNYSIFVAEVASTCNEALLNHYLLNTIDEEKKRLYLLNHYLEGFRGTVFRQTMFAEFEH 473

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
            +H + +    +    +++ + E  K+  G      D E G  W  +PHF  + +     
Sbjct: 474 IIHKKAQEGEALTAEMLSKEYYELNKKYFGEEDITIDEEIGLEWARIPHFYYNYYVYQY- 532

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     +L             E+Y+  L++G+S +  E+L    ++++     E  ++
Sbjct: 533 ATGFSAATALSKQILEEGQPAV-ERYIEFLKSGSSDYPIEVLKKAGVDMTVSQPIEEAMK 591

Query: 615 TVEKMIDDVEKM 626
             E+ ++++EKM
Sbjct: 592 VFEESLNEMEKM 603


>gi|218290987|ref|ZP_03495035.1| oligoendopeptidase F [Alicyclobacillus acidocaldarius LAA1]
 gi|218239069|gb|EED06273.1| oligoendopeptidase F [Alicyclobacillus acidocaldarius LAA1]
          Length = 609

 Score =  446 bits (1147), Expect = e-123,   Method: Composition-based stats.
 Identities = 144/605 (23%), Positives = 272/605 (44%), Gaps = 19/605 (3%)

Query: 28  DSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSL 87
            +++ +    RWNLED+YP  +      D + +   +  F   + G L       +  +L
Sbjct: 14  KARQEIDPEFRWNLEDIYPDQEEWR--KDADRVRALAEQFV-YFRGQL-----NASGETL 65

Query: 88  GAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEIN 147
             A+  ++ + +++ ++  YA +  + + +    +  + +     A+ + +  FF  E+ 
Sbjct: 66  LHALRAHDEVSQILWKLFVYAKMKLDEDTTESWRQALFAEAQRLAAEIQALTSFFYPELV 125

Query: 148 TLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCE 207
            L    +E           Y  +++   + + H+L+ + E LL+  S+V     + F   
Sbjct: 126 QLSPEQVEGWLETVEGLGLYRFFLEETLRQRDHVLTPEQEELLAQFSEVLHAPSEIFEMY 185

Query: 208 NIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITN 261
           N     F +         ++     ++     DR VR+ A  A+  T+ K  +  + +  
Sbjct: 186 NNADTVFPVIRDENGEDVQVTHALYHELLERRDRGVRERAFHAVYDTYKKHRNTIAALYA 245

Query: 262 TLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLK 321
              K   +  R R+Y    D+   ++ +   V E L+++V+         Y  L+K+ L 
Sbjct: 246 ASVKRNVVNARVRRYPSALDAALDADRIPRSVYENLIRAVRES-VPVLQSYLALRKRALG 304

Query: 322 LDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYD 381
           LD ++ WD   PL G     +P+  AR+ VL++   F    +  A +     W+D  +  
Sbjct: 305 LDELHMWDLYVPLVGEIDWKVPYAEARETVLKAVQVFGDTYASAAREGLYGRWVDVYETR 364

Query: 382 GKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLT 441
           GK SG ++ GT    HPYILLNY    QD+ TLAHELGH +H   S +TQ  + ++ ++ 
Sbjct: 365 GKRSGGYSWGT-YGTHPYILLNYTDSVQDMFTLAHELGHSMHSYFSRKTQPYIYSDYTIF 423

Query: 442 LAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERR 501
           +AE AS   E + +D LL        R  LL  ++E +  ++V Q  + +FE + H    
Sbjct: 424 VAEVASTVNEAILYDDLLGREQDPLRRAYLLNRQVETIRTTLVAQTLYAEFEKRTHERIE 483

Query: 502 STGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLV 561
           S G I    ++E++ E  +    P   + D +    WM +PHF  + FYVY YA G    
Sbjct: 484 SGGAITADWLDEVFYELNQAYYAPEVAVDD-DIAHGWMRIPHFYSA-FYVYKYATGISAA 541

Query: 562 NSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMID 621
            +L +  +    +    +YL  L +G+S    ELL    ++++      + L+   ++ +
Sbjct: 542 LALVEKIRREGDEAVA-RYLQFLSSGSSNTSIELLRMAGVDMTSDAPVRQALERFGRLTE 600

Query: 622 DVEKM 626
           ++ ++
Sbjct: 601 ELGEL 605


>gi|258510737|ref|YP_003184171.1| oligoendopeptidase F [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|257477463|gb|ACV57782.1| oligoendopeptidase F [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 609

 Score =  446 bits (1146), Expect = e-123,   Method: Composition-based stats.
 Identities = 144/605 (23%), Positives = 273/605 (45%), Gaps = 19/605 (3%)

Query: 28  DSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSL 87
            +++ +    RWNLED+YP  ++     D + +   + AF  ++ G L       +  +L
Sbjct: 14  KARQEIDPEFRWNLEDIYPDQEAWR--KDADRVRALAEAFV-QFRGRLNT-----SGETL 65

Query: 88  GAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEIN 147
             A+  ++ + +++ ++  YA +  + + +    +  + +     A+ +    FF  E+ 
Sbjct: 66  LHALRAHDELSQILWKLFVYAKMKLDEDTTESWRQALFAEAQRLAAEIQATTSFFYPELV 125

Query: 148 TLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCE 207
            L    +E           Y  +++   + + H+L+ + E LL+  S+V     + F   
Sbjct: 126 QLSPEQVEGWLETVEGLGLYHFFLEETLRQRDHVLTPEQEELLAQFSEVLHAPSEIFEMY 185

Query: 208 NIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITN 261
           N     F +         ++     ++     DR VR+ A  A+  T+ K  +  + +  
Sbjct: 186 NNADTVFPVIRDENGEDVQVTHALYHELLERRDRGVRERAFHAVYDTYKKHRNTIAALYA 245

Query: 262 TLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLK 321
              K   +  R R+Y    D+   ++ +   V E L+++V+         Y  L+K+ L 
Sbjct: 246 ASVKRNAVNARVRRYPSALDAALDADRIPRSVYENLIRAVRES-LPALQSYLALRKRALG 304

Query: 322 LDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYD 381
           LD +  WD   PL G     +P+  AR+ VL++   F    +  A +     W+D  +  
Sbjct: 305 LDELRMWDLYVPLVGEIDWKVPYAEARETVLKAVQVFGDTYASAAREGLYGRWVDVYETR 364

Query: 382 GKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLT 441
           GK SG ++ GT    HPYILLNY    QD+ TLAHELGH +H   S +TQ  + ++ ++ 
Sbjct: 365 GKRSGGYSWGT-YGTHPYILLNYTDSVQDMFTLAHELGHSMHSYFSRKTQPYIYSDYTIF 423

Query: 442 LAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERR 501
           +AE AS   E + +D LL        R  LL  ++E +  ++V Q  + +FE + H    
Sbjct: 424 VAEVASTVNEAILYDDLLGREQDPLRRAYLLNRQVETIRTTLVAQTLYAEFEKRTHERIE 483

Query: 502 STGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLV 561
           S G I    ++E++ +  +    P   + D +    WM +PHF  + FYVY YA G    
Sbjct: 484 SGGAITADWLDEVFYDLNRAYYAPEVAVDD-DIAHGWMRIPHFYSA-FYVYKYATGISAA 541

Query: 562 NSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMID 621
            +L +  +    +    +YL  L +G+S    ELL    ++++      + L+   ++  
Sbjct: 542 LALVEKIRREGDEAVA-RYLQFLSSGSSNTSIELLRMAGVDMTSDAPVRQALERFARLTA 600

Query: 622 DVEKM 626
           +++++
Sbjct: 601 ELDEL 605


>gi|326203947|ref|ZP_08193809.1| oligoendopeptidase F [Clostridium papyrosolvens DSM 2782]
 gi|325986045|gb|EGD46879.1| oligoendopeptidase F [Clostridium papyrosolvens DSM 2782]
          Length = 601

 Score =  445 bits (1145), Expect = e-123,   Method: Composition-based stats.
 Identities = 145/608 (23%), Positives = 266/608 (43%), Gaps = 19/608 (3%)

Query: 25  TTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC 84
            T+  ++++ +  +W LED+Y   DS E   D + ++  +      ++G L +     + 
Sbjct: 5   KTLPKRKDIEDRFKWKLEDIYKDTDSWE--KDFKAVKDLAAQM-GNFQGKLGN-----SA 56

Query: 85  HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL 144
            +L     + + +  L  ++  YA +  + +  + T +      +    +    + F   
Sbjct: 57  DTLLDCFKKSDELLSLNDKVFVYARMKRDEDNGNSTYQALTDRASTLGTEVYTAISFIIP 116

Query: 145 EINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRF 204
           E+  + E  L      +     Y   ++   + K+H+LS   E +L+ ++++   A   F
Sbjct: 117 EMLAIPEDKLLSFINSNKELSLYMFMVQENLRQKEHILSEKEEQILALSTEISDTAGDIF 176

Query: 205 FCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSF 258
              N   ++F     +      +   +        DR VRK A +A+  T++K  +    
Sbjct: 177 TMYNNADIKFPHIRDEKGEDVEVTKGRYSTMLESRDRRVRKDAFEAVYGTYDKMKNTLGA 236

Query: 259 ITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKK 318
                 K        RKY    ++   ++NV   V + L+    N       RY +L+KK
Sbjct: 237 SLTGNVKKNRFYSVVRKYPSSLEASLDNDNVSVEVYDNLI-ETVNKNLHLLDRYLKLRKK 295

Query: 319 WLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAP 378
            LKLD ++ +D   P+       + +E  + LV +       +     +  F   W+D  
Sbjct: 296 VLKLDELHMYDLYVPMVEEYDKKVTYEEGKKLVEEGLKPLGEEYIGYLKNGFDSGWVDIY 355

Query: 379 QYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNS 438
           +  GK SGA++ G     HPY+LLNY     DV TLAHE+GH +H   ++ TQ  + +  
Sbjct: 356 ENQGKTSGAYSWGAFK-THPYVLLNYQDNINDVYTLAHEMGHALHSYYTNMTQPYVYSQY 414

Query: 439 SLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHT 498
            + +AE AS   E+L    +L  + SK+E+  LL + +E+   ++ RQ  F +FE  +H 
Sbjct: 415 KIFVAEVASTVNESLLMRYMLSKSESKQEKAYLLNHYLEEFRGTVFRQTMFAEFEKLIHQ 474

Query: 499 ERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGN 558
           +      +    + +I+    K+  G A ++ D E    W  +PHF  S FYVY YA G 
Sbjct: 475 KTEQGEALNAQELCDIYYSLNKKYFGEAVNV-DKEIAMEWSRIPHFYSS-FYVYKYATGF 532

Query: 559 CLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
               ++ +           +KYL  L+ G S +  ELL    ++LS P   +  L   EK
Sbjct: 533 SAATAIAEKIYKEGKPAV-DKYLEFLKGGGSNYPIELLKIAGVDLSSPQPIQDALNVFEK 591

Query: 619 MIDDVEKM 626
            ++++E++
Sbjct: 592 TLEELEQL 599


>gi|331701044|ref|YP_004398003.1| oligoendopeptidase F [Lactobacillus buchneri NRRL B-30929]
 gi|329128387|gb|AEB72940.1| oligoendopeptidase F [Lactobacillus buchneri NRRL B-30929]
          Length = 603

 Score =  445 bits (1144), Expect = e-122,   Method: Composition-based stats.
 Identities = 144/609 (23%), Positives = 261/609 (42%), Gaps = 20/609 (3%)

Query: 25  TTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC 84
             +  ++++     W+L  +YP+   QE   D E ++  +  F     G +     +K+ 
Sbjct: 5   QELPLRKDVPEELTWDLTTIYPT--DQEFETDYEAVQTGAKQF-AELAGTI-----EKSA 56

Query: 85  HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL 144
            +L  A      +   + ++  YA L  + + S    +  Y+   +  A F     +F  
Sbjct: 57  AALLTATERLMTLSRKLEKVYVYAQLKNDQDTSEDKYQAMYSRAESLGAQFGAATAWFEP 116

Query: 145 EINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRF 204
           E+  + +  ++Q Y   P    Y  +     K + H+LSND+E +L+    +     K F
Sbjct: 117 ELLKVSDDQIKQFYQDQPKLADYRRFFDQTFKRRNHILSNDVEAVLAGAGDIFSSGEKTF 176

Query: 205 FCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSF 258
              +   L F           K+           + + VRK A + L   + +  H  + 
Sbjct: 177 GILDNTDLSFPAVTDENGNQVKLSQGVYGILLESTKQSVRKEAFEKLYQVYRQFQHTLAA 236

Query: 259 ITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKK 318
              T  K+   +   R Y    ++    N V   V   L+  V N +    HRY  L+KK
Sbjct: 237 TLTTNVKNHNFKANIRHYNNALEAALADNEVPTDVYNNLI-KVVNEHLDLLHRYVALRKK 295

Query: 319 WLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAP 378
            L LD ++ +D    L G       FE ++ + L++     P      ++ F + WID  
Sbjct: 296 ILGLDELHMYDMYTSLVGKKSPKYTFEQSKQIALEALQVMGPDYVSHVKEEFNNRWIDVV 355

Query: 379 QYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNS 438
           +   K SG ++ GT    +PYILLN+     ++ TL HE GH +H   S   Q     + 
Sbjct: 356 ENQFKRSGGYSSGTYD-TNPYILLNWKDNLDNLYTLIHETGHSMHSYYSHHNQPYQYGDY 414

Query: 439 SLTLAETASIFGETLTFDSLLQAA-SSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
           S+ +AE AS   E +  D LL       E +K +L   ++    ++ RQ  F +FE  +H
Sbjct: 415 SIFVAEIASTTNENILTDYLLNKFKDDDEMKKFILNYYLDGFKGTVFRQTQFAEFEQYIH 474

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
            +      +  + +++ +    ++  G A  +SD + G  W  +PHF   +FYVY Y+ G
Sbjct: 475 EQDAKGQPLTANFMDDYYRNLNQKYYGDAV-ISDPQIGLEWSRIPHFY-YNFYVYQYSTG 532

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
               ++L D    N      +KYLN L++G+S   + ++    ++++ P + E+  Q  E
Sbjct: 533 FAAASTLADGIV-NGGQANVDKYLNYLKSGSSDTPTNVMKKAGVDMTQPEYLEKAFQIFE 591

Query: 618 KMIDDVEKM 626
           + +D+ E++
Sbjct: 592 QRLDEFERL 600


>gi|331268927|ref|YP_004395419.1| oligoendopeptidase F [Clostridium botulinum BKT015925]
 gi|329125477|gb|AEB75422.1| oligoendopeptidase F [Clostridium botulinum BKT015925]
          Length = 596

 Score =  444 bits (1141), Expect = e-122,   Method: Composition-based stats.
 Identities = 143/608 (23%), Positives = 272/608 (44%), Gaps = 20/608 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           +++T + +++ +    +W++E +Y +    E   D   ++ ++  F+  ++G L+     
Sbjct: 2   TEVTRLKTRDEIEADDKWDIEKVYSTTKEWE--EDFNKLKEKAKGFEE-FKGKLS----- 53

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            + + L   +   E +  L  ++  YA L  + + ++   +   T I    ++   +  F
Sbjct: 54  -DPNKLLGFLKLDEEVSRLGEKLLVYAFLKGDEDTANNANQALKTKIEMYFSELSSLSAF 112

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
           F  EI + D+ ++E +  + P    Y   ++ I K K H L+  ME +L+  S       
Sbjct: 113 FVPEILSYDKKVIEDAINKLPELKVYELMLERILKRKPHTLTTQMEEMLATVSDALNAPS 172

Query: 202 KRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F       + F +   +      +            D  VR+SA KAL +T+    + 
Sbjct: 173 NIFSILTNADMTFPVIKDEEGKDVELTEGNYSIFIKSKDIRVRESAFKALFNTYKHFKNT 232

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
            +       K+     + RKY    +S    N++   V + +++++      + HRY ++
Sbjct: 233 LATSLTASIKNFSFMAKTRKYNSSIESSLEPNDIPIEVYDNVIKTINEN-LDSLHRYVKI 291

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           KKK L LD ++ +D   P+  T +  I F  A ++V ++      +   I        WI
Sbjct: 292 KKKLLGLDEIHMYDLYVPVIDTPKAHIEFSKAVEMVNEALKPLGDEYLKIFNNGIKDRWI 351

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK  GA++ GT  ++ PY+LLNY  +  DV TLAHE+GH IH   S + Q    
Sbjct: 352 DIYENKGKRKGAYSWGTYDTM-PYVLLNYNYELNDVSTLAHEMGHSIHSYYSRKEQPYAY 410

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            N +L  AE AS   E L  + L++  + + ++  L+  ++E +  ++ RQ+ F +FE  
Sbjct: 411 ANYTLFCAEVASTVNENLLINDLIKKETDENKKLYLINTQLEQIRTTVFRQVMFAEFEKT 470

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
            H +  +   + +  + +I+ +   +  GP   + D E    W  +PHF  S FYVY YA
Sbjct: 471 THEKIDNGEPLTSDELCKIYHDLNVKYFGPDMII-DEEIDMEWARIPHFY-SDFYVYQYA 528

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G    NS          +   EKY   L+AG S +   +L    ++++ P   +  +  
Sbjct: 529 TGYSAANSFVKQILDKGEEAV-EKYKGFLKAGGSDYPINILKKAGVDMTTPKPIQDTINR 587

Query: 616 VEKMIDDV 623
             +++D +
Sbjct: 588 FNELLDML 595


>gi|323706078|ref|ZP_08117647.1| oligoendopeptidase F [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323534522|gb|EGB24304.1| oligoendopeptidase F [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 599

 Score =  444 bits (1141), Expect = e-122,   Method: Composition-based stats.
 Identities = 144/608 (23%), Positives = 283/608 (46%), Gaps = 20/608 (3%)

Query: 25  TTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC 84
             +  ++++ +  +W LED+Y S   +E ++D +  +       + ++G +      K+ 
Sbjct: 3   KKLKDRKDIDDKYKWKLEDIYES--DKEWNDDFDKAKKIIRQL-SDFKGKI------KDS 53

Query: 85  HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL 144
            SL   +   + +  +I ++  YA +  + + S+   +           +      F A 
Sbjct: 54  ESLLNVLKLNDALQMIIEKLFVYARMKRDEDNSNGKYQALTDKAMRINIEASSATSFIAP 113

Query: 145 EINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRF 204
           EI ++DE +L+    ++   + Y  +++++ + K H LS+  E +L+++  +       F
Sbjct: 114 EILSMDEKILKSCIEENADFIDYRHFLEDLLRYKPHTLSDKEEMILAESEVMAHSPENIF 173

Query: 205 FCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSF 258
              +   +RF   + +      +      +     DR VRK + ++L   +   ++ ++ 
Sbjct: 174 KMLDNADIRFPSIEDEDGDLVELTHGNYIRFISSKDRNVRKKSFESLYSVYKNFANTYAA 233

Query: 259 ITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKK 318
           +T++  K +    + R Y    ++    +NV   V + L++++        HRY  L+K+
Sbjct: 234 MTDSNVKKDVFYSKIRNYSTSLEASLFDDNVPVSVYDNLIEAIHEKI-NLLHRYVSLRKR 292

Query: 319 WLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAP 378
            L LD ++ +D   PL         +E A+D+VL++      +   I  + F   WID  
Sbjct: 293 MLNLDELHMYDLYVPLVADFDKEYEYEEAKDIVLKALEPLGNEYVSILREGFDSRWIDVY 352

Query: 379 QYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNS 438
           +  GK SGA++ GT   VHP++LLN+ GK  DV T+AHE+GH +H   S + Q  + ++ 
Sbjct: 353 ENRGKTSGAYSWGT-YGVHPFVLLNFQGKLDDVFTIAHEMGHSLHTYYSDKAQKYINSHY 411

Query: 439 SLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHT 498
            + +AE AS   E++  D LL+ A  K E+  LL + +E    +I RQ+ F +FE   H 
Sbjct: 412 KIFVAEVASTCNESILIDYLLKNARDKSEKLYLLNHYLEQFKGTIFRQVMFAEFEKYTHE 471

Query: 499 ERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGN 558
           E      +   ++ + + E  +   G    + D E    W  +PHF  S FYVY YA G 
Sbjct: 472 EAEKGEALTAEKLCKKYHELNQFYYGNDIIVDD-EIDYEWERIPHFYSS-FYVYKYATGF 529

Query: 559 CLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
               +L  +  +   D   ++Y+  L++G S +   +L    ++L+        L   E 
Sbjct: 530 SAAVALSQMILNEG-DAAVKRYIEFLKSGGSDYPLNILKKAGVDLTTKKPVLDALTVFEN 588

Query: 619 MIDDVEKM 626
           ++D++E++
Sbjct: 589 VLDEMERL 596


>gi|168206357|ref|ZP_02632362.1| oligoendopeptidase F [Clostridium perfringens E str. JGS1987]
 gi|170662204|gb|EDT14887.1| oligoendopeptidase F [Clostridium perfringens E str. JGS1987]
          Length = 599

 Score =  443 bits (1140), Expect = e-122,   Method: Composition-based stats.
 Identities = 143/611 (23%), Positives = 277/611 (45%), Gaps = 20/611 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           S++  +  ++ +    +W ++ +Y +      + ++  ++ E+   K  +EG L      
Sbjct: 2   SEVKKLRRRDEIPESDKWRIDKIYETPAKW--NEELNKLKEEAPKLK-DFEGKLG----- 53

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            N   L A +   E++   +G++  YA +  + + S+P ++     I+   A+F     +
Sbjct: 54  -NKEDLKAFLLLNEKLSRKLGKLYVYAHMRSHEDTSNPEMQSLVNKIDPYSAEFSSYTAY 112

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
           F  EI +L E  +E    +D    +Y  + + I   K H+LS ++E +L+  S       
Sbjct: 113 FVPEILSLKEGTIENFINEDKDLKQYKIYFEMILNEKPHILSKEVESVLASVSDCLGAPE 172

Query: 202 KRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             +       + F     +      +            DR+VR++A K L  T+ K  + 
Sbjct: 173 SIYSMLTNSDMTFGEIVDESGRKVELTEGNYSSFIKSKDRKVREAAFKLLFGTYKKYENT 232

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
            +    +  K+   + + RKY    ++    NN+   V    +++  +   +  HRY  +
Sbjct: 233 LATSLTSSIKNFVFESKTRKYNSSLEASLKPNNIPVEVYYNALKT-VDGNIEALHRYVRI 291

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           KKK L L+ ++ +D   P+    ++ + ++ A  LV +       +   I  +     WI
Sbjct: 292 KKKLLNLEEIHMYDLYVPVIECKKEHLEYKDAISLVEEGLKPLGKEYLDIFNEGINEGWI 351

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G+  ++ PY+LLNY  +  D  TLAHE+GH IH   + +TQ  + 
Sbjct: 352 DVYENKGKRSGAYSWGSYDTM-PYVLLNYNYELNDASTLAHEMGHSIHSYYTRKTQPYIY 410

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + SL  AE AS   E L    L++  + K ++  L+  ++E +  ++ RQ+ F +FELK
Sbjct: 411 GDYSLFCAEVASTTNEILLIHHLIEKETDKNKKLYLINQELEQIRTTVFRQLMFAEFELK 470

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
            H    +   + +  + ++W +   +  G   ++ D E    W  +PHF  S FYVY YA
Sbjct: 471 THEAIENGESLTSEVLCKMWKDINIKYFGEDMNV-DEEISIEWARIPHFY-SDFYVYQYA 528

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G    +S  +   S   +   EKY   L+AG S +  + L    ++++     +  L  
Sbjct: 529 TGYAAASSFANSILSKGEEAV-EKYKGFLKAGGSMYPIDTLKMAGVDMTTSKPLKDTLDR 587

Query: 616 VEKMIDDVEKM 626
             +++D +E++
Sbjct: 588 FNELLDMLEEI 598


>gi|261408405|ref|YP_003244646.1| oligoendopeptidase F [Paenibacillus sp. Y412MC10]
 gi|261284868|gb|ACX66839.1| oligoendopeptidase F [Paenibacillus sp. Y412MC10]
          Length = 596

 Score =  443 bits (1140), Expect = e-122,   Method: Composition-based stats.
 Identities = 141/609 (23%), Positives = 254/609 (41%), Gaps = 21/609 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           M  +  + ++    +W LEDL+    +         +++        ++G L       N
Sbjct: 1   MEQLLKRADVPKEHQWKLEDLFADQKAW--DASFAELKNLLKR-TADYQGKLN------N 51

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
             S+       + I     R+  YA + ++ + ++PT +           +  + L F  
Sbjct: 52  AASIKECFELEDEISYHAERLYVYAHMHHDEDTANPTYQALTAKAKKLNVEAGEALSFIT 111

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            EI +L EA L++   +DP   ++   +  +++ K H+LS   E LL+    +       
Sbjct: 112 PEILSLSEAELDKLI-EDPTLKEFKFTLTEMKREKAHVLSKTEEALLAQVGNLSSAPQTI 170

Query: 204 FFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           F   N   ++F     +      +      +     +REVR+ A KA+  T+ K  +  +
Sbjct: 171 FGMLNNADMKFPKIKNEDGKDVELTHGNYIQFLESPNREVRERAFKAVYETYGKQKNTIA 230

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
              N          R RKY  + +     +N+   V   L+ ++        HRY EL+K
Sbjct: 231 ATLNANVNKNMFYSRVRKYPSVLEMALYGDNIPKEVYTNLIDTIHES-LPLLHRYMELRK 289

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           K L +D ++ +D  APL    +  I +E A+ +  +             ++ + + WID 
Sbjct: 290 KLLGVDELHMYDLFAPLVEEYKWDITYEEAKQMTKEGLTPLGDDYLSSLQEGYDNGWIDV 349

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            + + K +GA++ G     HPY+LLN+      + TLAHE+GH +H   S          
Sbjct: 350 YENENKRTGAYSWG-AYGTHPYVLLNHKDNLNSMFTLAHEMGHALHSYYSDNALKYRDAQ 408

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
            ++ LAE AS   E L  D LL+ A   +++  LL    +    ++ RQ  F +FE  +H
Sbjct: 409 YTIFLAEVASTTNEALLMDYLLKNAKDPKQKMYLLTYYADQFRTTVFRQTMFAEFEKIVH 468

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
               S   +    +++I+ E   +  G    + D E G  W  +PHF  S FYVY YA G
Sbjct: 469 ERVESGESLTPQDLSDIYYELNVKYHGKGMQV-DKEIGMEWARIPHFYNS-FYVYKYATG 526

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                S              ++YL  L++G S +   +L    +++S P      +   E
Sbjct: 527 FSAATSFSKQILEEGQPAV-DRYLGFLKSGGSDYSINILKKAGVDMSSPEPIREAMSVFE 585

Query: 618 KMIDDVEKM 626
            +I+ +E++
Sbjct: 586 DVINQMEQL 594


>gi|304317085|ref|YP_003852230.1| oligoendopeptidase F [Thermoanaerobacterium thermosaccharolyticum
           DSM 571]
 gi|302778587|gb|ADL69146.1| oligoendopeptidase F [Thermoanaerobacterium thermosaccharolyticum
           DSM 571]
          Length = 599

 Score =  443 bits (1140), Expect = e-122,   Method: Composition-based stats.
 Identities = 144/608 (23%), Positives = 273/608 (44%), Gaps = 20/608 (3%)

Query: 25  TTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC 84
             +  ++++ +  +W LED+Y S   +E + D +          + + G +      K+ 
Sbjct: 3   KKLKDRKDINDRYKWRLEDIYES--DKEWNEDFDKARRLIGEL-SNFRGKI------KDE 53

Query: 85  HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL 144
            SL   +   E++  +  R+  +A +  + + S+   +           +      F   
Sbjct: 54  KSLLDVLKLNEKLSMITERLFVFARMKRDEDNSNGKYQALADKAMRLNIESSSAASFILP 113

Query: 145 EINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRF 204
           EI ++DE ++      +     Y  +++++ + K H L+   E +L++++ + +     F
Sbjct: 114 EILSMDEGIIRGCIENNKDFEDYRHFLEDLLRYKPHTLTEREEMILAESAVMAQAPGNIF 173

Query: 205 FCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSF 258
              +   +RF   + +      +      K    SDR VRK A ++L   +    + ++ 
Sbjct: 174 KMLDNADIRFPAIENEDGDYVELTHGNFIKFMSSSDRNVRKRAFQSLYGVYKSFVNTYAS 233

Query: 259 ITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKK 318
            T++  K +    + R Y+   ++    +NV   V   L+ ++        HRY  L+K+
Sbjct: 234 TTDSNVKKDIFYSKMRNYKTSLEASLFDDNVPIDVYNNLIDAIHERI-DLLHRYVSLRKR 292

Query: 319 WLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAP 378
            L LD ++ +D   PL         +E A+++VL+       +   I ++ F ++WID  
Sbjct: 293 MLNLDELHMYDLYVPLVENYDKEYDYEEAKNIVLKGLEPLGDEYIDILKEGFNNHWIDVY 352

Query: 379 QYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNS 438
           +  GK SGA++ GT   VHPY+LLN+ GK  DV T+AHE+GH +H   S + Q  + +  
Sbjct: 353 ENRGKTSGAYSWGT-YGVHPYVLLNFQGKLDDVFTIAHEMGHSLHTYYSDKAQKYINSQY 411

Query: 439 SLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHT 498
            + +AE AS   E +  D L++ A  K E+  LL + +E    +I RQ+ F +FE   H 
Sbjct: 412 KIFVAEVASTCNEAILIDYLIKNAKDKNEKLYLLNHYLEQFKGTIYRQVMFAEFEKFTHE 471

Query: 499 ERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGN 558
           E      +   ++ + + E  K   G    + D E    W  +PHF  S FYVY YA G 
Sbjct: 472 EVEKGESLTPEKLCKKYHELNKFYYGNDIVIDD-EIDYEWERIPHFYTS-FYVYKYATGF 529

Query: 559 CLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
               +L  +  +   D   E+Y   L++G S +   +L    ++L+        L   E 
Sbjct: 530 SAATALSQMILNEG-DVAVERYKEFLKSGGSDYPLNILKKAGVDLTTKKPILDALDVFES 588

Query: 619 MIDDVEKM 626
           ++D+++ +
Sbjct: 589 ILDEIDGL 596


>gi|310641345|ref|YP_003946103.1| oligoendopeptidase f [Paenibacillus polymyxa SC2]
 gi|309246295|gb|ADO55862.1| Oligoendopeptidase F [Paenibacillus polymyxa SC2]
          Length = 598

 Score =  443 bits (1139), Expect = e-122,   Method: Composition-based stats.
 Identities = 139/609 (22%), Positives = 254/609 (41%), Gaps = 21/609 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           M+ +  + +      W LEDL+P+  +     + E ++  +     +++G L       +
Sbjct: 1   MSEIVKRADAPVENTWKLEDLFPNRKAW--DQEYEEVKQLAKK-AAQFQGKLN------S 51

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
             ++G      + +     R+  YA L ++ + + PT +           +  + L F  
Sbjct: 52  AEAIGNCFKLEDELSLKTERVYVYAHLHHDEDTAEPTYQGLSQKAKKLGVEVSESLSFVT 111

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            EI  L ++ L+    +DP    Y   ++ +++ K H+L    E LL+    + +     
Sbjct: 112 PEILALPDSQLDAFI-EDPKLSDYKFTLQEMKREKAHVLGKTEEALLAQVGNLAQAPQTI 170

Query: 204 FFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           F   N   L+F     +      +      +      REVR+ A KA+  T+ K+ +  +
Sbjct: 171 FGMLNNADLKFPKIKDEHGKEVELTHGSYIQFLESPHREVRERAFKAVYDTYAKNKNTIA 230

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
              +          R RKY  + +     +N+   V   L+ ++        HRY +L+K
Sbjct: 231 STLSANVNKNIFYSRVRKYPSVLEMSLYGDNIPKEVYTNLIDTIHES-LPLLHRYIKLRK 289

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           K L +D ++ +D  APL    +  I +E A+    +             +K +   WID 
Sbjct: 290 KLLGVDELHMYDLFAPLVDEYKMDITYEDAKKQTKEGLKPLGEDYLASLQKGYDERWIDV 349

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            + + K +GA++ G     HPY+LLN+      + TLAHE+GH +H   S          
Sbjct: 350 YENENKRTGAYSWG-AYGTHPYVLLNHKDNLNSMFTLAHEMGHALHSYYSDNALKYRDAQ 408

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
            ++ LAE AS   E L  D LL  ++  +E+  LL    +    ++ RQ  F +FE  +H
Sbjct: 409 YTIFLAEVASTTNEALLMDYLLNKSTDPKEKMYLLTYYADQFRTTVFRQTMFAEFEKIVH 468

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
                   +    ++EI+ +   +  GP   + D +    W  +PHF  S FYVY YA G
Sbjct: 469 ERAEQGESLTPQLLSEIYYDLNVKYHGPGMKV-DKDIEMEWARIPHFYNS-FYVYKYATG 526

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                S              ++YL  L++G S +   +L    +++S P      +   E
Sbjct: 527 FSAATSFSKQILEEGQPAV-DRYLGFLKSGGSDYSINILKKAGVDMSSPQPIREAMSVFE 585

Query: 618 KMIDDVEKM 626
           ++I ++EK+
Sbjct: 586 EVITEMEKL 594


>gi|168210043|ref|ZP_02635668.1| oligoendopeptidase F [Clostridium perfringens B str. ATCC 3626]
 gi|170711856|gb|EDT24038.1| oligoendopeptidase F [Clostridium perfringens B str. ATCC 3626]
          Length = 599

 Score =  443 bits (1139), Expect = e-122,   Method: Composition-based stats.
 Identities = 143/611 (23%), Positives = 275/611 (45%), Gaps = 20/611 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           S++  +  ++ +    +W ++ +Y +      + ++  ++ E+   K  +EG L      
Sbjct: 2   SEVKKLRRRDEIPESDKWRIDKIYETPAKW--NEELNKLKEEAPKLK-DFEGKLG----- 53

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            N   L A +   E++   +G++  YA +  + + S+P ++     I+   A+F     +
Sbjct: 54  -NKEDLKAFLLLNEKLSRKLGKLYVYAHMRSHEDTSNPEMQSLVNKIDPYSAEFSSYTAY 112

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
           F  EI +L E  +E    +D    +Y  + + I   K H+LS ++E +L+  S       
Sbjct: 113 FVPEILSLKEGTIENFINEDKDLKQYKIYFEMILNEKPHILSKEVESVLASVSDCLGAPE 172

Query: 202 KRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             +       + F     +      +            DR+VR+ A K L  T+ K  + 
Sbjct: 173 SIYSMLTNSDMTFGEIVDESGRKVELTEGNYISFIKSKDRKVREVAFKLLFGTYKKYENT 232

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
            +    +  K+   + + RKY    ++    NN+   V    +++  +      HRY  +
Sbjct: 233 LATSLTSSIKNFVFESKTRKYNSSLEASLKPNNIPVEVYYNALKT-VDENMDALHRYVRI 291

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           KKK L L+ ++ +D   P+    ++ + ++ A  LV +       +   I  +     WI
Sbjct: 292 KKKLLNLEEIHMYDLYVPVIECKKEHLEYKDAISLVEEGLKPLGKEYLDIFNEGINEGWI 351

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G+  ++ PY+LLNY  +  D  TLAHE+GH IH   + +TQ  + 
Sbjct: 352 DVYENKGKRSGAYSWGSYDTM-PYVLLNYNYELNDASTLAHEMGHSIHSYYTRKTQPYIY 410

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + SL  AE AS   E L    L++  + K ++  L+  ++E +  ++ RQ+ F +FELK
Sbjct: 411 GDYSLFCAEVASTTNEILLIHHLIEKETDKNKKLYLINQELEQIRTTVFRQLMFAEFELK 470

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
            H    +   + +  + ++W +   +  G   ++ D E    W  +PHF  S FYVY YA
Sbjct: 471 THEAIENGESLTSEVLCKMWKDINIKYFGEDMNV-DEEISIEWARIPHFY-SDFYVYQYA 528

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G    +S  +   S   +   EKY   L+AG S +  + L    ++++     +  L  
Sbjct: 529 TGYAAASSFANSILSKGEEAV-EKYKGFLKAGGSMYPIDTLKMAGVDMTTSKPLKDTLDR 587

Query: 616 VEKMIDDVEKM 626
             +++D +E++
Sbjct: 588 FNELLDMLEEI 598


>gi|315639725|ref|ZP_07894864.1| oligoendopeptidase F [Enterococcus italicus DSM 15952]
 gi|315484502|gb|EFU74959.1| oligoendopeptidase F [Enterococcus italicus DSM 15952]
          Length = 605

 Score =  443 bits (1139), Expect = e-122,   Method: Composition-based stats.
 Identities = 134/611 (21%), Positives = 269/611 (44%), Gaps = 19/611 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           S++  +  +E +     W+L  ++ S ++         ++ E       ++G L +    
Sbjct: 2   SEVQQLPIREEVPEALTWDLTKIFASDEA--FEAAFATVQEELKE-ADTYKGTLTN---- 54

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
               +  +AI     I   +  +  Y+ L  + + ++ T +          A     L +
Sbjct: 55  -GASAFLSAIDYLLSISRKLETLYVYSHLKNDQDTANTTYQALNARATNLAAQVGAALSW 113

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
           F  E+ +L + ++   + ++     Y  +I+ I   + H+L  + E LL+ + ++     
Sbjct: 114 FEPEVLSLADDVIWGYFDEEAALAPYRHFIETIVANRDHVLPAEQEELLAASGEIFGSPS 173

Query: 202 KRFFCENIESLRFKINDQKIPLTKAYKS------FFDSDREVRKSAAKALSHTFNKSSHI 255
           K F   N   L F     +   T              ++R+VR++A K L   + +  + 
Sbjct: 174 KTFSVLNNADLVFPTIKGENGETIQLSHGVYGQLMESTNRDVREAAFKGLYEVYKQFRNT 233

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +T  K    +   R +E    +   SN+V   V + L+    N +    HRY EL
Sbjct: 234 FASTLSTNIKAHNFKASARHFESARQAALSSNHVPESVYDTLVDV-VNEHLPLLHRYMEL 292

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L +D ++ +D   PL G +     +E A +  L++ A    +   + +  F + WI
Sbjct: 293 RKRLLAVDELHMYDVYTPLLGEASISYTYEEAVEKALEALAPMGEEYLAVVKSAFDNRWI 352

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G   ++ PYIL+N+      + TL HE+GH +H   +  +Q  + 
Sbjct: 353 DVVENKGKRSGAYSSGAYDTL-PYILMNWHDTLDQLFTLVHEMGHSVHSYFTRTSQPYVY 411

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            +  + LAE AS   E L  + LL+  S  + R  +L + ++    +I RQ  F +FE  
Sbjct: 412 GDYPIFLAEIASTTNENLLTEYLLKTESDPKVRAYILNHYLDGFKGTIFRQTQFAEFEHF 471

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H E      +    ++E + E   +  GPA   +D E    W  +PHF   ++YV+ YA
Sbjct: 472 MHVEDAKGTPLTAEFLSESYGELNNKYYGPALS-NDDEIKLEWSRIPHFY-YNYYVFQYA 529

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G    ++L     +   +     YL  L++G+S +  E++    ++++  ++    ++ 
Sbjct: 530 TGFSAASALSHKILTEGPEALT-NYLAYLKSGSSDYPVEVMKKAGVDMTKADYIVDAMKV 588

Query: 616 VEKMIDDVEKM 626
            E+ ++++E +
Sbjct: 589 FEQRLNELEAL 599


>gi|110801429|ref|YP_696142.1| oligoendopeptidase F [Clostridium perfringens ATCC 13124]
 gi|110676076|gb|ABG85063.1| oligoendopeptidase F [Clostridium perfringens ATCC 13124]
          Length = 599

 Score =  443 bits (1139), Expect = e-122,   Method: Composition-based stats.
 Identities = 143/611 (23%), Positives = 276/611 (45%), Gaps = 20/611 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           S++  +  ++ +    +W ++ +Y +      + ++  ++ E+   K  +EG L      
Sbjct: 2   SEVKKLRRRDEIPESDKWRIDKIYETPAKW--NEELNKLKEEAPKLK-DFEGKLG----- 53

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            N   L A +   E++   +G++  YA +  + + S+P ++     I+   A+F     +
Sbjct: 54  -NKEDLKAFLLLNEKLSRKLGKLYVYAHMRSHEDTSNPEMQSLVNKIDPYSAEFSSYTAY 112

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
           F  EI +L E  +E    +D    +Y  + + I   K H+LS ++E +L+  S       
Sbjct: 113 FVPEILSLKEGTIENFINEDKDLKQYKIYFEMILNEKPHILSKEVESVLASVSDCLGAPE 172

Query: 202 KRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             +       + F     +      +            DR+VR++A K L  T+ K  + 
Sbjct: 173 SIYSMLTNSDMTFGEIVDESGRKVELTEGNYISFIKSKDRKVREAAFKLLFGTYKKYENT 232

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
            +    +  K+   + + RKY    ++    NN+   V    +++  +      HRY  +
Sbjct: 233 LATSLTSSIKNFVFESKTRKYNSSLEASLKPNNIPVEVYYNALKT-VDENMDALHRYVRI 291

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           KKK L L+ ++ +D   P+    ++ + ++ A  LV +       +   I  +     WI
Sbjct: 292 KKKLLNLEEIHMYDLYVPVIECKKEHLEYKDAISLVEEGLKPLGKEYLDIFNEGINEGWI 351

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G+  ++ PY+LLNY  +  D  TLAHE+GH IH   + +TQ  + 
Sbjct: 352 DVYENKGKRSGAYSWGSYDTM-PYVLLNYNYELNDASTLAHEMGHSIHSYYTRKTQPYIY 410

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + SL  AE AS   E L    L++  + K ++  L+  ++E +  ++ RQ+ F +FELK
Sbjct: 411 GDYSLFCAEVASTTNEILLIHHLIEKETDKNKKLYLINQELEQIRTTVFRQLMFAEFELK 470

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
            H    +   + +  + ++W +   +  G   ++ D E    W  +PHF  S FYVY YA
Sbjct: 471 THEAIENGESLTSEVLCKMWKDINIKYFGKDMNV-DEEISIEWARIPHFY-SDFYVYQYA 528

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G    +S  +   S   +   EKY   L+AG S +  + L    ++++     +  L  
Sbjct: 529 TGYAAASSFANSILSKGEEAV-EKYKGFLKAGGSMYPIDTLKMAGVDMTTSKPLKDTLDR 587

Query: 616 VEKMIDDVEKM 626
             +++D +E++
Sbjct: 588 FNELLDMLEEI 598


>gi|168216840|ref|ZP_02642465.1| oligoendopeptidase F [Clostridium perfringens NCTC 8239]
 gi|182381101|gb|EDT78580.1| oligoendopeptidase F [Clostridium perfringens NCTC 8239]
          Length = 599

 Score =  443 bits (1139), Expect = e-122,   Method: Composition-based stats.
 Identities = 143/611 (23%), Positives = 276/611 (45%), Gaps = 20/611 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           S++  +  ++ +    +W ++ +Y +      + ++  ++ E+   K  +EG L      
Sbjct: 2   SEVKKLRRRDEIPESDKWRIDKIYETPAKW--NEELNKLKEEAPKLK-DFEGKLG----- 53

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            N   L A +   E++   +G++  YA +  + + S+P ++     I+   A+F     +
Sbjct: 54  -NKEDLKAFLLLNEKLSRKLGKLYVYAHMRSHEDTSNPEMQSLVNKIDPYSAEFSSYTAY 112

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
           F  EI +L E  +E    +D    +Y  + + I   K H+LS ++E +L+  S       
Sbjct: 113 FVPEILSLKEGTIENFINEDKDLKQYKIYFEMILNEKPHILSKEVESVLASVSDCLGAPE 172

Query: 202 KRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             +       + F     +      +            DR+VR++A K L  T+ K  + 
Sbjct: 173 SIYSMLTNSDMTFGEIVDESGRKVELTEGNYISFIKSKDRKVREAAFKLLFGTYKKYENT 232

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
            +    +  K+   + + RKY    ++    NN+   V    +++  +      HRY  +
Sbjct: 233 LATSLTSSIKNFVFESKTRKYNSSLEASLKPNNIPVEVYYNALKT-VDENMDALHRYVRI 291

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           KKK L L+ ++ +D   P+    ++ + ++ A  LV +       +   I  +     WI
Sbjct: 292 KKKLLNLEEIHMYDLYVPVIECKKEHLEYKDAISLVEEGLKPLGKEYLDIFNEGINEGWI 351

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G+  ++ PY+LLNY  +  D  TLAHE+GH IH   + +TQ  + 
Sbjct: 352 DVYENKGKRSGAYSWGSYDTM-PYVLLNYNYELNDASTLAHEMGHSIHSYYTRKTQPYIY 410

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + SL  AE AS   E L    L++  + K ++  L+  ++E +  ++ RQ+ F +FELK
Sbjct: 411 GDYSLFCAEVASTTNEILLIHHLIEKETDKNKKLYLINQELEQIRTTVFRQLMFAEFELK 470

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
            H    +   + +  + ++W +   +  G   ++ D E    W  +PHF  S FYVY YA
Sbjct: 471 THEAIENGESLTSEVLCKMWKDINIKYFGEDMNV-DEEISIEWARIPHFY-SDFYVYQYA 528

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G    +S  +   S   +   EKY   L+AG S +  + L    ++++     +  L  
Sbjct: 529 TGYAAASSFANSILSKGEEAV-EKYKGFLKAGGSMYPIDTLKMAGVDMTTSKPLKDTLDR 587

Query: 616 VEKMIDDVEKM 626
             +++D +E++
Sbjct: 588 FNELLDMLEEI 598


>gi|294101207|ref|YP_003553065.1| oligoendopeptidase F [Aminobacterium colombiense DSM 12261]
 gi|293616187|gb|ADE56341.1| oligoendopeptidase F [Aminobacterium colombiense DSM 12261]
          Length = 608

 Score =  443 bits (1139), Expect = e-122,   Method: Composition-based stats.
 Identities = 142/608 (23%), Positives = 275/608 (45%), Gaps = 19/608 (3%)

Query: 25  TTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC 84
           T +  +E + +   W LED+YPS D  E   D + +E     F+  ++G L      ++ 
Sbjct: 13  TALPKREEIDSAYIWRLEDIYPSIDEWE--KDFDGLEKLLPRFQA-YQGCL-----LESA 64

Query: 85  HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL 144
            +L   I   E    ++G++ +YA++  + + S    +     +   L      + F+  
Sbjct: 65  ATLLDGIRLMENAEIIMGKLYAYAVMKSHEDTSKEFYQALADRVGYLLTKLTAAISFYTP 124

Query: 145 EINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRF 204
           EI +  + +++    Q     +Y+ + +NI ++  H L+   E LL+ + +V R     F
Sbjct: 125 EILSGGKGVIDGFLGQSEDLKQYAFFFENILRMAPHTLTPSEEELLARSGEVARGPENIF 184

Query: 205 FCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSF 258
                  + F     +      +   +  +     DR+VR+ A + L  T++K  +  + 
Sbjct: 185 SLFTNADMVFPEVFDEDGNTIELSEERYTRLIRSQDRQVRREAYEGLFGTYSKYRNSLAA 244

Query: 259 ITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKK 318
           + ++  K +      RKY    ++   S+++   V ++++ +   +  K  H Y  L+K+
Sbjct: 245 MYSSSVKGDLFYAMSRKYGSCLEAALDSDHIPLSVYDSVVDT-VRFNLKPLHEYVALRKE 303

Query: 319 WLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAP 378
            L +  +  +D   PL    +  I +E A  +V++       +   + +  F   WID  
Sbjct: 304 ILNVPELCMYDLYVPLANEIKKNITYEEALAMVVKGLEPLGEEYISVLKHGFEAGWIDVY 363

Query: 379 QYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNS 438
           +  GK  GA++ G+    HPY+LLNY G  QDV T+AHE+GH IH   S   Q  +  + 
Sbjct: 364 ENQGKRKGAYSWGS-YGTHPYVLLNYNGTIQDVFTIAHEMGHAIHTWYSHGHQPFIYADY 422

Query: 439 SLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHT 498
           ++ LAE AS   E L  D LL+++  ++ R  LL   +E +  ++ RQ  F DFE ++H 
Sbjct: 423 TIFLAEVASTTNEALLLDHLLESSLDRQSRLYLLNYSLEQIRTTVYRQAMFADFERQVHN 482

Query: 499 ERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGN 558
              +   +   R++ +W        GP   + D      W  +PHF  + FYVY Y  G 
Sbjct: 483 MAEAGEPLTAERLSALWHGLNVTYYGPEISV-DAHIDIEWARIPHFYTA-FYVYKYVTGY 540

Query: 559 CLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
               SL      + +   ++ YL+ L+ G + +  ++L    ++++ P   +  L   ++
Sbjct: 541 AAATSLSQRIVGDGI-AARKSYLDFLKQGGAAYSIDILKNAGVDMATPQPLQDTLNLFKE 599

Query: 619 MIDDVEKM 626
            + +++ +
Sbjct: 600 KLGELKDL 607


>gi|182627148|ref|ZP_02954862.1| oligoendopeptidase F [Clostridium perfringens D str. JGS1721]
 gi|177907466|gb|EDT70135.1| oligoendopeptidase F [Clostridium perfringens D str. JGS1721]
          Length = 599

 Score =  443 bits (1138), Expect = e-122,   Method: Composition-based stats.
 Identities = 144/611 (23%), Positives = 276/611 (45%), Gaps = 20/611 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           S++  +  ++ +    +W ++ +Y +      + ++  ++ E+   K  +EG L      
Sbjct: 2   SEVKKLRRRDEIPESDKWRIDKIYETPAKW--NEELNKLKEEAPKLK-DFEGKLG----- 53

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            N   L A +   E++   +G++  YA +  + + S+P ++     I+   A+F     +
Sbjct: 54  -NKEDLKAFLLLNEKLSRKLGKLYVYAHMRSHEDTSNPEMQSLVNKIDPYSAEFSSYTAY 112

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
           F  EI +L E  +E    +D    +Y  + + I   K H+LS ++E +L+  S       
Sbjct: 113 FVPEILSLKEGTIENFINEDKDLKQYKIYFEMILNEKPHILSKEVESVLASVSDCLGAPE 172

Query: 202 KRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             +       + F     +      +            DR+VR++A K L  T+ K  + 
Sbjct: 173 SIYSMLTNSDMTFGEIVDESGRKVELTEGNYISFIKSKDRKVREAAFKLLFGTYKKYENT 232

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
            +    +  K+   + + RKY    ++    NN+   V    +++  +      HRY  +
Sbjct: 233 LATSLTSSIKNFVFESKTRKYNSSLEASLKPNNIPVEVYYNALKT-VDENMDALHRYVRI 291

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           KKK L L+ ++ +D   P+    ++ + ++ A  LV +       +   I  +     WI
Sbjct: 292 KKKLLNLEEIHMYDLYVPVIECKKEHLEYKDAISLVEEGLKPLGKEYLDIFNEGINEGWI 351

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G+  ++ PY+LLNY  +  D  TLAHE+GH IH   + +TQ  + 
Sbjct: 352 DVYENKGKRSGAYSWGSYDTM-PYVLLNYNYELNDASTLAHEMGHSIHSYYTRKTQPYIY 410

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + SL  AE AS   E L    L++  + K ++  L+  ++E +  ++ RQ+ F +FELK
Sbjct: 411 GDYSLFCAEVASTTNEILLIHHLIEKETDKNKKLYLINQELEQIRTTVFRQLMFAEFELK 470

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
            H    S   + +  + ++W +   +  G   ++ D E    W  +PHF  S FYVY YA
Sbjct: 471 THEAIESGESLTSEVLCKMWKDINIKYFGKDMNV-DEEISIEWARIPHFY-SDFYVYQYA 528

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G    +S  +   S   +   EKY   L+AG S +  + L    ++++     +  L  
Sbjct: 529 TGYAAASSFANSILSKGEEAV-EKYKGFLKAGGSMYPIDTLKMAGVDMTTSKPLKDTLDR 587

Query: 616 VEKMIDDVEKM 626
             +++D +E++
Sbjct: 588 FNELLDMLEEI 598


>gi|212639946|ref|YP_002316466.1| oligoendopeptidase F [Anoxybacillus flavithermus WK1]
 gi|212561426|gb|ACJ34481.1| Oligoendopeptidase F [Anoxybacillus flavithermus WK1]
          Length = 601

 Score =  442 bits (1137), Expect = e-122,   Method: Composition-based stats.
 Identities = 139/599 (23%), Positives = 262/599 (43%), Gaps = 19/599 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
             T+ +++++     W LED++ + +  E   + E I      F + ++G L      ++
Sbjct: 5   AKTLPTRKDVPVEYTWRLEDIFATDEQWE--KEFEEIMSLLPKF-SEYKGRLG-----ES 56

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
             +L  A+   + +   +G++ +YA + ++ + +    +   T      A+  +   F  
Sbjct: 57  AQTLYEALQYRDHVFMRLGKLYAYAHMRHDEDTAHSLYQGLETRAEGLYAEAGQATAFIV 116

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            EI  +DE +L     Q      Y+  +  + + + H+LS   E LL+  ++V   +   
Sbjct: 117 PEILAMDEDVLRTFLQQYEPLRLYAHELDEMNRQRPHVLSEKEEALLAQAAEVMNASSNT 176

Query: 204 FFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           F   N   LRF     +      +   +  +     +R VR  A KA+  T+ K  + F+
Sbjct: 177 FGALNNADLRFPTITDENGEEVEVTHGRYIRFLESEERRVRHDAFKAVYDTYRKYENTFA 236

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
              +   K      R R Y    ++    N +   V + L+    + Y    HRY +L+K
Sbjct: 237 STLSGAVKRNNFFARVRNYRSAREAALSKNQIPETVYDNLI-ETIHRYLPLLHRYVQLRK 295

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           + L LD ++ +D   PL       + +E A+D++L+       +   I ++ F + W+D 
Sbjct: 296 RVLGLDELHMYDLYTPLVKQVDMKVTYEEAKDILLKGLTPLGDEYISIVKEGFDNRWVDV 355

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK SGA++ G+    +PYIL+N+     ++ TLAHE GH +H   + + Q     N
Sbjct: 356 QETRGKRSGAYSSGS-YGTNPYILMNWQDNVNNLFTLAHEFGHSVHSYYTRKYQPYPYGN 414

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
            S+ +AE AS   E L  D LL+    ++++  LL + +E    ++ RQ  F +FE  +H
Sbjct: 415 YSIFVAEVASTCNEALLNDYLLKTIDDEKKKLYLLNHYLETFRGTVFRQTMFAEFEHMIH 474

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
              ++   +    + E + E  K   G    + D E G  W  +PHF  + +     A G
Sbjct: 475 QMAQNGEALTAKVLTEKYYELNKTYFGDGVVI-DEEIGLEWARIPHFYYNYYVYQY-ATG 532

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTV 616
                +L             E+Y+  L+AG+S +  E+L    ++++ P   E+  Q  
Sbjct: 533 FSAATALSKQILEEGAPAV-ERYIAFLKAGSSDYPIEVLKKAGVDMTSPEPIEQACQVF 590


>gi|300855085|ref|YP_003780069.1| oligoendopeptidase F [Clostridium ljungdahlii DSM 13528]
 gi|300435200|gb|ADK14967.1| oligoendopeptidase F [Clostridium ljungdahlii DSM 13528]
          Length = 595

 Score =  442 bits (1137), Expect = e-122,   Method: Composition-based stats.
 Identities = 148/607 (24%), Positives = 263/607 (43%), Gaps = 20/607 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           M     ++ +    +W +E +Y   +S     D E ++  +    + + G L        
Sbjct: 1   MVQTKRRDEILKEDKWKVEKIYKDIESW--KKDFEKLKSMAPKL-SEYAGKLFE------ 51

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
              L       E +  L G++A +A +  + + ++PT +     I A  A+ + +  FF 
Sbjct: 52  GKKLLEYFKLDEEVSRLAGKLAIFAHMKNDEDTANPTFQVLRDKIYAYSAEIKSMEAFFI 111

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            EI +L E  +++     P    Y   ++ I K K H+LS + E L++  S       K 
Sbjct: 112 PEILSLPEGTIDKFMKAVPELNMYKFLLERILKKKPHILSVEQEELIASVSDCLNAPEKV 171

Query: 204 FFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           +   +   + F     +      +             R VRK A K+L +T+ K  +  +
Sbjct: 172 YSMLSNADMTFPKIKDERGKRVELTDVNYSGFIRSKKRSVRKEAFKSLFNTYKKYKNTLA 231

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
               +  K+     + RKY+   +     N++   V    + +  N   K+ HRY  +KK
Sbjct: 232 ASLTSNIKNFIFISKTRKYKSSMECSLKPNDISLDVYNNTIDT-VNNNLKSLHRYVSIKK 290

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           K L L  M+ +D   PL  T ++ I F+ A  +V +       +   I ++   + W+D 
Sbjct: 291 KLLGLHEMHMYDLYVPLIDTVEEHIEFDEAVKIVKEGLKPLGKEYLDIFDEGIKNGWVDI 350

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
               GK  GA++ G      PY+LLNY  K  DV TLAHE+GH IH   S + Q  + ++
Sbjct: 351 YPNKGKRGGAYSTG-DYDTMPYVLLNYNYKLTDVSTLAHEMGHSIHSYYSRKDQPYIYSD 409

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
            SL  AE AS   E+L    L+   + K+ +  L+  ++E +  ++ RQ+ F +FE   H
Sbjct: 410 YSLFCAEVASTTNESLLIHYLIDNETDKKRKLYLINQELEQIRTTVFRQVMFAEFEKVTH 469

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
            +  +   +    + +IW E   +  G    + D E    W  +PHF    FYVY YA G
Sbjct: 470 EKIENETPLTGEDLCKIWRELNVKYFGENMVV-DEEIDMEWSRIPHFY-WDFYVYQYATG 527

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
               +S  +    N      E Y   L++G+S +   +L    ++++ P   E  ++  +
Sbjct: 528 YAAAHSFANAILENGEKAV-ESYKEFLKSGSSDYPINVLKKAGVDMTSPKPLEDTIKRFD 586

Query: 618 KMIDDVE 624
           +++D +E
Sbjct: 587 ELLDMLE 593


>gi|118443219|ref|YP_877645.1| oligoendopeptidase F [Clostridium novyi NT]
 gi|118133675|gb|ABK60719.1| oligoendopeptidase F [Clostridium novyi NT]
          Length = 595

 Score =  442 bits (1137), Expect = e-122,   Method: Composition-based stats.
 Identities = 149/607 (24%), Positives = 269/607 (44%), Gaps = 20/607 (3%)

Query: 23  DMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           ++  + ++E + N  +W++E +Y      E   D   +   +      ++G L       
Sbjct: 2   EVAKIKTREEILNDDKWDIEKVYADKKQWE--EDFNNLTEMAKGL-QDFQGKLN------ 52

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
           +   L   +   E++  L  ++  YA L  + + ++ T +     I A  A+   +  FF
Sbjct: 53  DPKMLLEFLKLDEKVSRLGEKLLVYAYLKADEDTANNTNQALKNKIEAYFAELSAMSAFF 112

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
             EI +  E  ++ +  + P    Y   +  I K K H LS +ME +L+  S        
Sbjct: 113 VPEILSYPEETIKSAINEVPELKMYELMMDRILKRKPHTLSKEMEEMLASVSDALNAPAS 172

Query: 203 RFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIF 256
            F       + F     +      +            DR VRK A +AL +T+ K  +  
Sbjct: 173 IFSILTNADMTFPTIKDENGNKVELTEGNYSIFIKSKDRRVRKEAFEALFNTYYKFKNTL 232

Query: 257 SFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELK 316
           +    +  K+     + R Y    +S    N++   V + +++++ N    + HRY ++K
Sbjct: 233 ATSLTSSIKNFSFLAKKRNYNSSIESSLEPNDIPVEVYDNVIKTI-NDNLDSLHRYVKVK 291

Query: 317 KKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWID 376
           K+ L LD ++ +D   P+  T ++ I F  A D+V  +      +   I      + WID
Sbjct: 292 KELLGLDEIHMYDLYVPVIDTPKEHIEFSKAVDMVNNALKPLGEEYLNIFNSGIKNRWID 351

Query: 377 APQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTN 436
             +  GK  GA++ GT  ++ PY+LLNY  +  DV TLAHE+GH IH   S + Q  +  
Sbjct: 352 IYENKGKRKGAYSWGTYDTM-PYVLLNYNHELNDVSTLAHEMGHSIHSYYSRKEQPYIYA 410

Query: 437 NSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKL 496
           N +L  AE AS   E L  + L++  + K++R  L+  ++E +  ++ RQ+ F +FE   
Sbjct: 411 NYTLFCAEVASTVNENLLINYLIKKETDKDKRLYLINTQLEQIRTTVFRQVMFAEFEKIT 470

Query: 497 HTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAF 556
           H +  +   + +  + +I+ +   +  G    + D E    W  +PHF  S FYVY YA 
Sbjct: 471 HEKIDAGHPLTSEDLCKIYHDLNVKYFGEDMVI-DKEIDMEWARIPHFY-SDFYVYQYAT 528

Query: 557 GNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTV 616
           G    NS       N  +   EKY   L+AG S +   +L    ++++ P   E  ++  
Sbjct: 529 GYSAANSFVKQILENGEEAV-EKYKGFLKAGGSDYPINILKNAGVDMTTPKPIEDTIKRF 587

Query: 617 EKMIDDV 623
            +++D +
Sbjct: 588 NELLDML 594


>gi|168214466|ref|ZP_02640091.1| oligoendopeptidase F [Clostridium perfringens CPE str. F4969]
 gi|170714075|gb|EDT26257.1| oligoendopeptidase F [Clostridium perfringens CPE str. F4969]
          Length = 599

 Score =  442 bits (1137), Expect = e-122,   Method: Composition-based stats.
 Identities = 143/611 (23%), Positives = 276/611 (45%), Gaps = 20/611 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           S++  +  ++ +    +W ++ +Y +      + ++  ++ E+   K  +EG L      
Sbjct: 2   SEVKKLRRRDEIPESDKWRIDKIYETPAKW--NEELSKLKEEAPKLK-DFEGKLG----- 53

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            N   L A +   E++   +G++  YA +  + + S+P ++     I+   A+F     +
Sbjct: 54  -NKEDLKAFLLLNEKLSRKLGKLYVYAHMRSHEDTSNPEMQSLVNKIDPYSAEFSSYTAY 112

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
           F  EI +L E  +E    +D    +Y  + + I   K H+LS ++E +L+  S       
Sbjct: 113 FVPEILSLKEGTIENFINEDKDLKQYKIYFEMILNEKPHILSREVESVLASVSDCLGAPE 172

Query: 202 KRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             +       + F     +      +            DR+VR++A K L  T+ K  + 
Sbjct: 173 SIYSMLTNSDMTFGEIVDESGRKVELTEGNYISFIKSKDRKVREAAFKLLFGTYKKYENT 232

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
            +    +  K+   + + RKY    ++    NN+   V    +++  +      HRY  +
Sbjct: 233 LATSLTSSIKNFVFESKTRKYNSSLEASLKPNNIPVEVYYNALKT-VDENMDALHRYVRI 291

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           KKK L L+ ++ +D   P+    ++ + ++ A  LV +       +   I  +     WI
Sbjct: 292 KKKLLNLEEIHMYDLYVPVIECKKEHLEYKDAISLVEEGLKPLGKEYLDIFNEGINEGWI 351

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G+  ++ PY+LLNY  +  D  TLAHE+GH IH   + +TQ  + 
Sbjct: 352 DVYENKGKRSGAYSWGSYDTM-PYVLLNYNYELNDASTLAHEMGHSIHSYYTRKTQPYIY 410

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + SL  AE AS   E L    L++  + K ++  L+  ++E +  ++ RQ+ F +FELK
Sbjct: 411 GDYSLFCAEVASTTNEILLIHHLIEKETDKNKKLYLINQELEQIRTTVFRQLMFAEFELK 470

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
            H    +   + +  + ++W +   +  G   ++ D E    W  +PHF  S FYVY YA
Sbjct: 471 THEAIENGESLTSEVLCKMWKDINIKYFGEDMNV-DEEISIEWARIPHFY-SDFYVYQYA 528

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G    +S  +   S   +   EKY   L+AG S +  + L    ++++     +  L  
Sbjct: 529 TGYAAASSFANSILSKGEEAV-EKYKGFLKAGGSMYPIDTLKMAGVDMTTSKPLKDTLDR 587

Query: 616 VEKMIDDVEKM 626
             +++D +E++
Sbjct: 588 FNELLDMLEEI 598


>gi|225574906|ref|ZP_03783516.1| hypothetical protein RUMHYD_02984 [Blautia hydrogenotrophica DSM
           10507]
 gi|225037874|gb|EEG48120.1| hypothetical protein RUMHYD_02984 [Blautia hydrogenotrophica DSM
           10507]
          Length = 602

 Score =  442 bits (1137), Expect = e-122,   Method: Composition-based stats.
 Identities = 146/608 (24%), Positives = 261/608 (42%), Gaps = 19/608 (3%)

Query: 25  TTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC 84
             +  +  +    +W ++DLY +    E   + +  +     +  +++G LA     K+ 
Sbjct: 5   NQLPKRSEIAKSDQWRIQDLYANESEWE--REYKETQRGLDGY-QKFQGRLA-----KSA 56

Query: 85  HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL 144
             L  A+ E +RI  L+ R+  YA   Y+ +  +   ++        +   +    F   
Sbjct: 57  KVLFEALQERDRIQMLLERLYVYANQRYHEDTGNSVYQQLSGRAQNLMVKAQGAFSFLEP 116

Query: 145 EINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRF 204
           E+  L E L E+   ++     Y  +++ I + +KH+LS +ME +++  SQ+       F
Sbjct: 117 ELMELTEELFERFLEENEKLRLYKRYMEEIFRTRKHVLSKEMEEVMAQVSQIANGPENIF 176

Query: 205 FCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSF 258
              N   LRF     +      +   +  +    SDR VRK+A + L  T+ +  +  + 
Sbjct: 177 SMFNNADLRFGAVQDEEGNSVELTHGRYAQFLESSDRSVRKAAFERLYGTYGQFQNTLAA 236

Query: 259 ITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKK 318
                 K      + R Y     +     N+   V + L+ +  +      HRY EL+++
Sbjct: 237 TFEANVKQAGFFAKMRNYPSARAAALDGGNIPVEVYDQLLTA-VHQALPALHRYVELRRR 295

Query: 319 WLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAP 378
            L +D ++ +D   PL  + +    FE A+ +V +  A        + +K F   WID  
Sbjct: 296 LLGVDVLHMYDLYTPLVSSEKKRYSFEQAKAMVKEGLAALGEDYQELLQKGFDEGWIDVY 355

Query: 379 QYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNS 438
           +  GK SGA++ G     HPY+LLNY G    V TLAHE+GH +H   S   Q       
Sbjct: 356 ENQGKRSGAYSWG-AYGTHPYVLLNYNGTLNHVFTLAHEMGHALHSWYSDHAQPYPYAGY 414

Query: 439 SLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHT 498
            + +AE AS   E+L    L+  A    E+  L+   +E    ++ RQ  F +FE  +H 
Sbjct: 415 RIFVAEVASTCNESLLIHDLIGKARDDSEKAYLINYFLEQFRTTVYRQTMFAEFEKIVHE 474

Query: 499 ERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGN 558
           +      +  + + EI+ E  +   G   ++ D +    W  +PHF  + FYVY YA G 
Sbjct: 475 KCALGESLTANVLCEIYRELNRVYFGEGMEI-DEQIALEWARIPHFY-TPFYVYQYATGF 532

Query: 559 CLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
               ++      +      EKY   L  G+S    ELL    ++++ P      L+  E+
Sbjct: 533 SAAIAISQKII-DGEPEIVEKYKRFLSGGSSMDPVELLKICGVDMTSPQPVTEALRMFER 591

Query: 619 MIDDVEKM 626
            ++++E +
Sbjct: 592 YLEEMESL 599


>gi|18310435|ref|NP_562369.1| oligoendopeptidase F [Clostridium perfringens str. 13]
 gi|18145115|dbj|BAB81159.1| oligopeptidase [Clostridium perfringens str. 13]
          Length = 599

 Score =  442 bits (1136), Expect = e-122,   Method: Composition-based stats.
 Identities = 143/612 (23%), Positives = 275/612 (44%), Gaps = 23/612 (3%)

Query: 24  MTTMDS---QENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
           M+ +     ++ +    +W ++ +Y +      + ++  ++ E+   K  +EG L     
Sbjct: 1   MSEVKKLRIRDEIPESDKWRIDKIYETPAKW--NEELNKLKEEAPKLK-DFEGKLG---- 53

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
             N   L A +   E++   +G++  YA +  + + S+P ++     I+   A+F     
Sbjct: 54  --NKEDLKAFLLLNEKLSRKLGKLYVYAHMRSHEDTSNPEMQSLVNKIDPYSAEFSSYTA 111

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           +F  EI +L E  +E    +D    +Y  + + I   K H+LS ++E +L+  S      
Sbjct: 112 YFVPEILSLKEGTIENFINEDKDLKQYKIYFEMILNEKPHILSKEVESVLASVSDCLGAP 171

Query: 201 LKRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              +       + F     +      +            DR+VR++A K L  T+ K  +
Sbjct: 172 ESIYSMLTNSDMTFGEIVDESSRKVELTEGNYISFIKSKDRKVREAAFKLLFGTYKKYEN 231

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
             +    +  K+   + + RKY    ++    NN+   V    +++  +      HRY  
Sbjct: 232 TLATSLTSSIKNFVFESKTRKYNSSLEASLKPNNIPVEVYYNALKT-VDENMDALHRYVR 290

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           +KKK L L+ ++ +D   P+    ++ + ++ A  LV +       +   I  +     W
Sbjct: 291 IKKKLLNLEEIHMYDLYVPVIECKKEHLEYKDAISLVEEGLKPLGKEYLDIFNEGINEGW 350

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           ID  +  GK SGA++ G+  ++ PY+LLNY  +  D  TLAHE+GH IH   + +TQ  +
Sbjct: 351 IDVYENKGKRSGAYSWGSYDTM-PYVLLNYNYELNDASTLAHEMGHSIHSYYTRKTQPYI 409

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
             + SL  AE AS   E L    L++  + K ++  L+  ++E +  ++ RQ+ F +FEL
Sbjct: 410 YGDYSLFCAEVASTTNEILLIHHLIEKETDKNKKLYLINQELEQIRTTVFRQLMFAEFEL 469

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
           K H    +   + +  + ++W +   +  G   ++ D E    W  +PHF  S FYVY Y
Sbjct: 470 KTHEAIENGESLTSEVLCKMWKDINIKYFGEDMNV-DEEISIEWARIPHFY-SDFYVYQY 527

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G    +S  +   S   +   EKY   L+AG S +  + L    ++++     +  L 
Sbjct: 528 ATGYAAASSFANSILSKGEEAV-EKYKGFLKAGGSMYPIDTLKMAGVDMTTSKPLKDTLD 586

Query: 615 TVEKMIDDVEKM 626
              +++D +E++
Sbjct: 587 RFNELLDMLEEI 598


>gi|294084910|ref|YP_003551670.1| oligoendopeptidase, pepF/M3 family [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664485|gb|ADE39586.1| oligoendopeptidase, pepF/M3 family [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 592

 Score =  441 bits (1135), Expect = e-121,   Method: Composition-based stats.
 Identities = 235/598 (39%), Positives = 352/598 (58%), Gaps = 12/598 (2%)

Query: 33  LGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIA 92
           L N P W+L DLY   D   I+ D++    +S A +T W+G L    ++ N   L   I 
Sbjct: 2   LDNSPVWDLSDLYTDIDDNRIAADIKSCRKDSAALQTSWQGKL----DKANGSELAEVIT 57

Query: 93  EYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEA 152
            YE I E +GR+  +A L +  N +  +I K +  +    A+    L+F  LEI T D+A
Sbjct: 58  IYEMIIERLGRVQCHAQLLFAANTADASIAKHHQSMREAGAEIGAQLLFVELEIATFDDA 117

Query: 153 LLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESL 212
            +     Q      ++ WI+ +R +  + LS DME +L++    GR A  R F E   ++
Sbjct: 118 HMNWVM-QTAELAHWAPWIRRVRAMAPYQLSADMEKMLAEQGPTGRGAWVRLFDETATAM 176

Query: 213 RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDR 272
           RF     ++   +        +   RK A  +LS T  K+  + S I NT+AKD+E++DR
Sbjct: 177 RFPFQGDEVTEAEILDMVSSPNAAHRKEAGLSLSTTLKKNERLLSLIINTIAKDKEVEDR 236

Query: 273 WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLA 332
           WR +++   SR+L+N+V+  V++AL+++V +     SHRYY LK +W+    + +WDR A
Sbjct: 237 WRGFKRPVASRNLANDVDDNVVDALVRAVNDRNVDLSHRYYSLKARWMGQSQLDWWDRNA 296

Query: 333 PLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGT 392
           PL G       ++ ARD+VL ++A F   M+ IA+ FF +NWIDA    GK SGAF+H  
Sbjct: 297 PLLGDDDRDFTWQEARDIVLDAFASFDQGMATIAKPFFDNNWIDAAPRLGKSSGAFSHPA 356

Query: 393 IPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGET 452
           +PS HPYIL+N+ GK +DVMTLAHE+GHG+H  L+++  G L +++ LTLAETAS+F E 
Sbjct: 357 VPSAHPYILMNFSGKARDVMTLAHEMGHGVHQCLAADN-GYLMSDTPLTLAETASVFAEM 415

Query: 453 LTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRIN 512
           L F  LL A ++   R++LLA K+EDMLN++VRQI+F++FE  LH  RRS+  +    I+
Sbjct: 416 LAFRRLLDATANPATRRVLLAGKVEDMLNTVVRQIAFHNFETALHDARRSSE-LMPEEIS 474

Query: 513 EIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYK--- 569
           +IW+ETQ+ +LG    + D +Y   W  VPHF+ + FYVYAYAFG+CLVN+L+  Y+   
Sbjct: 475 DIWMETQRAALGQGIRIGD-DYRPVWSYVPHFVHTPFYVYAYAFGDCLVNALWQNYQNAL 533

Query: 570 -SNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
            +     F  KY  +L AG ++ Y   L    ++  DP FW  GL  +  MID++E +
Sbjct: 534 ANGDAAGFVTKYKALLSAGGTERYDVALAKFGLDAGDPAFWSTGLDMISNMIDELESL 591


>gi|167465746|ref|ZP_02330835.1| hypothetical protein Plarl_24818 [Paenibacillus larvae subsp.
           larvae BRL-230010]
          Length = 589

 Score =  441 bits (1134), Expect = e-121,   Method: Composition-based stats.
 Identities = 138/602 (22%), Positives = 261/602 (43%), Gaps = 21/602 (3%)

Query: 31  ENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAA 90
           +++    +W LEDL+    +     +   ++         + G L       N +++   
Sbjct: 1   KDVPEQEKWKLEDLFADQKAW--DKEFNEVKQLLKK-VDDFHGKLN------NDNAIKQC 51

Query: 91  IAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLD 150
               ++I     R+  YA + ++ + + PT +           +  + L F + EI +L 
Sbjct: 52  FELEDKISLHTERLYVYAKMKHDEDAADPTYQALSEKARKLSVEVNQALSFISPEILSLS 111

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIE 210
           E  L    +  P    Y   ++ + + K H+LS   E LL+ T  +   A   F   N  
Sbjct: 112 EDQLRSFISH-PDLSLYKRTLEELLREKPHVLSKSEETLLAMTGNMAGSASNIFGMINNA 170

Query: 211 SLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLA 264
            ++F           ++      +   + DREVRK A +A+  T+    +  +   +   
Sbjct: 171 DIQFPKIKNEKGEEVQLTHGSYIQFLENPDREVRKRAFQAVYETYRNQRNTIAATLSANV 230

Query: 265 KDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDT 324
                  R RKY  + +    ++N++P V   L+ ++ +      HRY++L+KK LK+D 
Sbjct: 231 NKNIFYARARKYPSVLEMSLHADNIDPSVYTNLISTIHDS-LPVLHRYFKLRKKLLKVDE 289

Query: 325 MYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKG 384
           ++ +D  APL    +  I ++ A++ ++++      +   I ++ F + WID  +   K 
Sbjct: 290 LHMYDLFAPLVEEFKMDITYKQAQEKIIEALRPLGGKYIDILKEGFENRWIDVHENKNKR 349

Query: 385 SGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAE 444
           SGA++ G     HPY+LLN+      + TLAHE+GH +H  LS   Q       ++ LAE
Sbjct: 350 SGAYSWG-AYGTHPYVLLNHKDNLNSMFTLAHEMGHAMHSYLSDANQEYRNAQYTIFLAE 408

Query: 445 TASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTG 504
            AS   E L  D +L+  +  +E+  LL    +    ++ RQ  F +FE  +H +     
Sbjct: 409 VASTLNEALLMDYMLKHTTDPKEKLYLLTYYADQFRTTVFRQTMFAEFEKIVHEKAEKGE 468

Query: 505 DIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSL 564
            +     ++++ +  K   G    + D +    W  +PHF  S FYVY YA G     S 
Sbjct: 469 SLTPQEFSKVYYDLNKLYHGNDMVV-DQDIEMEWARIPHFYNS-FYVYKYATGFSAATSF 526

Query: 565 YDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVE 624
                        E+YL  L++G S     +L    +++S P   ++ +   + +++ +E
Sbjct: 527 ASQILEKGEPAV-ERYLGFLKSGGSDFSINILKKAGVDMSSPEPIKQSMDVFKSVVEQME 585

Query: 625 KM 626
           ++
Sbjct: 586 QL 587


>gi|291518458|emb|CBK73679.1| oligopeptidase F. Metallo peptidase. MEROPS family M03B
           [Butyrivibrio fibrisolvens 16/4]
          Length = 598

 Score =  441 bits (1133), Expect = e-121,   Method: Composition-based stats.
 Identities = 146/609 (23%), Positives = 276/609 (45%), Gaps = 19/609 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
              + S++ +     W+L  +Y +  + E   D++ IE +      +++G +      ++
Sbjct: 2   AKELVSRDQVRVEDTWDLTAMYENKSAWE--ADIKIIEGKLDEI-AKYQGKV-----CES 53

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
             +L A +       E +    +YA   ++ +  +   +     +   +A FE  + F +
Sbjct: 54  ADNLLAVLEINAIAEEKLELAFNYAERLFDQDQGNTEHQSMSQKMFGLIAKFEAAMSFVS 113

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            EI   D A+L+   A  P    Y   IK I+++K H LS +ME +++ TS++G    + 
Sbjct: 114 PEILACDTAVLDGFIASKPELELYRIEIKEIQRLKDHTLSAEMEKVVAMTSEMGNTPSEV 173

Query: 204 FFCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           +       + F            +   +       +DR VR+ A KA    + K  +  +
Sbjct: 174 YSAFKNVDMTFPAIKDENGEEVTLTDGRFVPMLMSADRRVREDAFKAYYGVYKKYLNTMA 233

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
            I N   K      R R Y    ++   +NNV P V + L+++  N      H Y  L+K
Sbjct: 234 AIYNGEVKQHIFNSRVRNYSSNLEAAVDANNVSPQVYDNLVKT-VNANLDKLHAYVSLRK 292

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           K L +D ++ +D    +   +   + +E A+  + ++ A        + ++ F + WID 
Sbjct: 293 KCLGVDELHMYDIYTSMIPDAAKTVKYEEAQKTICEALAVLGDDYVALLKEGFANRWIDV 352

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK  GA++  T   VHPY+LLNY     D+ T AHE+GH +H   S++TQ  + +N
Sbjct: 353 YENKGKRGGAYS-ATAYGVHPYMLLNYTDTFDDMFTTAHEMGHSMHSYFSNKTQPYIYSN 411

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
             + +AE AS   E L  + LL+  + K+E+  LL + ++    ++ RQ  F +FE   +
Sbjct: 412 YKIFVAEVASTCNEILLLEYLLKNCTDKKEKAYLLNHYLDSFKGTVFRQTQFAEFEKTTN 471

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
               +  ++    + +++ E  ++  GP   +SD E    W  +PHF   +FYVY YA  
Sbjct: 472 EMVEAGENLNAENLCKLYKEINEKYYGPDM-ISDDEIAYEWARIPHFY-YNFYVYQYATS 529

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
            C   ++ D+          E+Y   L +G +    ELL    ++L+ P   E  L  + 
Sbjct: 530 FCAAVAIADMILKEGAPAV-ERYKKFLSSGCTDAPVELLKIAGVDLTTPAPIEAALAKMG 588

Query: 618 KMIDDVEKM 626
           +++++++ +
Sbjct: 589 EIVEELKTL 597


>gi|291527328|emb|CBK92914.1| oligopeptidase F. Metallo peptidase. MEROPS family M03B
           [Eubacterium rectale M104/1]
          Length = 601

 Score =  441 bits (1133), Expect = e-121,   Method: Composition-based stats.
 Identities = 140/604 (23%), Positives = 252/604 (41%), Gaps = 18/604 (2%)

Query: 27  MDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS 86
           +  ++ + +  +W LED+Y + +  E   + E     +    + ++G+LA      +  +
Sbjct: 6   LQKRDEISDEYKWKLEDMYETDELWE--AECEKASQLAEKL-SGFKGHLAD-----SAAT 57

Query: 87  LGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEI 146
           L     + + +   + RI  YA    + + +    + + +            L F + EI
Sbjct: 58  LLDFFKKQDELSYYLERIVVYANERSHQDTAVSKYQAYVSKAETLTVQASGALAFASPEI 117

Query: 147 NTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFC 206
             +D+  LE  Y++    + Y   I  I + K H LS   E +L+   ++       F  
Sbjct: 118 LQIDDKRLESFYSESNELMHYKRAIDEIMRQKAHTLSAAEENILAQCGEMAAAPENIFSM 177

Query: 207 ENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFIT 260
            N   ++F           +I            DR +RK   + +  ++ K S+  S + 
Sbjct: 178 FNNADIKFPYITDVEGNKIRITHGNFIDFLSSKDRSLRKQVFRGVYDSYKKWSNTVSMMY 237

Query: 261 NTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWL 320
            +  K++    R RKY+          ++   V + L+    + +    HRY  L+KK L
Sbjct: 238 ISKLKNDTFYARVRKYDSARAMYLSGGDIPESVYDNLI-ETVHAHLPALHRYMALRKKLL 296

Query: 321 KLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQY 380
            ++ ++ +D  AP+    Q    ++ A+ LV ++      +     +      WID  + 
Sbjct: 297 GVEHLHMYDLFAPIVDNVQTTYTYDEAKKLVAKALEPMGDEYVSTLKAGMESGWIDVYEN 356

Query: 381 DGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSL 440
           + K SGA++ G     HPY+LLNY      V TLAHE+GH +H   S+E Q I      +
Sbjct: 357 ENKRSGAYSWG-AYGTHPYVLLNYADNLDSVFTLAHEMGHAMHTYYSNEHQSITYAGYLI 415

Query: 441 TLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTER 500
            +AE AS   E+L    +L+    + ERK L+ + ++    ++ RQ  F +FE   H + 
Sbjct: 416 FVAEVASTCNESLLMHYMLEHCEDENERKYLMTHFLDGFRTTLFRQAQFAEFEHIAHRKM 475

Query: 501 RSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCL 560
           +    +    +NE+W E   +  GP   + D E    WM +PHF  + +YVY Y+ G   
Sbjct: 476 QKGEPVTKDVLNELWHELNVQYYGPDMRVDD-EISYEWMRIPHFY-TPYYVYQYSTGYSA 533

Query: 561 VNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMI 620
             +              +   N L  G SK+  ELL    +++S P   +  L   E  +
Sbjct: 534 AVAFSKKILEEGKPAVDKYIGNFLCGGCSKNPIELLKSAGVDMSTPKPVDDALNVFEDYL 593

Query: 621 DDVE 624
              E
Sbjct: 594 KQFE 597


>gi|110802842|ref|YP_698758.1| oligoendopeptidase F [Clostridium perfringens SM101]
 gi|110683343|gb|ABG86713.1| oligoendopeptidase F [Clostridium perfringens SM101]
          Length = 599

 Score =  440 bits (1132), Expect = e-121,   Method: Composition-based stats.
 Identities = 144/611 (23%), Positives = 275/611 (45%), Gaps = 20/611 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           S++  +  ++ +    +W ++ +Y +      + ++  ++ E+   K  +EG L      
Sbjct: 2   SEVKKLRRRDEIPESDKWRIDKIYETPAKW--NEELSKLKEEAPKLK-DFEGKLG----- 53

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            N   L A +   E++   +G++  YA +  + + S+P ++     I+   A+F     +
Sbjct: 54  -NKEDLKAFLLLNEKLSRKLGKLYVYAHMRSHEDTSNPEMQSLVNKIDPYSAEFSSYTAY 112

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
           F  EI +L E  +E    +D    +Y  + + I   K H+LS ++E +L+  S       
Sbjct: 113 FVPEILSLKEGTIENFINEDKDLEQYKIYFEMILNEKPHILSKEVESVLASVSDCLGAPE 172

Query: 202 KRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             +       + F     +      +            DR+VR++A K L  T+ K  + 
Sbjct: 173 SIYSMFTNSDMTFGEIVDESGRKVELTEGNYSSFIKSKDRKVREAAFKLLFGTYKKYENT 232

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
            +    +  K+   + + RKY    ++    NN+   V    +++  +      HRY  +
Sbjct: 233 LATSLTSSIKNFVFESKTRKYNSSLEASLKPNNIPVEVYYNALKT-VDENMDALHRYVRI 291

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           KKK L LD ++ +D   P+    ++ + ++ A  LV +       +   I  +     WI
Sbjct: 292 KKKLLNLDEIHMYDLYVPVIECKKEHLEYKDAISLVEEGLKPLGKEYLDIFNEGINEGWI 351

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ G+  ++ PY+LLNY  +  D  TLAHE+GH IH   + +TQ  + 
Sbjct: 352 DVYENKGKRSGAYSWGSYDTM-PYVLLNYNYELNDASTLAHEMGHSIHSYYTRKTQPYIY 410

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + SL  AE AS   E L    L++  + K ++  L+  ++E +  ++ RQ+ F +FELK
Sbjct: 411 GDYSLFCAEVASTTNEILLIHHLIEKETDKNKKLYLINQELEQIRTTVFRQLMFAEFELK 470

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
            H    +   + +  + ++W +   +  G    + D E    W  +PHF  S FYVY YA
Sbjct: 471 THEAIENGESLTSEVLCKMWKDINIKYFGEDMKV-DEEISIEWARIPHFY-SDFYVYQYA 528

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G    +S  +   S   +   EKY   L+AG S +  + L    ++++     +  L  
Sbjct: 529 TGYAAASSFANSILSKGEEAV-EKYKGFLKAGGSMYPIDTLKMAGVDMTTSKPLKDTLDR 587

Query: 616 VEKMIDDVEKM 626
             +++D +E++
Sbjct: 588 FNELLDMLEEI 598


>gi|238924952|ref|YP_002938468.1| peptidase [Eubacterium rectale ATCC 33656]
 gi|238876627|gb|ACR76334.1| peptidase [Eubacterium rectale ATCC 33656]
          Length = 601

 Score =  440 bits (1131), Expect = e-121,   Method: Composition-based stats.
 Identities = 139/604 (23%), Positives = 252/604 (41%), Gaps = 18/604 (2%)

Query: 27  MDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS 86
           +  ++ + +  +W LED+Y + +  E   +      +     + ++G+LA      +  +
Sbjct: 6   LQKRDEISDEYKWKLEDMYETDELWEAECEKA---SQIAEKLSGFKGHLAD-----SAAT 57

Query: 87  LGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEI 146
           L     + + +   + RI  YA    + + +    + + +            L F + EI
Sbjct: 58  LLDFFKKQDELSYYLERIVVYANERSHQDTAVSKYQAYVSKAETLTVQASGALAFASPEI 117

Query: 147 NTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFC 206
             +D+  LE  Y++    + Y   I  I + K+H LS   E +L+   ++       F  
Sbjct: 118 LQIDDKRLESFYSESNELMHYKRAIDEIMRQKEHTLSAAEENILAQCGEMAAAPENIFSM 177

Query: 207 ENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFIT 260
            N   ++F           +I            DR +RK   + +  ++ K S+  S + 
Sbjct: 178 FNNADIKFPYITDVEGNKIRITHGNFIDFLSSKDRSLRKQVFRGVYDSYKKWSNTVSMMY 237

Query: 261 NTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWL 320
            +  K++    R RKY+          ++   V + L+    + +    HRY  L+KK L
Sbjct: 238 ISKLKNDTFYARVRKYDSARTMYLSGGDIPESVYDNLI-ETVHAHLPALHRYMALRKKLL 296

Query: 321 KLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQY 380
            ++ ++ +D  AP+    Q    ++ A+ LV ++      +     +      WID  + 
Sbjct: 297 GVEHLHMYDLFAPIVDNVQTTYTYDEAKKLVAKALEPMGDEYVSTLKAGMESGWIDVYEN 356

Query: 381 DGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSL 440
           + K SGA++ G     HPY+LLNY      V TLAHE+GH +H   S+E Q I      +
Sbjct: 357 ENKRSGAYSWG-AYGTHPYVLLNYADNLDSVFTLAHEMGHAMHTYYSNEHQSITYAGYLI 415

Query: 441 TLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTER 500
            +AE AS   E+L    +L+    + ERK L+ + ++    ++ RQ  F +FE   H + 
Sbjct: 416 FVAEVASTCNESLLMHYMLEHCEDENERKYLMTHFLDGFRTTLFRQAQFAEFEHIAHRKM 475

Query: 501 RSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCL 560
           +    +    +NE+W E   +  GP   + D E    WM +PHF  + +YVY Y+ G   
Sbjct: 476 QKGEPVTKDVLNELWYELNVQYYGPDMRVDD-EISYEWMRIPHFY-TPYYVYQYSTGYSA 533

Query: 561 VNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMI 620
             +              +   N L  G SK+  ELL    +++S P   +  L   E  +
Sbjct: 534 AVAFSKKILEEGKPAVDKYIGNFLCGGCSKNPIELLKSAGVDMSTPKPVDDALNVFEDYL 593

Query: 621 DDVE 624
              E
Sbjct: 594 KQFE 597


>gi|323488787|ref|ZP_08094027.1| oligoendopeptidase F [Planococcus donghaensis MPA1U2]
 gi|323397485|gb|EGA90291.1| oligoendopeptidase F [Planococcus donghaensis MPA1U2]
          Length = 602

 Score =  440 bits (1131), Expect = e-121,   Method: Composition-based stats.
 Identities = 138/601 (22%), Positives = 265/601 (44%), Gaps = 18/601 (2%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
              + ++E +     W LED++ S +  E   +   +   S      ++G L      ++
Sbjct: 2   AEKVLTREEVPTELTWKLEDIFESDELWE--KEFAEVSALSNK-AESFQGTLH-----ES 53

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
             +L   +   + + E + R+ +Y+ + Y+ + ++   +   + I +  A     L F  
Sbjct: 54  AEALYKGMVYRDELTERLRRLYTYSHMRYDQDTTNSKYQALDSRIKSLFAKVSAGLSFMT 113

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            EI  ++E++L     +      Y   ++ +  ++ H+L  + E LL+  S+V R + + 
Sbjct: 114 PEILAIEESVLNDYVEKHEGLSLYKQALEELNSMRPHVLPAEQESLLAQMSEVSRASSET 173

Query: 204 FFCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           F   N   L F   +       +I      +     DR VR+ A KA+  T+ K  + F+
Sbjct: 174 FGMLNNADLEFPEIEDESGEKVQITHGNYIRFLEGKDRRVREDAFKAIYATYGKFRNTFA 233

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
              +   K + +  R RK+E    +    +++   V + L+    N      HRY  L+K
Sbjct: 234 STLSGNIKKDNVSARIRKFESARQAALAEDHIPEAVYDNLV-ETVNNNLHLLHRYSALRK 292

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           + L LD ++ WD   PL    +  +P+E A  ++L        +   I ++   + W+D 
Sbjct: 293 EVLGLDKVHMWDLHTPLVKEVKMEMPYEKATGVMLNGLEALGEEYVGIVKEGIDNRWVDV 352

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   + + Q  +  +
Sbjct: 353 KENKGKRSGAYSSG-AYGTNPYILMNWQDNVDNLYTLAHEFGHSVHSYYTRKNQPYVYGD 411

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
            S+ +AE AS   E L  + ++++    +ER  LL + ++    ++ RQ  F +FE  +H
Sbjct: 412 YSIFVAEVASTTNEALLNEYMVKSTDDDQERIYLLNHWLDGFRGTVFRQTMFAEFEHLIH 471

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
              +    +   R+ E++ E  ++  GP   +SD E G  W  +PHF   ++YV+ YA G
Sbjct: 472 KMDQDGEALTADRLTEVYYELNQKYYGPDV-VSDEEIGMEWARIPHFY-YNYYVFQYATG 529

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                +L                   L+AG+S +  E+L    ++++     E      E
Sbjct: 530 FSAATALSKGILEEGQPAVDRYINEFLKAGSSDYPIEVLKKAGVDMTQSKAIEEACMVFE 589

Query: 618 K 618
           +
Sbjct: 590 Q 590


>gi|169347199|ref|ZP_02866138.1| oligoendopeptidase F [Clostridium perfringens C str. JGS1495]
 gi|169296595|gb|EDS78726.1| oligoendopeptidase F [Clostridium perfringens C str. JGS1495]
          Length = 599

 Score =  439 bits (1129), Expect = e-121,   Method: Composition-based stats.
 Identities = 142/612 (23%), Positives = 274/612 (44%), Gaps = 23/612 (3%)

Query: 24  MTTMDS---QENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
           M+ +     ++ +    +W ++ +Y +      + ++  ++ E+   K  +EG L     
Sbjct: 1   MSEVKKLRIRDEIPESDKWRIDKIYETPAKW--NEELNKLKEEAPKLK-DFEGKLG---- 53

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
             N   L A +   E++   +G++  YA +  + + S+P ++     I+   A+F     
Sbjct: 54  --NKEDLKAFLLLNEKLSRKLGKLYVYAHMRSHEDTSNPEMQSLVNKIDPYSAEFSSYTA 111

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           +F  EI +L E  +E    +D    +Y  + + I   K H+LS ++E +L+  S      
Sbjct: 112 YFVPEILSLKEGTIENFINEDKDLKQYKIYFEMILNEKPHILSKEVESVLASVSDCLGAP 171

Query: 201 LKRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              +       + F     +      +            DR+VR++A K L  T+ K  +
Sbjct: 172 ENIYSMLTNSDMTFGEIVDESSRKVELTEGNYISFIKSKDRKVREAAFKLLFETYKKYEN 231

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
             +    +  K+   + + RKY    ++    NN+   V    +++  +      HRY  
Sbjct: 232 TLATSLTSSIKNFVFESKTRKYNSSLEASLKPNNIPVEVYYNALKT-VDENMDALHRYVR 290

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           +KKK L L+ ++ +D   P+    ++ + ++ A  L  +       +   I  +     W
Sbjct: 291 IKKKLLNLEEIHMYDLYVPVIECKKEHLEYKDAISLAEEGLKPLGKEYLDIFNEGINEGW 350

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           ID  +  GK SGA++ G+  ++ PY+LLNY  +  D  TLAHE+GH IH   + +TQ  +
Sbjct: 351 IDVYENKGKRSGAYSWGSYDTM-PYVLLNYNYELNDASTLAHEMGHSIHSYYTRKTQPYI 409

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
             + SL  AE AS   E L    L++  + K ++  L+  ++E +  ++ RQ+ F +FEL
Sbjct: 410 YGDYSLFCAEVASTTNEILLIHHLIEKETDKNKKLYLINQELEQIRTTVFRQLMFAEFEL 469

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
           K H    +   + +  + ++W +   +  G   ++ D E    W  +PHF  S FYVY Y
Sbjct: 470 KTHEAIENGESLTSEVLCKMWKDINIKYFGEDMNV-DEEISIEWARIPHFY-SDFYVYQY 527

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G    +S  +   S   +   EKY   L+AG S +  + L    ++++     +  L 
Sbjct: 528 ATGYAAASSFANSILSKGEEAV-EKYKGFLKAGGSMYPIDTLKMAGVDMTTSKPLKDTLD 586

Query: 615 TVEKMIDDVEKM 626
              +++D +E++
Sbjct: 587 RFNELLDMLEEI 598


>gi|291525930|emb|CBK91517.1| oligopeptidase F. Metallo peptidase. MEROPS family M03B
           [Eubacterium rectale DSM 17629]
          Length = 601

 Score =  439 bits (1129), Expect = e-121,   Method: Composition-based stats.
 Identities = 139/605 (22%), Positives = 251/605 (41%), Gaps = 18/605 (2%)

Query: 27  MDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS 86
           +  ++ + +  +W LED+Y + +  E   + E     +    + ++G+LA      +  +
Sbjct: 6   LQKRDEISDEYKWKLEDMYETDELWE--AECEKASQLAEKL-SGFKGHLAD-----SAAT 57

Query: 87  LGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEI 146
           L     + + +   + RI  YA    + + +    + + +            L F + EI
Sbjct: 58  LLDFFKKQDELSYYLERIVVYANERSHQDTAVSKYQAYVSKAETLTVQASGALAFASPEI 117

Query: 147 NTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFC 206
             +D+  LE  Y++    + Y   I  I + K H LS   E +L+   ++       F  
Sbjct: 118 LQIDDKRLESFYSESNELMHYKRAIDEIMRQKAHTLSAAEENILAQCGEMAAAPENIFSM 177

Query: 207 ENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFIT 260
            N   ++F           +I            DR +RK   + +  ++ K S+  S + 
Sbjct: 178 FNNADIKFPYITDVEGNKIRITHGNFIDFLSSKDRSLRKQVFRGVYDSYKKWSNTVSMMY 237

Query: 261 NTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWL 320
            +  K++    R RKY+          ++   V + L+    + +    HRY  L+KK L
Sbjct: 238 ISKLKNDTFYARVRKYDSARAMYLSDGDIPESVYDNLI-ETVHAHLPALHRYMALRKKLL 296

Query: 321 KLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQY 380
            ++ ++ +D  AP+    Q    ++ A+ LV ++      +     +      WID  + 
Sbjct: 297 GVEHLHMYDLFAPIVDNVQTTYTYDEAKKLVAKALEPMGDEYVSTLKSGMESGWIDVYEN 356

Query: 381 DGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSL 440
           + K SGA++ G     HPY+LLNY      V TLAHE+GH +H   S+E Q I      +
Sbjct: 357 ENKRSGAYSWG-AYGTHPYVLLNYADNLDSVFTLAHEMGHAMHTYYSNEHQSITYAGYLI 415

Query: 441 TLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTER 500
            +AE AS   E+L    +L+    + ERK L+ + ++    ++ RQ  F +FE   H + 
Sbjct: 416 FVAEVASTCNESLLMHYMLEHCEDENERKYLMTHFLDGFRTTLFRQAQFAEFEHIAHRKM 475

Query: 501 RSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCL 560
           +    +    +NE+W E   +  G    + D E    WM +PHF  + +YVY Y+ G   
Sbjct: 476 QKGEPVTKDVLNELWHELNVQYYGSDMRVDD-EISYEWMRIPHFY-TPYYVYQYSTGYSA 533

Query: 561 VNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMI 620
             +              +   N L  G SK+  ELL    +++S P   +  L   E  +
Sbjct: 534 AVAFSKKILEEGKPAVDKYIGNFLCGGCSKNPIELLKSAGVDMSTPKPVDDALNVFEDYL 593

Query: 621 DDVEK 625
              E 
Sbjct: 594 KQFEA 598


>gi|251796127|ref|YP_003010858.1| oligoendopeptidase F [Paenibacillus sp. JDR-2]
 gi|247543753|gb|ACT00772.1| oligoendopeptidase F [Paenibacillus sp. JDR-2]
          Length = 596

 Score =  439 bits (1128), Expect = e-121,   Method: Composition-based stats.
 Identities = 135/609 (22%), Positives = 247/609 (40%), Gaps = 21/609 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           M  +  +       RW LEDL+    +     +    +         +EG L+      +
Sbjct: 1   MNHVPKRSETAVEARWKLEDLFADQAAW--DKEFAEAKALIKK-VGAFEGKLS------D 51

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
              L A     + +   + R+  Y+ + ++ + + PT +           +  + L F  
Sbjct: 52  PAQLKACFELEDELSLHVERLYVYSNMKHHEDTAEPTYQALSDKAKKISVETGEALSFIT 111

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            E+ +L +A L+           +   ++ +R+ K H+LS   E L++    V       
Sbjct: 112 PEVLSLSDAALDALIENK-DLAVFKHTLEEMRRQKAHVLSKAEEALMAQVGNVSSAPGSI 170

Query: 204 FFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           +   N   L+F     +      +   +  +     +REVR +A + +  T+ K  +  +
Sbjct: 171 YSILNNADLKFPKVKNEAGEEVELTQGRYIQFLESKNREVRANAFRTMYDTYGKLKNTLA 230

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
              N          R RKY          +N+   V   L+ ++  +     +RY  L+K
Sbjct: 231 TTLNANVTKNIFYARARKYPSALGMSLYGDNIPESVYTNLIDTIHKHM-PLMYRYMNLRK 289

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           K L +D ++ +D  APL       I ++ A+ +V +S          + +  F + WID 
Sbjct: 290 KLLGVDELHMYDLFAPLVDEFDMEIKYDDAKKIVKESLKPLGEDYLSVLQDGFDNGWIDV 349

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            + +GK SGA++ G     HPY+LLN+      + TL HE+GH +H   S   Q      
Sbjct: 350 YENEGKRSGAYSWGAF-GTHPYVLLNHKDNLNSMFTLTHEMGHALHSYYSDTNQNYRDAQ 408

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
            ++ LAE AS   E L  D LL  ++  +E+  LL    +    ++ RQ  F +FE  +H
Sbjct: 409 YTIFLAEVASTLNEALLMDYLLNKSTDPKEKMFLLTYYADQFRTTVFRQTMFAEFEKIIH 468

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
            +      +    +++I+ +      G    + D +    W  +PHF  S FYVY YA G
Sbjct: 469 EKTEQGESLTPQDLSKIYYDLNVLYYGKDMVV-DKDIEMEWARIPHFYNS-FYVYKYATG 526

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                S              ++YL  L++G S     +L    +++S P   E+ +   E
Sbjct: 527 FSAATSFSKQILEEGAPAV-DRYLGFLKSGGSDFSINILKKAGVDMSSPEPIEQAMSVFE 585

Query: 618 KMIDDVEKM 626
            +I+ +E++
Sbjct: 586 SLIEQMEEL 594


>gi|254519467|ref|ZP_05131523.1| oligoendopeptidase F [Clostridium sp. 7_2_43FAA]
 gi|226913216|gb|EEH98417.1| oligoendopeptidase F [Clostridium sp. 7_2_43FAA]
          Length = 600

 Score =  439 bits (1128), Expect = e-121,   Method: Composition-based stats.
 Identities = 143/610 (23%), Positives = 269/610 (44%), Gaps = 20/610 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           S+   +  +E + N  +W ++ ++ + +  E     E ++ E+ + K  +EG L      
Sbjct: 2   SESKVLKKREEIENKYKWKVDKIFSTDEEWE--KTFEELKKEAPSLK-DFEGKLN----- 53

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            +  ++   + +Y  +      +  YA L  + + S+P  +     +++ +A+F     +
Sbjct: 54  -DEENILGYLNKYVDLGIKAETVYVYAHLKCDEDTSNPKYQSMMNKVDSYMAEFASYTAY 112

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
           F  EI +L++  +  +   +     YS   ++I K K H+LS + E LL+  S       
Sbjct: 113 FVPEILSLEDDFIRNTINTNEKLKMYSFMFEDILKEKPHILSKEQEELLAQVSDCLDAPD 172

Query: 202 KRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
                     ++F     +      +            DR+VR+ A K L  ++    + 
Sbjct: 173 SIHNMLTNADMKFGDILDEDGKKVELTEGNYSGFIKSKDRKVREEAFKTLFKSYKDLENT 232

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+    +  K+     + RKY    ++    N++   V +  ++++     K+ HRY  L
Sbjct: 233 FATTLTSSIKNFNFSAKVRKYNSALEASLKPNDIPLEVYKNSLKTIDEN-LKSLHRYVAL 291

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           KK+ L L+ M+ +D   P+    ++ I F  A D+VL+       +   I +      WI
Sbjct: 292 KKQLLGLNEMHMYDLYVPVIEIPKEHIEFNSAVDMVLEGLKPLGDEYLNIFKGGVEEGWI 351

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  Q  GK  GA++ G   ++ PY+LLNY  +  DV TLAHE+GH IH   S + Q  + 
Sbjct: 352 DIYQNKGKRGGAYSWGGYKTM-PYVLLNYNYELHDVSTLAHEMGHSIHSYYSRKEQPYIY 410

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
              +L  AE AS   E L    L+   + K+++  L+  ++E +  ++ RQ+ F +FEL 
Sbjct: 411 AGYTLFCAEVASTTNEALLIHHLINKETDKKKKLYLINQELEQIRTTVFRQLMFAEFELY 470

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
            H        +     N+ W E   +  GP   + D E    W  +PHF  S FYVY YA
Sbjct: 471 THESLEKGIPLTAEDYNKAWHELNVKYFGPDM-IVDEEINIEWARIPHFY-SDFYVYQYA 528

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G    ++          +    +Y+  L++G S +  E+L    ++++     E  ++ 
Sbjct: 529 TGYAAASAFAKSILE-GKEDAVPRYIEFLKSGGSNYPIEILKKAGVDMTTSRPLEATIER 587

Query: 616 VEKMIDDVEK 625
             +++D ++K
Sbjct: 588 FNELLDMLDK 597


>gi|299535945|ref|ZP_07049264.1| oligoendopeptidase F [Lysinibacillus fusiformis ZC1]
 gi|298728550|gb|EFI69106.1| oligoendopeptidase F [Lysinibacillus fusiformis ZC1]
          Length = 605

 Score =  438 bits (1126), Expect = e-120,   Method: Composition-based stats.
 Identities = 138/602 (22%), Positives = 261/602 (43%), Gaps = 18/602 (2%)

Query: 21  SSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
           +S+   +  ++ +     W LED++ + ++ E   +++ +   +      + G L     
Sbjct: 2   ASNSNQVLVRKEVPEELTWRLEDIFATDEAWE--EELKEVAEHAKQ-APSYAGTL----- 53

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
                +L AA+  ++ I E   ++ +YA + Y+ + ++   +   + I          L 
Sbjct: 54  NNGAEALLAALQYHDHIYERAMKLYTYAHMRYDQDTTNGFYQDMNSRIQTLATSISAGLS 113

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           +   EI TL E  +E+   ++     Y   +K I   + H+L  + E LL+  S+V   A
Sbjct: 114 YLTPEILTLSEETIERYLTENQDLQLYKQSLKEITMARPHVLPAEQEALLAQMSEVTGTA 173

Query: 201 LKRFFCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              F   N   + F           ++      K     DR VR+ A KA+  T+ K  +
Sbjct: 174 SNTFSMLNNADMVFPHVKNEEGEEVQLTHGNYIKFLESKDRSVREGAFKAMYETYGKFKN 233

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
            FS       K   +  R R YE    +   +N +   V + L++++  +      RY  
Sbjct: 234 TFSATLTGNVKKHNVSARIRHYESARHAAMSNNFIPENVYDQLVETIHKH-LPAMQRYIS 292

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+KK L +D ++ WD  APL    +  + ++ A+D+++++ A    +   I +    + W
Sbjct: 293 LRKKLLGVDELHMWDLFAPLVKEVEMKVSYDEAKDILVKALAPLGEEYQSIVQNGLDNRW 352

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   S   Q  +
Sbjct: 353 VDVLENKGKRSGAYSSG-AYGTNPYILMNWQDNVNNLFTLAHEFGHSVHSYYSRNNQPFV 411

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
             + S+ +AE AS   E L  D LL+     +++  LL + ++   +++ RQ  F +FE 
Sbjct: 412 YGDYSIFVAEVASTCNEELLNDYLLKTIDDPQQKIYLLNHWLDGFRSTVFRQTMFAEFEH 471

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
            +H   ++   +   R+ E++ E  K+  G    + D E G  W  +PHF  + +     
Sbjct: 472 LIHQMDKNGESLTADRLTEVYYELNKKYFGDDMVV-DEEIGLEWARIPHFYYNYYVYQY- 529

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     +L            +    N L+AG S    E+L    +++++    E   +
Sbjct: 530 ATGKSAATALSKQILEEGAPAVERYINNFLKAGCSDFPIEVLKAAGVDMNEAKPIEDACK 589

Query: 615 TV 616
             
Sbjct: 590 VF 591


>gi|169826800|ref|YP_001696958.1| oligoendopeptidase F [Lysinibacillus sphaericus C3-41]
 gi|168991288|gb|ACA38828.1| oligoendopeptidase F [Lysinibacillus sphaericus C3-41]
          Length = 605

 Score =  438 bits (1126), Expect = e-120,   Method: Composition-based stats.
 Identities = 141/605 (23%), Positives = 258/605 (42%), Gaps = 18/605 (2%)

Query: 21  SSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
           +S+   +  +  +     W LED++ S    E   + + +   +    + + G L     
Sbjct: 2   ASNSNQILVRNEVPKELTWRLEDIFASDALWE--EEFKEVAELAKK-ASSFAGTL----- 53

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
                +L AA+  ++ I E   ++ +YA + Y+ + ++   +   + I          L 
Sbjct: 54  NNGAQALLAALQYHDHIYERAMKLYTYAHMRYDQDTTNSFYQDMNSRIQTLATSISAGLS 113

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           F   EI  L+E  +E   A+      Y   +K I   + H+L  + E LL+  S+V   A
Sbjct: 114 FLTPEILALNEETIESYLAESQDLQLYKQSLKEITMARPHVLPAEQEALLAQMSEVTGTA 173

Query: 201 LKRFFCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              F   N   L F           ++      K     DR VR+ A KA+  T+ K  +
Sbjct: 174 SNTFSMLNNADLEFPFVKNEEGEEVQLTHGNYIKFLESKDRSVREGAFKAMYETYGKFKN 233

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
            FS       K   +  R R Y+   ++   +N +   V + L++++  +      RY  
Sbjct: 234 TFSSTLTGNVKKHNVSARIRHYDSAREAAMSNNFIPENVYDQLVETIHKH-LPAMQRYIS 292

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+KK L +D ++ WD  APL    +  + ++ A+D+++++ A    +   I +    + W
Sbjct: 293 LRKKLLGVDELHMWDLFAPLVKEVEMKVTYDEAKDILVKALAPLGEEYQNIVQNGLDNRW 352

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D  +  GK SGA++ G     +PYIL+N+     ++ TLAHE GH +H   S   Q  +
Sbjct: 353 VDVLENKGKRSGAYSSG-AYGTNPYILMNWQDNVNNLFTLAHEFGHSVHSYYSRNNQPFV 411

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
             + S+ +AE AS   E L  D LL+     +++  LL + ++   +++ RQ  F +FE 
Sbjct: 412 YGDYSIFVAEVASTCNEELLNDYLLKTIDDPQQKIYLLNHWLDGFRSTVFRQTMFAEFEH 471

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
            +H   ++   +   R+ E++ E  K+  G    + D E G  W  +PHF  + +     
Sbjct: 472 LIHQMDKNGESLTADRLTEVYYELNKKYFGDDMAV-DEEIGLEWARIPHFYYNYYVYQY- 529

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     +L            +    N L+AG S    E+L    ++++     E   +
Sbjct: 530 ATGKSAATALSKQILEEGKPAVERYINNFLKAGCSDFPIEVLKAAGVDMNVAKPIEDACK 589

Query: 615 TVEKM 619
             E  
Sbjct: 590 VFEDR 594


>gi|314937672|ref|ZP_07844997.1| oligoendopeptidase F [Enterococcus faecium TX0133a04]
 gi|314940932|ref|ZP_07847838.1| oligoendopeptidase F [Enterococcus faecium TX0133C]
 gi|314948047|ref|ZP_07851449.1| oligoendopeptidase F [Enterococcus faecium TX0082]
 gi|314952326|ref|ZP_07855336.1| oligoendopeptidase F [Enterococcus faecium TX0133A]
 gi|314991950|ref|ZP_07857405.1| oligoendopeptidase F [Enterococcus faecium TX0133B]
 gi|314995208|ref|ZP_07860322.1| oligoendopeptidase F [Enterococcus faecium TX0133a01]
 gi|313590617|gb|EFR69462.1| oligoendopeptidase F [Enterococcus faecium TX0133a01]
 gi|313593534|gb|EFR72379.1| oligoendopeptidase F [Enterococcus faecium TX0133B]
 gi|313595541|gb|EFR74386.1| oligoendopeptidase F [Enterococcus faecium TX0133A]
 gi|313600290|gb|EFR79133.1| oligoendopeptidase F [Enterococcus faecium TX0133C]
 gi|313642945|gb|EFS07525.1| oligoendopeptidase F [Enterococcus faecium TX0133a04]
 gi|313645463|gb|EFS10043.1| oligoendopeptidase F [Enterococcus faecium TX0082]
          Length = 615

 Score =  438 bits (1126), Expect = e-120,   Method: Composition-based stats.
 Identities = 138/610 (22%), Positives = 271/610 (44%), Gaps = 19/610 (3%)

Query: 23  DMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           ++  +  +E L     W+L  ++ S   QE       +  E      + +G L      +
Sbjct: 15  EVKQLPKREELPENLTWDLTKIFSS--DQEFDEKYLELSEELKQ-SEKHKGTLD-----Q 66

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
                  AI    R+      I  YA L  + +  +   +  Y   ++  +   + + +F
Sbjct: 67  GASQFLNAIEFVLRVYRQTEVIYVYAHLKNDQDTGNTDYQALYARASSLFSKVSEAVSWF 126

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
             EI  L +  + Q + ++P    Y  +I+ I   + H+LS + E LL+   ++   +  
Sbjct: 127 EPEILQLSDDQIWQYFKEEPKLEVYRHYIQQIVDNRAHVLSAEQESLLAGAGEIFDASSD 186

Query: 203 RFFCENIESLRFKIND------QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIF 256
            F   N   L F   +       ++      +    +DR VR++A K L   + +  + F
Sbjct: 187 TFAVLNNADLVFPTIEGENGEIVQLSHGVYGQLLESTDRRVREAAFKGLYSVYEQFRNTF 246

Query: 257 SFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELK 316
           +    T  K    + + R Y    ++   +N++   V + L+    N +    HRY EL+
Sbjct: 247 ASTLGTHIKGHNFKAKVRNYSSAREASLSNNHIPESVYDTLVDV-VNKHLPLLHRYMELR 305

Query: 317 KKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWID 376
           K+ L+++ ++ +D   P+ G +     +E A++  L++      +   I EK F+  WID
Sbjct: 306 KRLLEVEKLHMYDLYTPVLGEAPITFTYEEAKEKALEALKPMGEEYMAIVEKAFSERWID 365

Query: 377 APQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTN 436
             +  GK SGA++ G+    +PYILLN+      + TL HE+GH +H   +   Q  +  
Sbjct: 366 VVENKGKRSGAYSSGSYD-TNPYILLNWHDTLDQLFTLVHEMGHSVHSYFTRSNQPYVYG 424

Query: 437 NSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKL 496
           + S+ LAE AS   E +  + LL+       R  +L + ++    ++ RQ  F +FE  +
Sbjct: 425 DYSIFLAEIASTTNENILTEYLLETEKDPRVRAYVLNHYLDGFKGTVFRQTQFAEFEHFM 484

Query: 497 HTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAF 556
           HTE      + +  +++ + +   +  GPA +  D E    W  +PHF   ++YV+ Y+ 
Sbjct: 485 HTEDEKGVPLTSEYLSDSYGKLNAKYYGPAVE-EDPEIKFEWSRIPHFY-YNYYVFQYST 542

Query: 557 GNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTV 616
           G    ++L     +   +   E YL  L+AGNS +  E++    ++++   + E  +   
Sbjct: 543 GFSAASALAKKILNQEPEAL-ENYLAYLKAGNSDYPVEVMKKAGVDMTQAAYIEDAMSMF 601

Query: 617 EKMIDDVEKM 626
           E+ ++++E++
Sbjct: 602 EQRLNELEEL 611


>gi|150019139|ref|YP_001311393.1| oligoendopeptidase F [Clostridium beijerinckii NCIMB 8052]
 gi|149905604|gb|ABR36437.1| oligoendopeptidase F [Clostridium beijerinckii NCIMB 8052]
          Length = 594

 Score =  438 bits (1125), Expect = e-120,   Method: Composition-based stats.
 Identities = 146/608 (24%), Positives = 273/608 (44%), Gaps = 20/608 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           M+ +  +E + +  +W ++ +Y S +  E   D E +++E++  K  + G L       N
Sbjct: 1   MSDLKKREEIEDKFKWKVDKIYKSIEDWE--KDFEDVKNEAVKLK-DFSGKLV------N 51

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
             ++   +   E++      +  YA L  + + S+ T +   + ++  +A+      FF 
Sbjct: 52  GEAILDYLKFNEKVSRKAENLFIYAHLKCDEDTSNTTYQSLMSKVDIYMAELASYTAFFV 111

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            EI +LD++ ++    +     ++   I++I K K H+LS +ME LL+  S         
Sbjct: 112 PEILSLDDSFIKSEINRLDELKQFEFLIEDILKEKPHILSKEMEELLAAASDCLDAPSAI 171

Query: 204 FFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
                   + F   + +      +            +REVRK+A + L   ++K  +  +
Sbjct: 172 HNILTNADMTFGKIEDEDGNEVELTEGNYSSFIRGKNREVRKAAFERLFGEYDKLKNTLA 231

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
              +   K      R RKY    ++    NN+   V +  +  V N    + HRY ++KK
Sbjct: 232 TSLSASIKTFNFSSRVRKYNNALEASLKPNNIPLEVYKNAI-KVINNNLDSLHRYVKIKK 290

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           K L LD ++ +D   P+    ++ I F    ++VL++ +    +   I +    + WID 
Sbjct: 291 KLLGLDEIHMYDLYVPVIEIPKEKIEFNDGVNIVLKALSPLGTEYLDIFKSGVNNGWIDI 350

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK  GA++ G   ++ PY+LLNY  +  DV TLAHE+GH IH   S + Q     N
Sbjct: 351 YENKGKRGGAYSWGGYDTM-PYVLLNYNNELGDVSTLAHEMGHSIHSYYSRKEQPYYYAN 409

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
            +L  AE AS   E+L    L++    ++++  L+  ++E +  ++ RQ+ F +FEL  H
Sbjct: 410 YTLFCAEVASTTNESLLIHYLIENEKDEKKKLYLINQELEQIRTTVFRQLMFAEFELYTH 469

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
                   +     N+ W +   +  G    + D E    W  +PHF  S FYVY YA G
Sbjct: 470 ETLEKGIPLTAEDYNKAWHDLNVKYFGNEIVI-DKEVDVEWSRIPHFY-SDFYVYQYATG 527

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
               ++       +  +   EKY   L++G S +   +L    ++++     E  ++   
Sbjct: 528 YAAASAFSKAIL-DGKENAVEKYKGFLKSGGSDYPINILRNAGVDMTTDVPIEATIKRFN 586

Query: 618 KMIDDVEK 625
           +++D +EK
Sbjct: 587 ELLDMIEK 594


>gi|261367089|ref|ZP_05979972.1| oligoendopeptidase F [Subdoligranulum variabile DSM 15176]
 gi|282571211|gb|EFB76746.1| oligoendopeptidase F [Subdoligranulum variabile DSM 15176]
          Length = 601

 Score =  438 bits (1125), Expect = e-120,   Method: Composition-based stats.
 Identities = 145/610 (23%), Positives = 250/610 (40%), Gaps = 21/610 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           S+   +  ++ +    +W+L  +Y    + E   D   ++ +  A  T + G L      
Sbjct: 2   SETQVLKERDEMDPRYQWDLTPMYHDDAAWE--ADFATLDDQVQAM-TAFAGTL------ 52

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
           K+  S+GA +     +   +  +  YA L  + +  +   +  Y  I AK       + F
Sbjct: 53  KDAVSIGAYLDAGTDLSRKLSNLYCYASLRRSEDTRAEAGQSMYARITAKYVQAMAAISF 112

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              EI +L E  L++   +D     +   ++N+ + K H LS   E LL+   +      
Sbjct: 113 AEPEILSLPEETLQE-IVRDEQLADHKFTMENLLRQKPHTLSAPEEKLLATFGEALGAPS 171

Query: 202 KRFFCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
           +         L F           ++  +         DR +R++A  +    + +  + 
Sbjct: 172 EIADNLQDADLVFDSVQDSAGNTVEVTGSNYIMLQMSPDRTLRENAFVSFYKGYRQHINT 231

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+       K    +   R YE          N+   V + L+ +V+ +     +RY  L
Sbjct: 232 FASAYAGAVKGATAEAAVRHYESSRAMSMAGENIPGEVYDNLIAAVRKHM-PAMYRYVAL 290

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +KK L L  ++++D  APL G  +    +  A+ +VL++          +  K F   WI
Sbjct: 291 RKKILGLKELHYYDVYAPLVGEVKVRYTYAQAQQMVLEAVKPLGKDYCNLVRKAFAERWI 350

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D     GK  GA++ GT  S +PYIL N+ G    V T+AHE+GH +H   S+  Q    
Sbjct: 351 DVYPNKGKSGGAYSSGTYDS-NPYILTNFTGTLDSVSTIAHEMGHSMHTWHSNHHQPPQY 409

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            + +L +AE AS   E L  + LLQ     + R  LL   +E+   ++ RQ  F +FE +
Sbjct: 410 ADYTLFVAEVASTVNENLLIEQLLQKEQEPQMRLYLLNQYLENFKGTVYRQTMFAEFEKE 469

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
            H        +    +N ++    +E  GP   + D E    W  +PHF    FYVY YA
Sbjct: 470 AHGMAERGEALSPAALNGLYKCLVEEYFGPELVVDD-EVQYEWARIPHFYR-PFYVYKYA 527

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L +            +Y   L  G S +  + L    ++L+ P   E  L  
Sbjct: 528 TGYSTAVALSEAILKEGEPAV-RRYREFLSMGGSAYPLDELRHAGVDLATPEPVEAALGK 586

Query: 616 VEKMIDDVEK 625
            E++++D EK
Sbjct: 587 FERILEDAEK 596


>gi|293376462|ref|ZP_06622691.1| oligoendopeptidase F [Turicibacter sanguinis PC909]
 gi|292644884|gb|EFF62965.1| oligoendopeptidase F [Turicibacter sanguinis PC909]
          Length = 599

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 148/606 (24%), Positives = 274/606 (45%), Gaps = 20/606 (3%)

Query: 27  MDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS 86
           + S+  +    +W ++ +Y S ++ E   D + ++ ++   K  ++G L + T       
Sbjct: 7   LKSRNEIEEESKWKIDKVYASTEAWE--KDFQAVKEKAPKLKE-FQGRLGNIT------D 57

Query: 87  LGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEI 146
           L   +   E +  ++ ++  +A +  + + S+   +     I+  +A F     FF  EI
Sbjct: 58  LKEYLKVEEELSRVLEKLYVFAHMKSHEDTSNSEFQTLVNKIDPFMAQFSSYNAFFTPEI 117

Query: 147 NTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFC 206
            +L++  +E+    D     Y  + K + K K H+LS +ME LL+  S     +   +  
Sbjct: 118 LSLEDGTIEKMLESDDELKVYDTFFKVLLKEKPHILSKEMEELLASASDCLGASESIYTM 177

Query: 207 ENIESLRFKI------NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFIT 260
                + F         D ++            DR VR+ A K L  T+ K  +  +   
Sbjct: 178 LTNADMTFGTIKGENGQDIELTEGNYSSLIKSKDRRVREEAFKLLFSTYKKYENTIATSL 237

Query: 261 NTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWL 320
            +  K      + RKY    ++    N++   V +  +Q++ N   K+ HRY  LKKK L
Sbjct: 238 TSSLKTFIFYAKTRKYASSLEASLKPNDIPVEVYKNAIQTI-NNNLKSLHRYVGLKKKLL 296

Query: 321 KLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQY 380
            LD ++ +D    +    +  I +  A ++V +       +   I ++     W+D  + 
Sbjct: 297 GLDEIHMYDLYVSVIDIPKQHIEYSDAIEMVKEGLKPLGQEYLDIFDEGIKDGWVDVYEN 356

Query: 381 DGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSL 440
            GK SGA++ G+  ++ PY+LLNY  +  DV TLAHE+GH IH   + + Q  +  N +L
Sbjct: 357 KGKKSGAYSWGSYDTM-PYVLLNYNYELNDVSTLAHEMGHSIHSYYTRKEQPYVYGNYTL 415

Query: 441 TLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTER 500
             AE AS   E L  + L+     K ++  L+  ++E +  ++ RQ+ F +FEL  H   
Sbjct: 416 FCAEVASTTNEILLINDLIHKEQDKNKKLYLINQELEQIRATVYRQLMFAEFELITHETL 475

Query: 501 RSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCL 560
            + G + +  ++ IW +  K+  GP   + D E    W  +PHF  S FYVY YA G   
Sbjct: 476 ENGGSLTSDDLDNIWYDLNKKYFGPEMVVDD-EIKIEWARIPHFY-SDFYVYQYATGYAA 533

Query: 561 VNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMI 620
            ++       N  +   EKY   L+AG S +  + L    ++++     E  ++   +++
Sbjct: 534 ASAFAKSILENG-EVAVEKYKGFLKAGGSLYPIDTLKNAGVDMTTSMPLEATIERFNELL 592

Query: 621 DDVEKM 626
           D +E++
Sbjct: 593 DMLEEL 598


>gi|205372943|ref|ZP_03225751.1| oligopeptidase F [Bacillus coahuilensis m4-4]
          Length = 603

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 138/601 (22%), Positives = 263/601 (43%), Gaps = 19/601 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           ++  T+  +  +     W LED++ S +  E   + + I+         ++G L      
Sbjct: 3   TETKTLPKRSEVSEELTWKLEDIFSSDEKWE--QEFKEIQSLVSR-AETFKGTLG----- 54

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
           ++  +L +A    + + E +G++ +Y+ + Y+ + ++   + +                +
Sbjct: 55  ESSSNLYSAFLFQDEVFERMGKLYTYSHMRYDQDTTNSKYQGYDDRAKNLYTTLASAFSY 114

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
              E+ ++DE  L Q   ++     Y   ++ I K + H+LS + E LL++ S V   A 
Sbjct: 115 VTPEVLSIDEEKLTQFVHENDDLKLYKHALEQINKQRPHILSAEQEALLAEVSDVTSNAS 174

Query: 202 KRFFCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             +   N   L F           ++   +  +     DR VR+ A KA+  T+ K  + 
Sbjct: 175 NTYGMLNNADLEFPSIKDEEGAEVQVTHGRFIRFLESDDRRVREEAFKAVYETYGKFKNT 234

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
           F+   +   K +    R R Y    +S   SN++   V + L++++         RY +L
Sbjct: 235 FATTLSGAIKKDNFYARVRNYGSARESALASNDIPETVYDQLVETINKN-LHLLQRYVKL 293

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L+LD ++ +D   PL    +  + +E A+D +++  A        + ++ F   W+
Sbjct: 294 RKQVLELDELHMYDLYTPLVKEGKFDVSYEEAKDYLMKGLAPLGQDYLNVLQEGFESRWV 353

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK SGA++ GT    +PYIL+N+     ++ TLAHE GH +H   + + Q    
Sbjct: 354 DVVENKGKRSGAYSSGT-YGTNPYILMNWQDNVNNLFTLAHEFGHSLHSYYTRKHQPYPY 412

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            N S+ +AE AS   E L  D LL+     ++R  LL + +E    ++ RQ  F +FE  
Sbjct: 413 GNYSIFVAEVASTCNEALLNDYLLKTIDDDKKRLFLLNHYLEGFRGTVFRQTMFAEFEHI 472

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
           +H + +    +    + E +    K+  G    + D E G  W  +PHF  + +     A
Sbjct: 473 IHKKAQDGVALTADMLTEEYYALNKKYFGDDIVI-DEEIGLEWARIPHFYYNYYVYQY-A 530

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G     +L             E+YL  L+AG+S +  E+L    ++++ P   E   + 
Sbjct: 531 TGFSAATALSKQILEEGQPAV-ERYLEFLKAGSSDYPIEVLKKAGVDMTSPKPIEDACKV 589

Query: 616 V 616
            
Sbjct: 590 F 590


>gi|172058054|ref|YP_001814514.1| oligoendopeptidase F [Exiguobacterium sibiricum 255-15]
 gi|171990575|gb|ACB61497.1| oligoendopeptidase F [Exiguobacterium sibiricum 255-15]
          Length = 600

 Score =  436 bits (1122), Expect = e-120,   Method: Composition-based stats.
 Identities = 136/609 (22%), Positives = 265/609 (43%), Gaps = 18/609 (2%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           M  + +++++     WNLE +Y +++  E   + E ++         ++G LA     ++
Sbjct: 1   MAEVLTRKDVKQEETWNLESIYETNEKWE--EEFESVKAMLPLLVE-YKGRLA-----QS 52

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
             +L   +   + I   + ++ +YA + Y+ N +    +          +     L F  
Sbjct: 53  DATLFEGLQLRDEISRRLHKLYTYAHMRYDENTADSFYQAMNDRARTLASQIGATLAFMT 112

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            E+  + E  +     Q+P    Y      + + ++H+LS   E +L+   +V  ++   
Sbjct: 113 PELLEVPEETIASYLDQNPDLALYRHAFDELNREREHVLSEAEEAILAKAGEVLGQSGTT 172

Query: 204 FFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           F   N   ++F         + ++   +        DR VR++A KA+  T+++ ++  +
Sbjct: 173 FGMLNNADMKFPKIKGEDGEEAELTHGRFITFMESKDRSVREAAFKAMYGTYSQYTNTLA 232

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
                  K +      RK++   +S    N +   V + L+++V  +     HRY  L+K
Sbjct: 233 STLAGSVKKDNFYAEVRKFKTARESALHGNTIPEQVYDGLIEAVHEH-LPLLHRYVALRK 291

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           + L +D ++ +D   PL    +  I +E A+ L++   A   P+   I E+     W+D 
Sbjct: 292 RILGVDELHMYDMYTPLVSEVEMKISYEEAKQLMVDGLAPLGPEYKHILEEGLAERWVDV 351

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK SGA++ G      P+IL+N+     ++ TLAHE GH +H   + + Q     +
Sbjct: 352 RETRGKRSGAYSSGAYD-TQPFILMNWQDNVNNLFTLAHEFGHSVHSYYTRQNQPYAYGD 410

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
            S+ +AE AS   E L  D LL+  + K E+  LL N++E    ++ RQ  F +FE ++H
Sbjct: 411 YSIFVAEVASTTNEALLNDYLLKRVTDKNEKLYLLNNQLETFRGTLFRQTMFAEFEHQIH 470

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
              R    +    + + +    K   G    L D E G  W  +PHF  + +     A G
Sbjct: 471 EAARLGQALTPEFLTKTYYALNKTYFGDGIVL-DEEIGLEWARIPHFYYNYYVYQY-ATG 528

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                +L            +    N L+AG+S +  E+L    ++++     E  L+  E
Sbjct: 529 ISAAAALTSQILEEGEPAVERYINNFLKAGSSDYPIEVLKAAGVDMTTKAPVEAALRQFE 588

Query: 618 KMIDDVEKM 626
           +++D+ E +
Sbjct: 589 RVLDEFEAL 597


>gi|220930819|ref|YP_002507728.1| oligoendopeptidase F [Clostridium cellulolyticum H10]
 gi|220001147|gb|ACL77748.1| oligoendopeptidase F [Clostridium cellulolyticum H10]
          Length = 601

 Score =  436 bits (1122), Expect = e-120,   Method: Composition-based stats.
 Identities = 147/600 (24%), Positives = 260/600 (43%), Gaps = 19/600 (3%)

Query: 25  TTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC 84
            T+  ++++    +W LED+Y   DS E   D + ++  +      ++G L +     + 
Sbjct: 5   KTLPKRKDIEERFKWKLEDIYKDTDSWE--KDFKQVKELAAQMV-NFKGKLGN-----SA 56

Query: 85  HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL 144
            +L     + + +  L  ++  YA +  + +  + T +      +    +    + F   
Sbjct: 57  DTLLDCFKKSDELLSLNDKVFVYARMKRDEDNGNSTYQALTERASTLATEVYAAISFVVP 116

Query: 145 EINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRF 204
           E+ T+ E  L      +     Y   ++   + K+H+L+   E +L+ ++++   A   F
Sbjct: 117 EMLTIPEDKLMSFLNSNKELSVYMFMVQENLRQKEHILTEKEEQILALSTEISDTAGDIF 176

Query: 205 FCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSF 258
              N   ++F     +      +   +        DR VRK A +AL  T++K  +    
Sbjct: 177 TMYNNADIKFPHIRDEEGEEIEVTKGRYTTLMESRDRRVRKDAFEALYSTYSKMKNTLGA 236

Query: 259 ITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKK 318
                 K        R Y     +   ++NV   V + L+    N      +RY +L+KK
Sbjct: 237 SLTGNVKKNRFYSVVRNYPSALAASLDNDNVPVEVYDNLI-ETVNKNLHLLNRYLKLRKK 295

Query: 319 WLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAP 378
            LKLD ++ +D   P+       + +E A+ +V +       +     +K     WID  
Sbjct: 296 VLKLDALHMYDLYVPMVEEYDKKVTYEEAKKIVQEGLQPLGEEYIGYLKKGLNSGWIDIY 355

Query: 379 QYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNS 438
           + +GK SGA+A GT    HPY+LLNY     DV TL HE+GH +H   ++ TQ  + +  
Sbjct: 356 ENEGKTSGAYAWGTYK-THPYVLLNYQDNINDVYTLTHEMGHALHSYYTNMTQPYVYSEY 414

Query: 439 SLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHT 498
            + +AE AS   E+L    +L  + SK+E+  LL + +E+   ++ RQ  F +FE  +H 
Sbjct: 415 RIFVAEVASTVNESLLMRYMLSKSESKQEKAYLLNHYLEEFRGTVFRQTMFAEFEKLIHQ 474

Query: 499 ERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGN 558
           +      +    + +I+ +  K+  G   D+ D E    W  +PHF  S FYVY YA G 
Sbjct: 475 KTEQGEALNAQELCDIYYDLNKKYFGETVDV-DEEIAMEWSRIPHFYSS-FYVYKYATGF 532

Query: 559 CLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
               ++ +           +KYL  L+ G S +  ELL    ++LS P   E  L   EK
Sbjct: 533 SAATAIAEKIYKEGKPAV-DKYLEFLKGGGSNYPLELLKIAGVDLSSPKPIEDALNVFEK 591


>gi|182418463|ref|ZP_02949757.1| oligoendopeptidase F [Clostridium butyricum 5521]
 gi|237666491|ref|ZP_04526476.1| oligoendopeptidase F [Clostridium butyricum E4 str. BoNT E BL5262]
 gi|182377845|gb|EDT75389.1| oligoendopeptidase F [Clostridium butyricum 5521]
 gi|237657690|gb|EEP55245.1| oligoendopeptidase F [Clostridium butyricum E4 str. BoNT E BL5262]
          Length = 595

 Score =  436 bits (1122), Expect = e-120,   Method: Composition-based stats.
 Identities = 142/607 (23%), Positives = 266/607 (43%), Gaps = 20/607 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           M+ +  +E + +  +W ++ +Y +    E   D E ++ E++  K  + G L       N
Sbjct: 1   MSELKKREEIDDKYKWKIDKVYKNIADWE--KDFEDLKKEAVKLKE-FNGKLN------N 51

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
             ++   +   E+I      +  YA L  + + S+ T +   + I+  +A+F     +F 
Sbjct: 52  GETILEYLKLNEKISRKAETLYIYAHLKCDEDTSNSTFQSLMSKIDIYMAEFSSYTAYFV 111

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            EI +L++  +E+  A+      +     +I K K H+L+ +ME LL+  S         
Sbjct: 112 PEILSLEDGFIEKEIARIDDLKPFKFLFDDILKEKPHVLTKEMEELLAAASDCLDAPSAI 171

Query: 204 FFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
                   + F     +      +            DR VR++A + L   ++K  +  +
Sbjct: 172 HNILTNADMTFGKIKNEEGNEVELTEGNYSSFIRSKDRNVRRAAFEKLFGEYDKFKNTLA 231

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
                  K+     R RKYE   D+    NN+   V +  ++ + N   ++ HRY  +KK
Sbjct: 232 TSLTCSIKNFNFMSRVRKYESALDASLKPNNIPLEVYKNAVKVM-NDNIESLHRYVSIKK 290

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           K L L+ ++ +D   P+  T ++ + F    ++VL +      +   I +      WID 
Sbjct: 291 KLLGLEEIHMYDLYVPVIETPKEKVEFNDGVNIVLDALKPLGEEYLNIFKSGINDGWIDI 350

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK  GA++ G   ++ PY+LLNY  + +DV TLAHE+GH IH   S + Q      
Sbjct: 351 YENKGKRGGAYSWGGYDTM-PYVLLNYNNEMEDVSTLAHEMGHSIHSYYSRKEQPYYYAG 409

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
            +L  AE AS   E+L    L+   + ++++  L+  ++E +  ++ RQ+ F +FEL  H
Sbjct: 410 YTLFCAEVASTTNESLLIHYLINKETDEKKKLFLINQELEQIRTTVFRQLMFAEFELYTH 469

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
                   + +   ++ W +   +  G    + D E    W  +PHF  S FYVY YA G
Sbjct: 470 ETLEKGIPLTSEDYSKAWHDLNVKYFGEDMVV-DKEIDVEWSRIPHFY-SDFYVYQYATG 527

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
               ++          +   EKY   L+AG S +   +L    ++++     E  +    
Sbjct: 528 YAAASAFAKSILE-GKENAVEKYKGFLKAGGSDYPINILKTAGVDMTTSKPIEATINRFN 586

Query: 618 KMIDDVE 624
           +++D ++
Sbjct: 587 ELLDMID 593


>gi|158320201|ref|YP_001512708.1| oligoendopeptidase F [Alkaliphilus oremlandii OhILAs]
 gi|158140400|gb|ABW18712.1| oligoendopeptidase F [Alkaliphilus oremlandii OhILAs]
          Length = 608

 Score =  436 bits (1122), Expect = e-120,   Method: Composition-based stats.
 Identities = 135/604 (22%), Positives = 269/604 (44%), Gaps = 20/604 (3%)

Query: 29  SQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG 88
            +  +    +W++E +Y +        D + ++     F  +++G L      K+C +L 
Sbjct: 14  ERNEIDKAFKWDIEKMYQNEALW--KKDYDTVKELIAEFV-QYKGKL------KDCKNLL 64

Query: 89  AAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINT 148
            A++ YE + E   ++  YA +  + +  +   +    +  +        + FF  EI +
Sbjct: 65  KALSLYETLVEKTNKLYVYATMKRDEDNRNAKHQGLADNAQSLYTRMGSSVAFFVPEILS 124

Query: 149 LDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCEN 208
           + E  +++ Y ++    KY  ++  I + K H+LS   E +++   +V       F   N
Sbjct: 125 ISEEDIQEFYRKETGLKKYQHYLDEILRHKSHVLSAAEEEIVAQAGEVANGPRDIFTMLN 184

Query: 209 IESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNT 262
              ++F     +      +      +   + DR VR+ A  AL  T+    +  + + ++
Sbjct: 185 NADMKFPTIIDQSGVEVEVTHGNFIQLLENPDRRVREDAFSALYSTYESYKNTLATVFSS 244

Query: 263 LAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKL 322
             K +    + +K++    +   + N+   V   L+  + N+     HRY  L+K+ L L
Sbjct: 245 SLKKDNFLAKVKKHKNSMSAALFNTNIPEEVYHNLIGVIHNH-LHLMHRYVNLRKRMLGL 303

Query: 323 DTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDG 382
           D ++ +D   P+       IP+E A++L+++  +      + I +  F   W+D  +  G
Sbjct: 304 DELHMYDLYTPMVQNIDMQIPYEEAKELLVKGLSPLGEAYTNILKSGFRDRWVDVYENTG 363

Query: 383 KGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTL 442
           K SGA++ GT  S +P+IL++Y      + TLAHE+GH IH   + + Q  + ++    +
Sbjct: 364 KTSGAYSWGTYDS-YPFILMSYKDNVNSMFTLAHEMGHSIHSYYTCKNQPFIYSDYKTFV 422

Query: 443 AETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRS 502
           AE AS   E L  D +L+      ER  LL   +E    ++ RQ  F +FE   H +   
Sbjct: 423 AEVASTVNEALLMDYMLKNTKETNERMYLLNYYLEQFRTTVYRQTMFAEFEKITHEKISM 482

Query: 503 TGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVN 562
              +    +N+I+ +   +  G    + D      W  +PHF  S FYV+ YA G     
Sbjct: 483 GEALTAEDLNKIYRDLNIKYYGNDI-IVDSHIDIEWARIPHFYNS-FYVFQYATGYSAAI 540

Query: 563 SLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
           +L         +  ++ Y+  L++G+S +   +L    +++S P   E  L+  E ++ +
Sbjct: 541 ALSKKILMEGENAVQQ-YIEFLKSGSSDYSINVLKNAGVDMSSPAPIESALKVFEDLLTE 599

Query: 623 VEKM 626
           +E++
Sbjct: 600 MEEI 603


>gi|69247666|ref|ZP_00604442.1| Peptidase M3B, oligoendopeptidase F [Enterococcus faecium DO]
 gi|257880314|ref|ZP_05659967.1| peptidase M3B [Enterococcus faecium 1,230,933]
 gi|257882168|ref|ZP_05661821.1| peptidase M3B [Enterococcus faecium 1,231,502]
 gi|257885361|ref|ZP_05665014.1| peptidase M3B [Enterococcus faecium 1,231,501]
 gi|257890973|ref|ZP_05670626.1| peptidase M3B [Enterococcus faecium 1,231,410]
 gi|257894228|ref|ZP_05673881.1| peptidase M3B [Enterococcus faecium 1,231,408]
 gi|258614738|ref|ZP_05712508.1| oligoendopeptidase F,plasmid [Enterococcus faecium DO]
 gi|260562382|ref|ZP_05832896.1| peptidase M3B [Enterococcus faecium C68]
 gi|293559932|ref|ZP_06676442.1| oligoendopeptidase F [Enterococcus faecium E1162]
 gi|293568345|ref|ZP_06679668.1| oligoendopeptidase F [Enterococcus faecium E1071]
 gi|294621981|ref|ZP_06701126.1| oligoendopeptidase F [Enterococcus faecium U0317]
 gi|68194738|gb|EAN09218.1| Peptidase M3B, oligoendopeptidase F [Enterococcus faecium DO]
 gi|257814542|gb|EEV43300.1| peptidase M3B [Enterococcus faecium 1,230,933]
 gi|257817826|gb|EEV45154.1| peptidase M3B [Enterococcus faecium 1,231,502]
 gi|257821217|gb|EEV48347.1| peptidase M3B [Enterococcus faecium 1,231,501]
 gi|257827333|gb|EEV53959.1| peptidase M3B [Enterococcus faecium 1,231,410]
 gi|257830607|gb|EEV57214.1| peptidase M3B [Enterococcus faecium 1,231,408]
 gi|260073306|gb|EEW61647.1| peptidase M3B [Enterococcus faecium C68]
 gi|291588954|gb|EFF20779.1| oligoendopeptidase F [Enterococcus faecium E1071]
 gi|291598460|gb|EFF29532.1| oligoendopeptidase F [Enterococcus faecium U0317]
 gi|291606097|gb|EFF35521.1| oligoendopeptidase F [Enterococcus faecium E1162]
          Length = 602

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 138/610 (22%), Positives = 271/610 (44%), Gaps = 19/610 (3%)

Query: 23  DMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           ++  +  +E L     W+L  ++ S   QE       +  E      + +G L      +
Sbjct: 2   EVKQLPKREELPENLTWDLTKIFSS--DQEFDEKYLELSEELKQ-SEKHKGTLD-----Q 53

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
                  AI    R+      I  YA L  + +  +   +  Y   ++  +   + + +F
Sbjct: 54  GASQFLNAIEFVLRVYRQTEVIYVYAHLKNDQDTGNTDYQALYARASSLFSKVSEAVSWF 113

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
             EI  L +  + Q + ++P    Y  +I+ I   + H+LS + E LL+   ++   +  
Sbjct: 114 EPEILQLSDDQIWQYFKEEPKLEVYRHYIQQIVDNRAHVLSAEQESLLAGAGEIFDASSD 173

Query: 203 RFFCENIESLRFKIND------QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIF 256
            F   N   L F   +       ++      +    +DR VR++A K L   + +  + F
Sbjct: 174 TFAVLNNADLVFPTIEGENGEIVQLSHGVYGQLLESTDRRVREAAFKGLYSVYEQFRNTF 233

Query: 257 SFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELK 316
           +    T  K    + + R Y    ++   +N++   V + L+    N +    HRY EL+
Sbjct: 234 ASTLGTHIKGHNFKAKVRNYSSAREASLSNNHIPESVYDTLVDV-VNKHLPLLHRYMELR 292

Query: 317 KKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWID 376
           K+ L+++ ++ +D   P+ G +     +E A++  L++      +   I EK F+  WID
Sbjct: 293 KRLLEVEKLHMYDLYTPVLGEAPITFTYEEAKEKALEALKPMGEEYMAIVEKAFSERWID 352

Query: 377 APQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTN 436
             +  GK SGA++ G+    +PYILLN+      + TL HE+GH +H   +   Q  +  
Sbjct: 353 VVENKGKRSGAYSSGSYD-TNPYILLNWHDTLDQLFTLVHEMGHSVHSYFTRSNQPYVYG 411

Query: 437 NSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKL 496
           + S+ LAE AS   E +  + LL+       R  +L + ++    ++ RQ  F +FE  +
Sbjct: 412 DYSIFLAEIASTTNENILTEYLLETEKDPRVRAYVLNHYLDGFKGTVFRQTQFAEFEHFM 471

Query: 497 HTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAF 556
           HTE      + +  +++ + +   +  GPA +  D E    W  +PHF   ++YV+ Y+ 
Sbjct: 472 HTEDEKGVPLTSEYLSDSYGKLNAKYYGPAVE-EDPEIKFEWSRIPHFY-YNYYVFQYST 529

Query: 557 GNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTV 616
           G    ++L     +   +   E YL  L+AGNS +  E++    ++++   + E  +   
Sbjct: 530 GFSAASALAKKILNQEPEAL-ENYLAYLKAGNSDYPVEVMKKAGVDMTQAAYIEDAMSMF 588

Query: 617 EKMIDDVEKM 626
           E+ ++++E++
Sbjct: 589 EQRLNELEEL 598


>gi|304403832|ref|ZP_07385494.1| oligoendopeptidase F [Paenibacillus curdlanolyticus YK9]
 gi|304346810|gb|EFM12642.1| oligoendopeptidase F [Paenibacillus curdlanolyticus YK9]
          Length = 596

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 139/609 (22%), Positives = 256/609 (42%), Gaps = 21/609 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           MT++  +        W LEDL+    S     +    + +       +EG LA      +
Sbjct: 1   MTSVPKRSETAAEHHWKLEDLFGDQASW--DREYALAKEQIKQ-AAAYEGKLA------D 51

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
              L A     + +   + R+  YA + ++ + + PT +           +  + L +  
Sbjct: 52  PAQLKACFELEDELSLHVERLYVYANMRHHEDTAEPTYQALSDKTKKLSVETGEALSYVT 111

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            E+ +L +  L+     +     Y   ++ +R+ K H+LS   E LL+    V +     
Sbjct: 112 PEVLSLSDEQLDALI-NNSDLALYKKTLEEMRRQKAHVLSKAEEALLAQVGSVTQAPNTI 170

Query: 204 FFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           +   +   L+F     +      +   +  +     +R+VR +A KA+  T+ K  +  +
Sbjct: 171 YSMLSNADLKFPKVKNEQGEEIELTQGRYIQFLESKNRDVRANAFKAMYDTYGKLRNTMA 230

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
              N          R RKY    +     +N+   V   L+ ++  +     +RY EL+K
Sbjct: 231 ATLNANVTKNVFYSRARKYPSALEMSLFGDNIPKEVYTNLIDTIHKH-LPLMYRYMELRK 289

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           K L +D ++ +D  APL    +  I ++ A+  V +S          + ++ F   WID 
Sbjct: 290 KLLGVDELHMYDLFAPLVDEFKMDITYDQAKTTVKESLKPLGDAYLNVLQEGFDQGWIDV 349

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            + +GK SGA++ G     HPY+LLN+      + TL HE+GH +H   S  +Q      
Sbjct: 350 YENEGKRSGAYSWG-AYGTHPYVLLNHKDNLNSMFTLTHEMGHALHSYYSDSSQNYRDAQ 408

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
            ++ LAE AS   E L  D +L  ++  +E+  LL    +    ++ RQ  F +FE  +H
Sbjct: 409 YTIFLAEVASTLNEALLMDHMLNKSTDPKEKMYLLTYYADQFRTTVFRQTMFAEFEKIVH 468

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
               +   +    +++I+ +      G    + D +    W  +PHF  S FYVY YA G
Sbjct: 469 ERTEAGESLTPQDLSKIYYDLNVLYYGKGMVV-DKDIEVEWARIPHFYTS-FYVYKYATG 526

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                S              E+YL  L++G S +   +L    +++S P   E+ +   E
Sbjct: 527 FSAATSFAKQILDEGAPAV-ERYLGFLKSGGSDYSINILKRAGVDMSSPEPIEQAMAVFE 585

Query: 618 KMIDDVEKM 626
           ++I+ +E++
Sbjct: 586 QLIEQMEQL 594


>gi|257899592|ref|ZP_05679245.1| peptidase M3B [Enterococcus faecium Com15]
 gi|293571569|ref|ZP_06682591.1| oligoendopeptidase F [Enterococcus faecium E980]
 gi|257837504|gb|EEV62578.1| peptidase M3B [Enterococcus faecium Com15]
 gi|291608375|gb|EFF37675.1| oligoendopeptidase F [Enterococcus faecium E980]
          Length = 602

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 140/610 (22%), Positives = 274/610 (44%), Gaps = 19/610 (3%)

Query: 23  DMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           ++  +  +E L     W+L  ++ S   QE       +  +      +++G L      +
Sbjct: 2   EVKQLPKREELPENLTWDLTKIFSS--DQEFDEKYLELSEKLKK-SEKYKGTLD-----Q 53

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
                  AI     +      I  YA L  + +  +   +  Y   ++  +   + + +F
Sbjct: 54  GASQFLDAIEFVLSVYRQTEIIYVYAHLKNDQDTGNTEYQALYARASSLFSKVSEAVSWF 113

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
             EI  L +  + Q + ++P    Y  +I+ I   + H+LS D E LL+   ++   +  
Sbjct: 114 EPEILQLSDERIWQYFKEEPKLEVYRHYIQQIVDNRAHVLSADQESLLAGAGEIFEASSD 173

Query: 203 RFFCENIESLRFKIND------QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIF 256
            F   N   L F   +       ++      +    +DR VR++A K L   + +  + F
Sbjct: 174 TFAVLNNADLVFPTIEGENGEKVQLSHGVYGQLLESTDRSVREAAFKGLYSVYEQFRNTF 233

Query: 257 SFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELK 316
           +   +T  K    + + R Y    ++   +N++   V + L+ +V N +    HRY EL+
Sbjct: 234 ASTLSTHIKGHNFKAKVRNYSSAREASLSNNHIPESVYDTLV-AVVNKHLPLLHRYMELR 292

Query: 317 KKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWID 376
           K+ L+++ ++ +D   P+ G +     +E A++  L++      +   I EK F+  WID
Sbjct: 293 KRLLEVEKLHMYDLYTPVLGEAPITFTYEEAKEKALEALKPMGEEYMTIVEKAFSERWID 352

Query: 377 APQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTN 436
             +  GK SGA++ G+    +PYILLN+      + TL HE+GH +H   +   Q  +  
Sbjct: 353 VVENKGKRSGAYSSGSYD-TNPYILLNWHDTLDQLFTLVHEMGHSVHSYFTRSNQPYVYG 411

Query: 437 NSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKL 496
           + S+ LAE AS   E +  + LL+       R  +L + ++    ++ RQ  F +FE  +
Sbjct: 412 DYSIFLAEIASTTNENILTEYLLETEKDPRVRAYVLNHYLDGFKGTVFRQTQFAEFEHFM 471

Query: 497 HTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAF 556
           HTE      + +  +++ + +   +  GPA +  D E    W  +PHF   ++YV+ Y+ 
Sbjct: 472 HTEDEKGVPLTSEYLSDSYGKLNAKYYGPAVE-EDPEIKFEWSRIPHFY-YNYYVFQYST 529

Query: 557 GNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTV 616
           G    ++L     S   D   E YL  L+AGNS +  E++    ++++   + E  +   
Sbjct: 530 GFSAASALAKRILSQEPDAL-ENYLAYLKAGNSDYPVEVMKKAGVDMTQAAYIEDAMSMF 588

Query: 617 EKMIDDVEKM 626
           E+ ++++E++
Sbjct: 589 EQRLNELEEL 598


>gi|261209243|ref|ZP_05923635.1| peptidase M3B [Enterococcus faecium TC 6]
 gi|289565992|ref|ZP_06446430.1| oligoendopeptidase F [Enterococcus faecium D344SRF]
 gi|294616204|ref|ZP_06696001.1| oligoendopeptidase F [Enterococcus faecium E1636]
 gi|260076789|gb|EEW64524.1| peptidase M3B [Enterococcus faecium TC 6]
 gi|289162190|gb|EFD10052.1| oligoendopeptidase F [Enterococcus faecium D344SRF]
 gi|291590959|gb|EFF22671.1| oligoendopeptidase F [Enterococcus faecium E1636]
          Length = 602

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 138/610 (22%), Positives = 272/610 (44%), Gaps = 19/610 (3%)

Query: 23  DMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           ++  +  +E L     W+L  ++ S   QE       +  E      + +G L      +
Sbjct: 2   EVKQLPKREELPENLTWDLTKIFSS--DQEFDEKYLELSEELKQ-SEKHKGTLD-----Q 53

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
                  AI    R+      I  YA L  + +  +   +  Y   ++  +   + + +F
Sbjct: 54  GASQFLNAIEFVLRVYRQTEVIYVYAHLKNDQDTGNTDYQALYARASSLFSKVSEAVSWF 113

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
             EI  L +  + Q + ++P    Y  +I+ I   + H+LS + E LL+   ++   +  
Sbjct: 114 EPEILQLSDDQIWQYFKEEPKLEVYRHYIQQIVDNRAHVLSAEQESLLAGAGEIFDASSD 173

Query: 203 RFFCENIESLRFKIND------QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIF 256
            F   N   L F   +       ++      +    +DR VR++A K L   + +  + F
Sbjct: 174 TFAVLNNADLVFPTIEGENGEIVQLSHGVYGQLLESTDRRVREAAFKGLYSVYEQFRNTF 233

Query: 257 SFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELK 316
           +    T  K    + + R Y    ++   +N++   V + L+    N +    HRY EL+
Sbjct: 234 ASTLGTHIKGHNFKAKVRNYSSAREASLSNNHIPESVYDTLVDV-VNKHLPLLHRYMELR 292

Query: 317 KKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWID 376
           K+ L+++ ++ +D   P+ G +     +E A++  L++      +  +I EK F+  WID
Sbjct: 293 KRLLEVEKLHMYDLYTPVLGEAPITFTYEEAKEKALEALKPMGEEYMVIVEKAFSERWID 352

Query: 377 APQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTN 436
             +  GK SGA++ G+    +PYILLN+      + TL HE+GH +H   +   Q  +  
Sbjct: 353 VVENKGKRSGAYSSGSYD-TNPYILLNWHDTLDQLFTLVHEMGHSVHSYFTRSNQPYVYG 411

Query: 437 NSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKL 496
           + S+ LAE AS   E +  + LL+       R  +L + ++    ++ RQ  F +FE  +
Sbjct: 412 DYSIFLAEIASTTNENILTEYLLETEKDPRVRAYVLNHYLDGFKGTVFRQTQFAEFEHFM 471

Query: 497 HTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAF 556
           HTE      + +  +++ + +   +  GPA +  D E    W  +PHF   ++YV+ Y+ 
Sbjct: 472 HTEDEKGVPLTSEYLSDSYGKLNAKYYGPAVE-EDPEIKFEWSRIPHFY-YNYYVFQYST 529

Query: 557 GNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTV 616
           G    ++L     +   +   E YL  L+AGNS +  E++    ++++   + E  +   
Sbjct: 530 GFSAASALAKKILNQEPEAL-ENYLAYLKAGNSDYPVEVMKKAGVDMTQAAYIEDAMSMF 588

Query: 617 EKMIDDVEKM 626
           E+ ++++E++
Sbjct: 589 EQRLNELEEL 598


>gi|294618808|ref|ZP_06698334.1| oligoendopeptidase F [Enterococcus faecium E1679]
 gi|291594931|gb|EFF26282.1| oligoendopeptidase F [Enterococcus faecium E1679]
          Length = 602

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 138/610 (22%), Positives = 271/610 (44%), Gaps = 19/610 (3%)

Query: 23  DMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           ++  +  +E L     W+L  ++ S   QE       +  E      + +G L      +
Sbjct: 2   EVKQLPKREELPENLTWDLTKIFSS--DQEFDEKYLELSEELKQ-SEKHKGTLD-----Q 53

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
                  AI    R+      I  YA L  + +  +   +  Y   ++  +   + + +F
Sbjct: 54  GASQFLNAIEFVLRVYRQTEVIYVYAHLKNDQDTGNTDYQALYARASSLFSKVSEAVSWF 113

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
             EI  L +  + Q + ++P    Y  +I+ I   + H+LS + E LL+   ++   +  
Sbjct: 114 EPEILQLSDDQIWQYFKEEPKLEVYRHYIQQIVDNRAHVLSAEQESLLAGAGEIFDASSD 173

Query: 203 RFFCENIESLRFKIND------QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIF 256
            F   N   L F   +       ++      +    +DR VR++A K L   + +  + F
Sbjct: 174 TFAVLNNADLVFPTIEGENSEIVQLSHGVYGQLLESTDRRVREAAFKGLYSVYEQFRNTF 233

Query: 257 SFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELK 316
           +    T  K    + + R Y    ++   +N++   V + L+    N +    HRY EL+
Sbjct: 234 ASTLGTHIKGHNFKAKVRNYSSAREASLSNNHIPESVYDTLVDV-VNKHLPLLHRYMELR 292

Query: 317 KKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWID 376
           K+ L+++ ++ +D   P+ G +     +E A++  L++      +   I EK F+  WID
Sbjct: 293 KRLLEVEKLHMYDLYTPVLGEAPITFTYEEAKEKALEALKPMGEEYMAIVEKAFSERWID 352

Query: 377 APQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTN 436
             +  GK SGA++ G+    +PYILLN+      + TL HE+GH +H   +   Q  +  
Sbjct: 353 VVENKGKRSGAYSSGSYD-TNPYILLNWHDTLDQLFTLVHEMGHSVHSYFTRSNQPYVYG 411

Query: 437 NSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKL 496
           + S+ LAE AS   E +  + LL+       R  +L + ++    ++ RQ  F +FE  +
Sbjct: 412 DYSIFLAEIASTTNENILTEYLLETEKDPRVRAYVLNHYLDGFKGTVFRQTQFAEFEHFM 471

Query: 497 HTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAF 556
           HTE      + +  +++ + +   +  GPA +  D E    W  +PHF   ++YV+ Y+ 
Sbjct: 472 HTEDEKGVPLTSEYLSDSYGKLNAKYYGPAVE-EDPEIKFEWSRIPHFY-YNYYVFQYST 529

Query: 557 GNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTV 616
           G    ++L     +   +   E YL  L+AGNS +  E++    ++++   + E  +   
Sbjct: 530 GFSAASALAKKILNQEPEAL-ENYLAYLKAGNSDYPVEVMKKAGVDMTQAAYIEDAMSMF 588

Query: 617 EKMIDDVEKM 626
           E+ ++++E++
Sbjct: 589 EQRLNELEEL 598


>gi|322368341|ref|ZP_08042910.1| oligoendopeptidase F [Haladaptatus paucihalophilus DX253]
 gi|320552357|gb|EFW94002.1| oligoendopeptidase F [Haladaptatus paucihalophilus DX253]
          Length = 596

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 136/609 (22%), Positives = 258/609 (42%), Gaps = 20/609 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           M+++  +  +    +W+LE +Y + +  E     E +E      +  +EG +       +
Sbjct: 1   MSSVPERSAIDAQYKWDLESIYATDEEWE--EAYEDVEERLSELEA-YEGQVTD-----D 52

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
             +L   +   + +   +  +ASYA +  + + S    +   +   +  +       F  
Sbjct: 53  GETLLTVLQLSDELGREVSMVASYARMRSDEDTSDQEYQALASRAQSLASRAGSATSFIE 112

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            EI +LD   L+Q  A+      Y   + ++ ++K+H  S ++E LL++  +V       
Sbjct: 113 PEIQSLDREELDQMIAETDGLETYEHALDDVIRMKEHTRSAEIENLLAEFGEVTGAPNDI 172

Query: 204 FFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           +   +   + F   +        I  +       + DRE R++  +     ++   +   
Sbjct: 173 YSMLSNADMTFPTVEDPDGESVEITQSNFVNLLKNPDREFRQTVYENYFDEWSDVRNAVG 232

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
                  K +    R R Y+   ++     NV   V + L+ +         HR+ ELK+
Sbjct: 233 AAYKNSVKADVKYARARNYDTAREAALDGPNVPVDVYDNLLDT-VRDNLDKLHRHAELKR 291

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           + L +D +  WD   P+  T    + ++ A + V+ +             +     WID 
Sbjct: 292 RSLGVDELRMWDVYMPMTDTESPDLDYDQAVEYVVDAVGALGDDYQSRVAEGIESRWIDV 351

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +   K SGA++ GT     P+IL+NY      + TLAHELGH +H  L+SE+Q    ++
Sbjct: 352 YETQDKRSGAYSGGTYD-TQPFILMNYQDDISSMYTLAHELGHSLHSQLTSESQPYTYSS 410

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
             + +AE AS   E L    LL+     + R+ +L   +E   +++ RQ  F DFE + H
Sbjct: 411 YEIFVAEVASTVNEALLTHHLLETVEDPDFRRHVLNEYLERFRSTLYRQTLFADFEYRAH 470

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
                   +   R++ I+ + ++E   PA    D      WM +PHF  + +YVY Y+ G
Sbjct: 471 QLAEDNEALTPDRLDGIYGDLKREFYDPAVV--DDRIEREWMRIPHFYRA-YYVYQYSTG 527

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                +L D           E+YL+ L  G+ ++   LL    +++S P   +R L    
Sbjct: 528 ISAAVALADKILEEGEPAA-ERYLDFLSNGSREYPLTLLQGAGVDMSSPEPIQRALDVYG 586

Query: 618 KMIDDVEKM 626
           K +D++E++
Sbjct: 587 KRLDEMEEL 595


>gi|302385992|ref|YP_003821814.1| oligoendopeptidase F [Clostridium saccharolyticum WM1]
 gi|302196620|gb|ADL04191.1| oligoendopeptidase F [Clostridium saccharolyticum WM1]
          Length = 594

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 140/606 (23%), Positives = 251/606 (41%), Gaps = 19/606 (3%)

Query: 27  MDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS 86
           M  ++ +     WNL D+ PS  + E   D+      SL+   R+EG+LA      +   
Sbjct: 1   MKKRDEIPVCDTWNLADILPSESAWE---DLFRETESSLSGYKRYEGHLAD-----SGEM 52

Query: 87  LGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEI 146
           L + +   E +   I  +  Y     + +  +   ++  +   +       +  F   EI
Sbjct: 53  LFSCLRFDEEMSLNIETLFVYGRQKSDEDTGNARYQELSSRARSLSYKAAGLSSFLVPEI 112

Query: 147 NTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFC 206
             + +  L +         +Y    + I K K H LS  ME LL+ + +      + F  
Sbjct: 113 LAIPQENLTEFRENTAELKRYDRTFEIILKKKDHTLSAPMEALLAKSMEATSGPSEIFHM 172

Query: 207 ENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFIT 260
            N   ++F           +I            DR VRKSA +AL   + +  +  +   
Sbjct: 173 FNNADVKFPEIKDEKNQPVRITHGNYIAFMEKQDRSVRKSAFEALYSVYGQFINTLASTF 232

Query: 261 NTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWL 320
           ++  K      + R Y          N +   V + L+++V        H+Y  ++KK L
Sbjct: 233 SSNVKQAAFYAKARNYPSARAHSLGENEIPEEVYDNLIKAVHEG-LPNLHQYISIRKKAL 291

Query: 321 KLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQY 380
            ++ ++ +D   P+    +  I FE A+ +VL+       +   +  + F + WID  + 
Sbjct: 292 GVEELHMYDLYVPMVSREERKITFEEAKAMVLEGLKPLGAEYLSLLREGFDNRWIDVYEN 351

Query: 381 DGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSL 440
           +GK SGA++ G    +HPY+LLN+ G    V TLAHE+GH +H   S + Q  +     +
Sbjct: 352 EGKRSGAYSWGV-YGIHPYVLLNFNGTLDSVFTLAHEMGHALHSWFSDKNQTYIDAGYKI 410

Query: 441 TLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTER 500
            +AE AS   E L    LL+  + K+ER  L+ + ++    ++ RQ  F +FE + H   
Sbjct: 411 FVAEVASTCNEALLIRHLLEVTADKKERAYLVNHFMDSFRGTLYRQAMFAEFEAETHRRA 470

Query: 501 RSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCL 560
                +    +  I+    +E  GP   + D E G  W  +PHF  + FYVY YA G   
Sbjct: 471 GEGEVLTGEVLCRIYQRLNEEYFGPDMVV-DPEIGYEWSRIPHFY-TPFYVYQYATGFSA 528

Query: 561 VNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMI 620
             ++         +   + Y   L  GNS    +LL    +++      +  L     ++
Sbjct: 529 AIAISSRILK-GDESAVKGYYEFLSGGNSMTPIDLLKLCGVDMGTAEPVKDALFVFAGLL 587

Query: 621 DDVEKM 626
           +++ ++
Sbjct: 588 EEMSRL 593


>gi|295111136|emb|CBL27886.1| oligopeptidase F. Metallo peptidase. MEROPS family M03B
           [Synergistetes bacterium SGP1]
          Length = 659

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 148/622 (23%), Positives = 270/622 (43%), Gaps = 19/622 (3%)

Query: 10  FSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKT 69
           F+  F            +  + ++    RW+LE +YPS ++ E       +  +  A   
Sbjct: 47  FAMRFEAPEAMGDGTGGVPERRDVPEAMRWDLEAIYPSFEAWE--RAFSDLTPKIDAL-A 103

Query: 70  RWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDIN 129
            + G L      +    L   +   E +   + ++  YA +  + +L      +  + I 
Sbjct: 104 GFAGRLG-----EGPKKLLEYLKAEEAVSLELEKLYVYANMKSHEDLRETRPMELASRIE 158

Query: 130 AKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECL 189
           A  A    V  FFA E+  L E  L +    +P    Y+ +++ + + ++H+L    E L
Sbjct: 159 ALSARHGVVTAFFAPEVLELPEDELRRWVRGEPGLKLYAFFVERLLREREHILPRAEEAL 218

Query: 190 LSDTSQVGREALKRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAK 243
           L+   +        F       L+F     +      +   + YK      R+VR++A +
Sbjct: 219 LASAREATAAPENAFSLLTNADLKFPTIRDEEGRSVELTEERWYKLSRSPSRDVRRAAFE 278

Query: 244 ALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKN 303
            +  T+    +  + +     K +    R R+Y+   ++    +NV   V E ++ +   
Sbjct: 279 GIYGTYGSFKNALAALYAGSVKGDLFYARARRYKDSLEAALFGDNVPRSVYENVVDT-AA 337

Query: 304 YYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMS 363
                 HR   L+K+ LKLD ++++D   P+    ++ IP+E A  +V ++ A       
Sbjct: 338 RCAPLMHRLVALRKRALKLDRLHYYDLNVPIAEEPREDIPYERACRMVAEALAPLGEDYV 397

Query: 364 IIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIH 423
              ++     WID  +  GK  GA++ G+  + HPY+LLNY G   DV TLAHE+GH +H
Sbjct: 398 ANFKRGLAERWIDVYENRGKRKGAYSWGS-YATHPYVLLNYNGTLNDVFTLAHEMGHSMH 456

Query: 424 FVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSI 483
              S   Q  +  + ++ LAE AS   E L    LL+ A ++EERK LL+     +  + 
Sbjct: 457 SWYSHRNQPQVYGDYTILLAEVASTTNEALLLGHLLKTAKTEEERKWLLSYYYNMVRTTF 516

Query: 484 VRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPH 543
            RQ  F DFEL++H      G +    ++ +W E  +   GP     +L +   W  +PH
Sbjct: 517 FRQAMFADFELQVHARAEEGGALTPEWMSGLWRELNERCYGPDMAPDELLW-VEWARIPH 575

Query: 544 FIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINL 603
           F  + FYVY Y  G    N+              ++YL  L++G S     +L    ++L
Sbjct: 576 FYSA-FYVYKYVTGFTAANAFASAIL-AGEPGAVDRYLTFLKSGGSDESLNILRRAGVDL 633

Query: 604 SDPNFWERGLQTVEKMIDDVEK 625
           +    ++R ++  ++ +++ E+
Sbjct: 634 TSREPFDRTMKLFQERLEEGER 655


>gi|293553061|ref|ZP_06673703.1| oligoendopeptidase F [Enterococcus faecium E1039]
 gi|291602770|gb|EFF32980.1| oligoendopeptidase F [Enterococcus faecium E1039]
          Length = 602

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 138/610 (22%), Positives = 271/610 (44%), Gaps = 19/610 (3%)

Query: 23  DMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           ++  +  +E L     W+L  ++ S   QE       +  E      + +G L      +
Sbjct: 2   EVKQLPKREELPGNLTWDLTKIFSS--DQEFDEKYLELSEELKQ-SEKHKGTLD-----Q 53

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
                  AI    R+      I  YA L  + +  +   +  Y   ++  +   + + +F
Sbjct: 54  GASQFLNAIEFVLRVYRQTEVIYVYAHLKNDQDTGNTDYQALYARASSLFSKVSEAVSWF 113

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
             EI  L +  + Q + ++P    Y  +I+ I   + H+LS + E LL+   ++   +  
Sbjct: 114 EPEILQLSDDQIWQYFKEEPKLEVYRHYIQQIVDNRAHVLSAEQESLLAGAGEIFDASSD 173

Query: 203 RFFCENIESLRFKIND------QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIF 256
            F   N   L F   +       ++      +    +DR VR++A K L   + +  + F
Sbjct: 174 TFAVLNNADLVFPTIEGENGEIVQLSHGVYGQLLESTDRRVREAAFKGLYSVYEQFRNTF 233

Query: 257 SFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELK 316
           +    T  K    + + R Y    ++   +N++   V + L+    N +    HRY EL+
Sbjct: 234 ASTLGTHIKGHNFKAKVRNYSSAREASLSNNHIPESVYDTLVDV-VNKHLPLLHRYMELR 292

Query: 317 KKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWID 376
           K+ L+++ ++ +D   P+ G +     +E A++  L++      +   I EK F+  WID
Sbjct: 293 KRLLEVEKLHMYDLYTPVLGEAPITFTYEEAKEKALEALKPMGEEYMAIVEKAFSERWID 352

Query: 377 APQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTN 436
             +  GK SGA++ G+    +PYILLN+      + TL HE+GH +H   +   Q  +  
Sbjct: 353 VVENKGKRSGAYSSGSYD-TNPYILLNWHDTLDQLFTLVHEMGHSVHSYFTRSNQPYVYG 411

Query: 437 NSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKL 496
           + S+ LAE AS   E +  + LL+       R  +L + ++    ++ RQ  F +FE  +
Sbjct: 412 DYSIFLAEIASTTNENILTEYLLETEKDPRVRAYVLNHYLDGFKGTVFRQTQFAEFEHFM 471

Query: 497 HTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAF 556
           HTE      + +  +++ + +   +  GPA +  D E    W  +PHF   ++YV+ Y+ 
Sbjct: 472 HTEDEKGVPLTSEYLSDSYGKLNTKYYGPAVE-EDPEIKFEWSRIPHFY-YNYYVFQYST 529

Query: 557 GNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTV 616
           G    ++L     +   +   E YL  L+AGNS +  E++    ++++   + E  +   
Sbjct: 530 GFSAASALAKKILNQEPEAL-ENYLAYLKAGNSDYPVEVMKKAGVDMTQAAYIEDAMSIF 588

Query: 617 EKMIDDVEKM 626
           E+ ++++E++
Sbjct: 589 EQRLNELEEL 598


>gi|15790868|ref|NP_280692.1| oligopeptidase [Halobacterium sp. NRC-1]
 gi|10581433|gb|AAG20172.1| oligopeptidase [Halobacterium sp. NRC-1]
          Length = 632

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 136/609 (22%), Positives = 252/609 (41%), Gaps = 19/609 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           M+++  + ++ +  +W L  +Y + D  E     E ++ E  A    +EG L      ++
Sbjct: 36  MSSVPDRADVADEYKWALASIYETDDEWE--AAFEDVQAELDALN-DYEGRLT-----ED 87

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
             +L AA+   + +      +++YA +  + +      +       + + D      FF 
Sbjct: 88  GETLLAALELRDAVYRDAKTVSAYASMRSDEDTRDQEYQALQARGASLMTDVSSATSFFD 147

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            E+       L+    + P    Y  +  ++ ++K H  S ++E LLS+  +V       
Sbjct: 148 PELQACTREQLQSMIEETPELAAYEHYFDDVLRMKPHTRSAEVEGLLSELGEVFGAPSDA 207

Query: 204 FFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           +       L F   +        I  +         DR  R++  +    T +   +   
Sbjct: 208 YNMLTDADLEFPTVEDPAGDAVEISQSNFTNLLKTPDRAFRQTVHEQFYDTISGVRNTIG 267

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
               T  K +      R Y+    +   S N+   V + L+ +  +    T  R+ +LK+
Sbjct: 268 STMKTQMKRDVKLAEARNYDTARQAALDSGNIPVEVYDTLVDT-VDDNLDTLQRHADLKR 326

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           + L +D +  WD   P+  +    I +  AR+ V+++ A                NW+D 
Sbjct: 327 RALGVDDLEMWDLYMPIVDSEGPDIEYADAREHVIEAVAPLGEDYQQRVADGLDSNWVDV 386

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK SGA++ GT     P+IL+NY      + TLAHELGH +H   +SE Q  + +N
Sbjct: 387 YENRGKRSGAYSGGTYD-TQPFILMNYQDDISSMFTLAHELGHSLHSQYTSEHQPYVYSN 445

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
             + +AE AS   E L  + LL        R+ +L   +E   +++ RQ  F D E +LH
Sbjct: 446 YEIFVAEVASTVNEALLVNHLLDTVEDDHFRRHILNEYLERFRSTLYRQTLFADVEQRLH 505

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
              R+   +   RI+E++ + ++     A    D      WM +PHF   +FYV+ YA G
Sbjct: 506 ELTRAGEALTPDRIDEVYGDRKRAYYANATI--DDHIEREWMRIPHFY-YNFYVFQYATG 562

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                +L +    +       +Y   L  G+S +  ELL    +++S     ER +   +
Sbjct: 563 ISAAVALVEDILDDDQPDAAARYREFLTRGSSAYPIELLQDAGVDMSTSAPIERAIGVYD 622

Query: 618 KMIDDVEKM 626
             +D+ + +
Sbjct: 623 HYLDEADDL 631


>gi|225378022|ref|ZP_03755243.1| hypothetical protein ROSEINA2194_03682 [Roseburia inulinivorans DSM
           16841]
 gi|225210023|gb|EEG92377.1| hypothetical protein ROSEINA2194_03682 [Roseburia inulinivorans DSM
           16841]
          Length = 600

 Score =  435 bits (1118), Expect = e-119,   Method: Composition-based stats.
 Identities = 155/609 (25%), Positives = 268/609 (44%), Gaps = 19/609 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
            + +  +  +     WN++D+YP+ ++ E       +  E +     +EG++A       
Sbjct: 2   ASELLKRSEVKEADTWNVKDMYPTTEAWENE---LKVITEIVDKIASYEGSVAA-----T 53

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
             +L A +       E I +  +YA   ++ + ++ T +     + +  A       F  
Sbjct: 54  AENLLAVLEHLASAGEKIEKAFNYAERLFDEDQTNTTHQAMSAKVYSLYAAMGSKTAFVD 113

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            EI    +  LE  Y + P    Y   I  IR++K+H LS +ME LL+ T+++ +     
Sbjct: 114 PEIIAATDETLEAFYKELPALELYRKQIAEIRRMKEHCLSAEMEKLLAMTAEMSQTPADT 173

Query: 204 FFCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           F   N   L F   +       +I   +  +    +DR VRK A + L  T+ +  +  +
Sbjct: 174 FSILNNADLVFPEIEDENGEKVRITHGRYGQFLQSADRRVRKDAFENLYQTYKQFLNTSA 233

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
            +     K +    + RKY    +    +NNV   V   L+ +  N      H+Y  L+K
Sbjct: 234 SLYCGNVKQQVFHAKARKYASSLECAVDANNVSSSVYHNLIDT-VNKNLDKMHQYVSLRK 292

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           K L ++ ++ +D   P+       I FE A++ VL++ A          ++ F + WID 
Sbjct: 293 KCLGVEELHMYDIYTPMIADVAKKISFEEAKETVLKALAPLGEDYVNKVKEGFENRWIDV 352

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK SGA++ G     HPY+LLNY G   D+ TLAHE+GH +H   S+E Q  +   
Sbjct: 353 YENQGKRSGAYSAG-AYGCHPYVLLNYNGTLDDMFTLAHEMGHAMHSNYSNEAQPYIYAG 411

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
             + +AE AS   E L  + LL+  + K+ER  LL + ++    ++ RQ  F ++E+  +
Sbjct: 412 YKIFVAEVASTCNEILLMEYLLKNTTDKKERAYLLNHYLDSFKGTVYRQTQFAEYEMLTN 471

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
                   +    ++ ++LE  K+  G    +SD +    W  +PHF   +FYVY YA  
Sbjct: 472 KMYEDGESLTADNLSSVYLELNKKYYGSDI-ISDDQIAYEWARIPHFY-YNFYVYQYATS 529

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
            C   S+             E+Y   L  G S    ELL    +NL  P   +  L    
Sbjct: 530 YCAAFSVAHKILEEGTPAV-ERYKKFLSGGCSMAPVELLKIAGVNLETPAPIQDALNAFG 588

Query: 618 KMIDDVEKM 626
           ++I ++E +
Sbjct: 589 EIIKEMETL 597


>gi|257888162|ref|ZP_05667815.1| peptidase M3B [Enterococcus faecium 1,141,733]
 gi|257824216|gb|EEV51148.1| peptidase M3B [Enterococcus faecium 1,141,733]
          Length = 602

 Score =  435 bits (1118), Expect = e-119,   Method: Composition-based stats.
 Identities = 138/610 (22%), Positives = 273/610 (44%), Gaps = 19/610 (3%)

Query: 23  DMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           ++  +  +E L     W+L  ++ S   +E       +  +      +++G L      +
Sbjct: 2   EVKQLPKREELPENLTWDLTKIFSS--DKEFDEKYLELSEKLKK-SEKYKGTL-----NQ 53

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
                  AI     +      I  YA L  + +  +   +  Y   ++  +   + + +F
Sbjct: 54  GASQFLDAIEFVLSVYRQTEIIYVYAHLKNDQDTGNTEYQALYARASSLFSKVSEAVSWF 113

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
             EI  L +  + Q + ++P    Y  +I+ I   + H+LS D E LL+   ++   +  
Sbjct: 114 EPEILQLSDERIWQYFKEEPKLEVYRHYIQQIVDNRAHVLSADQESLLAGAGEIFEASSD 173

Query: 203 RFFCENIESLRFKIND------QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIF 256
            F   N   L F   +       ++      +    +DR VR++A K L   + +  + F
Sbjct: 174 TFAVLNNADLVFPTIEGENGEKVQLSHGVYGQLLESTDRSVREAAFKGLYSVYEQFRNTF 233

Query: 257 SFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELK 316
           +   +T  K    + + R Y    ++   +N++   V + L+    N +    HRY EL+
Sbjct: 234 ASTLSTHIKGHNFKAKVRNYSSAREASLSNNHIPESVYDTLVDV-VNKHLPLLHRYMELR 292

Query: 317 KKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWID 376
           K+ L+++ ++ +D   P+ G +     +E A++  L++      +   I EK F+  WID
Sbjct: 293 KRLLEVEKLHMYDLYTPVLGEAPITFTYEEAKEKALEALKPMGEEYMTIVEKAFSERWID 352

Query: 377 APQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTN 436
             +  GK SGA++ G+    +PYILLN+      + TL HE+GH +H   +  +Q  +  
Sbjct: 353 VVENKGKRSGAYSSGSYD-TNPYILLNWHDTLDQLFTLVHEMGHSVHSYFTRSSQPYVYG 411

Query: 437 NSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKL 496
           + S+ LAE AS   E +  + LL+       R  +L + ++    ++ RQ  F +FE  +
Sbjct: 412 DYSIFLAEIASTTNENILTEYLLETEKDPRVRAYVLNHYLDGFKGTVFRQTQFAEFEHFM 471

Query: 497 HTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAF 556
           HTE      + +  +++ + +   +  GPA +  D E    W  +PHF   ++YV+ Y+ 
Sbjct: 472 HTEDEKGVPLTSEYLSDSYGKLNAKYYGPAVE-EDPEIKFEWSRIPHFY-YNYYVFQYST 529

Query: 557 GNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTV 616
           G    ++L     S   D   E YL  L+AGNS +  E++    ++++   + E  +   
Sbjct: 530 GFSAASALAKRILSQEPDAL-ENYLAYLKAGNSDYPVEVMKKAGVDMTQAAYIEDAMSMF 588

Query: 617 EKMIDDVEKM 626
           E+ ++++E++
Sbjct: 589 EQRLNELEEL 598


>gi|227552609|ref|ZP_03982658.1| oligoendopeptidase F [Enterococcus faecium TX1330]
 gi|257896947|ref|ZP_05676600.1| peptidase M3B [Enterococcus faecium Com12]
 gi|227178235|gb|EEI59207.1| oligoendopeptidase F [Enterococcus faecium TX1330]
 gi|257833512|gb|EEV59933.1| peptidase M3B [Enterococcus faecium Com12]
          Length = 602

 Score =  434 bits (1117), Expect = e-119,   Method: Composition-based stats.
 Identities = 138/610 (22%), Positives = 273/610 (44%), Gaps = 19/610 (3%)

Query: 23  DMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           ++  +  +E L     W+L  ++ S   +E       +  +      +++G L      +
Sbjct: 2   EVKQLPKREELPENLTWDLTKIFSS--DKEFDEKYLELSEKLKK-SEKYKGTL-----NQ 53

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
                  AI     +      I  YA L  + +  +   +  Y   ++  +   + + +F
Sbjct: 54  GVSQFLDAIEFVLSVYRQTEIIYVYAHLKNDQDTGNTEYQALYARASSLFSKVSEAVSWF 113

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
             EI  L +  + Q + ++P    Y  +I+ I   + H+LS D E LL+   ++   +  
Sbjct: 114 EPEILQLSDERIWQYFKEEPKLEVYRHYIQQIVDNRAHVLSADQESLLAGAGEIFEASSD 173

Query: 203 RFFCENIESLRFKIND------QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIF 256
            F   N   L F   +       ++      +    +DR VR++A K L   + +  + F
Sbjct: 174 TFAVLNNADLVFPTIEGENGEKVQLSHGVYGQLLESTDRSVREAAFKGLYSVYEQFRNTF 233

Query: 257 SFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELK 316
           +   +T  K    + + R Y    ++   +N++   V + L+    N +    HRY EL+
Sbjct: 234 ASTLSTHIKGHNFKAKVRNYSSAREASLSNNHIPESVYDTLVDV-VNKHLPLLHRYMELR 292

Query: 317 KKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWID 376
           K+ L+++ ++ +D   P+ G +     +E A++  L++      +   I EK F+  WID
Sbjct: 293 KRLLEVEKLHMYDLYTPVLGEAPITFTYEEAKEKALEALKPMGEEYMTIVEKAFSERWID 352

Query: 377 APQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTN 436
             +  GK SGA++ G+    +PYILLN+      + TL HE+GH +H   +  +Q  +  
Sbjct: 353 VVENKGKRSGAYSSGSYD-TNPYILLNWHDTLDQLFTLVHEMGHSVHSYFTRSSQPYVYG 411

Query: 437 NSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKL 496
           + S+ LAE AS   E +  + LL+       R  +L + ++    ++ RQ  F +FE  +
Sbjct: 412 DYSIFLAEIASTTNENILTEYLLETEKDPRVRAYVLNHYLDGFKGTVFRQTQFAEFEHFM 471

Query: 497 HTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAF 556
           HTE      + +  +++ + +   +  GPA +  D E    W  +PHF   ++YV+ Y+ 
Sbjct: 472 HTEDEKGVPLTSEYLSDSYGKLNAKYYGPAVE-EDPEIKFEWSRIPHFY-YNYYVFQYST 529

Query: 557 GNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTV 616
           G    ++L     S   D   E YL  L+AGNS +  E++    ++++   + E  +   
Sbjct: 530 GFSAASALAKRILSQEPDAL-ENYLAYLKAGNSDYPVEVMKKAGVDMTQAAYIEDAMSMF 588

Query: 617 EKMIDDVEKM 626
           E+ ++++E++
Sbjct: 589 EQRLNELEEL 598


>gi|293379110|ref|ZP_06625261.1| oligoendopeptidase F [Enterococcus faecium PC4.1]
 gi|292642251|gb|EFF60410.1| oligoendopeptidase F [Enterococcus faecium PC4.1]
          Length = 602

 Score =  434 bits (1116), Expect = e-119,   Method: Composition-based stats.
 Identities = 138/610 (22%), Positives = 273/610 (44%), Gaps = 19/610 (3%)

Query: 23  DMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQK 82
           ++  +  +E L     W+L  ++ S   +E       +  +      +++G L      +
Sbjct: 2   EVKQLPKREELPENLTWDLTKIFSS--DKEFDEKYLELSEKLKK-SEKYKGTL-----NQ 53

Query: 83  NCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFF 142
                  AI     +      I  YA L  + +  +   +  Y   ++  +   + + +F
Sbjct: 54  GASQFLDAIEFVLSVYRQTEIIYVYAHLKNDQDTGNTEYQALYARASSLFSKVSEAVSWF 113

Query: 143 ALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALK 202
             EI  L +  + Q + ++P    Y  +I+ I   + H+LS D E LL+   ++   +  
Sbjct: 114 EPEILQLSDERIWQYFKEEPKLEVYRHYIQQIVDNRAHVLSADQESLLAGAGEIFEASSD 173

Query: 203 RFFCENIESLRFKIND------QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIF 256
            F   N   L F   +       ++      +    +DR VR++A K L   + +  + F
Sbjct: 174 TFAVLNNADLVFPTIEGENGEKVQLSHGVYGQLLESTDRSVREAAFKGLYSVYEQFRNTF 233

Query: 257 SFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELK 316
           +   +T  K    + + R Y    ++   +N++   V + L+    N +    HRY EL+
Sbjct: 234 ASTLSTHIKGHNFKAKVRNYSSAREASLSNNHIPESVYDTLVDV-VNKHLPLLHRYMELR 292

Query: 317 KKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWID 376
           K+ L+++ ++ +D   P+ G +     +E A++  L++      +   I EK F+  WID
Sbjct: 293 KRLLEVEKLHMYDLYTPVLGEAPITFTYEEAKEKALEALKPMGEEYMTIVEKAFSERWID 352

Query: 377 APQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTN 436
             +  GK SGA++ G+    +PYILLN+      + TL HE+GH +H   +  +Q  +  
Sbjct: 353 VVENKGKRSGAYSSGSYD-TNPYILLNWHDTLDQLFTLVHEMGHSVHSYFTRSSQPYVYG 411

Query: 437 NSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKL 496
           + S+ LAE AS   E +  + LL+       R  +L + ++    ++ RQ  F +FE  +
Sbjct: 412 DYSIFLAEIASTTNENILTEYLLETEKDPRVRAYVLNHYLDGFKGTVFRQTQFAEFEHFM 471

Query: 497 HTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAF 556
           HTE      + +  +++ + +   +  GPA +  D E    W  +PHF   ++YV+ Y+ 
Sbjct: 472 HTEDEEGVPLTSEYLSDSYGKLNAKYYGPAVE-EDPEIKFEWSRIPHFY-YNYYVFQYST 529

Query: 557 GNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTV 616
           G    ++L     S   D   E YL  L+AGNS +  E++    ++++   + E  +   
Sbjct: 530 GFSAASALAKRILSQEPDAL-ENYLAYLKAGNSDYPVEVMKKAGVDMTQAAYIEDAMSMF 588

Query: 617 EKMIDDVEKM 626
           E+ ++++E++
Sbjct: 589 EQRLNELEEL 598


>gi|326790905|ref|YP_004308726.1| oligoendopeptidase F [Clostridium lentocellum DSM 5427]
 gi|326541669|gb|ADZ83528.1| oligoendopeptidase F [Clostridium lentocellum DSM 5427]
          Length = 600

 Score =  434 bits (1116), Expect = e-119,   Method: Composition-based stats.
 Identities = 145/607 (23%), Positives = 264/607 (43%), Gaps = 18/607 (2%)

Query: 25  TTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC 84
           T+   ++++     W LEDL+ +       N +   +     F   +EG L       N 
Sbjct: 3   TSQPKRQDVKIEDTWKLEDLFET--DLLFENTLSETKKLLDKFNP-YEGKLTS-----NP 54

Query: 85  HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL 144
           H+L   +   +   E +G++  YA +  + + S+   +   +          + L F   
Sbjct: 55  HTLLTFLKLQDTFGEALGKLYVYAHMRLHQDGSNAYYQDLASQSEDLSVAASEALAFSGP 114

Query: 145 EINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRF 204
           E+  L  A L+  + + P    Y  ++  I + K H+L+++ME +L+   ++G      F
Sbjct: 115 ELTQLTAAQLDTFFKELPELRHYERYLNEILRQKTHILTSEMEAVLARVGELGTMPQNTF 174

Query: 205 FCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSF 258
              N   ++F   +       ++            +R VR+SA  AL +T+    +  S 
Sbjct: 175 SMLNNVDMKFPTVENAKGETVRLTHGNYIPLMESQNRSVRESAFTALYNTYTSYKNTIST 234

Query: 259 ITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKK 318
           +     K        R +E    S    NN+   V   L+ +  N      H Y  L+K+
Sbjct: 235 LFAANIKQYGFFSSMRHFETPLHSALSENNIPVTVYHELIHT-VNNNLSIMHDYVTLRKE 293

Query: 319 WLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAP 378
            L LDT++ +D   P+    +  I +E + D++L++ A        I ++   + WID  
Sbjct: 294 ELGLDTLHMYDLFVPMIKDFEKEISYEESCDILLKALAPLGEDYLAIVKEALDNRWIDKY 353

Query: 379 QYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNS 438
           + +GK SGA++ G+  + HPYILLNY      + TLAHE+GH +H   S   Q  +  + 
Sbjct: 354 ENEGKRSGAYSWGSYGAPHPYILLNYSPNINSLFTLAHEMGHALHSYYSHHHQPHIYGDY 413

Query: 439 SLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHT 498
            + +AE AS   E L  + LL+    +  ++ L+   +E   +++ RQ  F +FEL +HT
Sbjct: 414 CIFVAEVASTVNEALLMNYLLETTQEETYKRYLINYFMEQFRSTLYRQTMFAEFELMMHT 473

Query: 499 ERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGN 558
             +    +    + + + E  K+  GP+ ++ D      W  +PHF  + FYVY YA G 
Sbjct: 474 ASQEGKTLTADYLCDTYYELVKKYHGPSIEV-DAAIAMEWARIPHFY-TPFYVYQYATGY 531

Query: 559 CLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
               +L +       +  K+ Y   L  G+SK   +LL    +++S      + L+    
Sbjct: 532 SAAITLSERILKEGTEAVKD-YKAFLSGGSSKDPIDLLKIAGVDMSTSAPIAKALEVFNS 590

Query: 619 MIDDVEK 625
           +I   ++
Sbjct: 591 LIIQFKQ 597


>gi|330686165|gb|EGG97783.1| oligoendopeptidase F [Staphylococcus epidermidis VCU121]
          Length = 603

 Score =  434 bits (1116), Expect = e-119,   Method: Composition-based stats.
 Identities = 132/612 (21%), Positives = 262/612 (42%), Gaps = 22/612 (3%)

Query: 24  MTTMDSQENLG---NLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
           M+   S+E          W+L  ++PS D+       + +E++    + +++G+L     
Sbjct: 2   MSQQLSREEQERKYPEYTWDLTTIFPSDDA--FEAAFKDVENDIGK-EEQFKGHLGD--- 55

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
             +  +L  A+A  + I   + ++  YA L  + + ++          +  +  F     
Sbjct: 56  --SADTLYQALALEDEIGTKLEKVYVYAHLKQDQDTANDQYTGMEARAHQLIIKFSSAWS 113

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           F   EI  LDE  ++     +    +Y   ++ I + + H+L  D E LL++        
Sbjct: 114 FLVPEILQLDEETIQTFIQSNDKLKQYEFDLQLINEKRPHILDADTEKLLTEAQDALSTP 173

Query: 201 LKRFFCENIESLRFKI------NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              +   +   L F+           +      K     DR +R+SA + +   +   ++
Sbjct: 174 SNVYGMFSNADLEFEDAIDKDGKAHPLTQGTFIKYLESDDRVLRESAFRNVYKAYGSHNN 233

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
                     K      R   Y+   +    +N++   V + L+++V  Y     HRY  
Sbjct: 234 TLGATLAGEVKKNVFNARTHHYKSAREKALSNNHIPEEVYDNLVKTVHKY-LPLLHRYTR 292

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+++ L +D +  +D   PL    +  +P+E A+  +L++      +   + ++   + W
Sbjct: 293 LRQELLGIDDLKMYDLYTPLVKDVKFEMPYEEAKSWMLKALEPMGEEYLNVVKEGLDNRW 352

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D  +  GK SG ++ G     +P+ILLN+     D+ TL HE GH  H   S + Q   
Sbjct: 353 VDVYENKGKRSGGYSSGAHL-TNPFILLNWSDTVSDLYTLVHEFGHSAHSYFSRQNQPSN 411

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
            ++ ++ +AE AS   E L  D + +     ++R +LL  ++E    ++ RQ  F +FE 
Sbjct: 412 LSDYTIFVAEVASTCNEALLSDYMDKHLD-DDKRLLLLNQELERFRATLFRQTMFAEFEH 470

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
           K+H    +   +  +R+NE + +  K+  G A + +D +    W  +PHF   ++YVY Y
Sbjct: 471 KIHQIEEAGEPLTPNRMNEEYAKLNKQYFGDAVE-TDEDISKEWSRIPHFY-MNYYVYQY 528

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     SL     +      +      L+ G+S +  E+L    ++++ P   E+  +
Sbjct: 529 ATGYSAAQSLSHQILTEGQPAVERYINEFLKKGSSNYPIEILKNAGVDMTSPEPIEQACE 588

Query: 615 TVEKMIDDVEKM 626
             E+ +D  EK+
Sbjct: 589 VFEQKLDAFEKL 600


>gi|159899634|ref|YP_001545881.1| oligoendopeptidase F [Herpetosiphon aurantiacus ATCC 23779]
 gi|159892673|gb|ABX05753.1| oligoendopeptidase F [Herpetosiphon aurantiacus ATCC 23779]
          Length = 603

 Score =  434 bits (1116), Expect = e-119,   Method: Composition-based stats.
 Identities = 133/608 (21%), Positives = 265/608 (43%), Gaps = 18/608 (2%)

Query: 25  TTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC 84
             + ++E +     W++  LY    + E   D+E I  + L   T  +G LA+       
Sbjct: 6   EQVPTREEVSAEDTWDISSLYADQAAWE--ADVERISSDLLPALTNLQGTLAN-----GP 58

Query: 85  HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL 144
            +L A     E +  ++ +I  YA L  + + ++   +       A          +   
Sbjct: 59  EALLAVFQAQEALGMVLEQIYVYASLRADEDTANQHYQALEERATALSIKASAATSWIEP 118

Query: 145 EINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRF 204
           E+  L +  +    +  P    Y   ++   ++++H  S ++E LL+ T ++ R A   F
Sbjct: 119 ELLALSDEQILGYVSSLPALELYRRALEEQIRLRQHTRSGEVEELLAQTGEISRGAQTTF 178

Query: 205 FCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSF 258
              +   L+F   + +      + + +      + ++ +R+    ++  T+ +  ++ + 
Sbjct: 179 NMFSDADLKFPPIEDEQGKPLEVTMGRYAVLLENPNQRIRRDTFMSIHRTYRQFRNMLAA 238

Query: 259 ITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKK 318
              T  +      + R Y+   D+      +   V + L+ +V  + PK  HRY  ++K+
Sbjct: 239 NYATNVRSNIFYAKARGYDSALDASLKPKEIPMSVYDNLISTVHEHLPKL-HRYGAVRKR 297

Query: 319 WLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAP 378
            L +D+++ +D   PL G +   I FE    L+L +      + S          W+D  
Sbjct: 298 ILGVDSLHAYDWFVPLNGAAPTKIDFEQGASLILSALEPLGAEYSSNLGHGLESRWVDRY 357

Query: 379 QYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNS 438
           +   K SGA++ G   +  P+IL+NY      + TLAHELGH +H +++ + Q     + 
Sbjct: 358 ENKNKRSGAYSWG-CYTSQPFILMNYKNNLNSLFTLAHELGHSMHSLMTRKYQPYTYGHY 416

Query: 439 SLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHT 498
           +L +AE AS   E L  + +L+ +     R  L+  +I+D+  +++RQ  F +FE + H 
Sbjct: 417 TLFVAEVASTLNEALLAEYMLKTSDDPALRLQLVTQQIDDIRGTLLRQTLFAEFERETHR 476

Query: 499 ERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGN 558
                  +    ++ ++    ++  GP   + D E    W  +PHF  S FYVY Y+ G 
Sbjct: 477 MVEQGEALTADNLSALYRRLIEQYYGPELVI-DEELDIEWARIPHFYRS-FYVYQYSTGI 534

Query: 559 CLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
               +L D   +       E Y+N LR GNSK   +LL    ++++ P+   R +     
Sbjct: 535 SAALALADKILTEGA-GAAENYVNFLRGGNSKSSIDLLKGAGVDMTTPDPIHRAMNRFGD 593

Query: 619 MIDDVEKM 626
           ++  ++++
Sbjct: 594 LVTKLDEL 601


>gi|219848221|ref|YP_002462654.1| oligoendopeptidase F [Chloroflexus aggregans DSM 9485]
 gi|219542480|gb|ACL24218.1| oligoendopeptidase F [Chloroflexus aggregans DSM 9485]
          Length = 602

 Score =  434 bits (1115), Expect = e-119,   Method: Composition-based stats.
 Identities = 137/612 (22%), Positives = 262/612 (42%), Gaps = 19/612 (3%)

Query: 21  SSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
           +    ++ ++  +     W+L  ++    + E       +E  +       +G LA    
Sbjct: 2   TLSANSIPTRAEIPVEYTWDLSQIFADVPAWEQER--SAVEARAQELAA-LQGTLA---- 54

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
            +    L AA+   + + + +  +  YA+   + + + P  +       +  A  + VL 
Sbjct: 55  -QGPAQLLAALTLRDEVAQRLHALYVYALHRKDSDGTDPVGQGLAERAGSFAARIQAVLA 113

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           F   EI T+    L++  A  P    Y   ++ + + + H+ S ++E +++  S + R  
Sbjct: 114 FIEPEILTIPAETLDEWLAATPGLQVYRYALEKLNRQRAHIRSAEVEQVMAALSDIVRAP 173

Query: 201 LKRFFCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              F       L+F   +       K+   +  +     DR VR+ A K     F    +
Sbjct: 174 YATFSMLTDADLQFPTIEDEQGQPVKLSHARYGRLLESHDRRVRRDAFKGYYSAFLPFRN 233

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
             +       +   I+ R R Y    ++    N +   V   L+ +         HRY  
Sbjct: 234 TLATTLGAAIRSHVIEARLRNYGSALEAALAPNEIPVEVYHNLI-ATVEANLPRFHRYLT 292

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           ++++ + LD ++F+D         +  IP+  A DL+ +++    P+     ++ FT  W
Sbjct: 293 VRRRLMGLDDLHFYDLYVQPVPDVEMTIPYREACDLMREAFRPLGPEYGAALDQMFTRRW 352

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           ID  +  GK SGA++ G+     PYILLNY  + +DV TLAHELGH +H   +  TQ  +
Sbjct: 353 IDVYENVGKRSGAYSGGS-YGTPPYILLNYQDRLRDVFTLAHELGHSLHSYFTRATQPFV 411

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
               ++ +AE AS   E L    +LQ+ + +  R+ LLA +IE++  +I RQ  F  FEL
Sbjct: 412 YGEYTIFVAEVASTLNEALLTHYMLQSGADEALRRRLLAQQIEEIRGTIFRQTMFAAFEL 471

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
            +H +      +    +++ + E      GP   + D E    W+ +PHF    +     
Sbjct: 472 WMHEQAERGQPLTADALSQHYRELVVRYHGPELVIDD-ELAYEWLRIPHFYYQFYVYQY- 529

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     +L     +       E+YL  LR+G+S+   +LL    ++++ P   +  + 
Sbjct: 530 ATGLSAALALSRQIINEGQPAV-ERYLRFLRSGSSRSSIDLLRDAGVDMTSPAPIQAAMD 588

Query: 615 TVEKMIDDVEKM 626
           T  +++  +E++
Sbjct: 589 TFAELVSQLEQL 600


>gi|320528284|ref|ZP_08029446.1| oligoendopeptidase F [Solobacterium moorei F0204]
 gi|320131198|gb|EFW23766.1| oligoendopeptidase F [Solobacterium moorei F0204]
          Length = 601

 Score =  433 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 152/608 (25%), Positives = 272/608 (44%), Gaps = 21/608 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           MT +  +  +    +W+L  L+ S ++   +  +  ++         ++G L       N
Sbjct: 1   MTELKERNQIEQKYKWDLSTLFESDEAW--NEALTKLDALISE-AASFQGKLN------N 51

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
             SL A     + + + +  + +YAML ++ +  +   +  Y+    K  +      F  
Sbjct: 52  TESLLAYFTVSDELDKALNNVFTYAMLRHSEDTRATDAQGMYSKAYGKYVEAVSATSFAQ 111

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            EI   DE +L++  A DP    ++  ++N+ + K H LS   E LLS   +V     + 
Sbjct: 112 PEILGNDEEVLKRFIA-DPSLNDFAFLLENLVRNKAHTLSAAEEKLLSTFGEVFSAPGRT 170

Query: 204 FFCENIESLRFKINDQKIPLTKAYKSFFD------SDREVRKSAAKALSHTFNKSSHIFS 257
                   + F         +               DRE+RK++  +L   + +  + F+
Sbjct: 171 SEALMDADMVFDAAKDGEGNSHEVNGSSYILLQGSDDRELRKNSFTSLYKGYKQHINTFA 230

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
              +T  K   I  + R +E    +   S+N+   V + L+++V  +   T +RY +L+K
Sbjct: 231 STYSTTVKAASIDAKVRHHESSRQAAMFSDNIPVSVYDNLVETVHKH-LPTMYRYVKLRK 289

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           K L LD ++++D  APL   S     +E A+++VL++      + + + +    + W+D 
Sbjct: 290 KMLDLDELHYYDVYAPLLKGSAKDYSYEEAKEMVLEAVEPLGTEYTDVVKAGLENRWVDV 349

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
               GK  GA++ GT  S +PYIL NY G    V TLAHE+GH +H   ++ TQ +   N
Sbjct: 350 YPNKGKRGGAYSSGTYTS-NPYILCNYTGTLDSVSTLAHEMGHSMHSYRTNHTQPVHYAN 408

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
            ++ +AE AS   E L  + LLQ  +   +R  LL   +E    +I RQ  F +FE + H
Sbjct: 409 YTMFVAEVASTVNENLLIEQLLQKETDPAQRMALLNQYMEGFKGTIYRQTMFAEFEKEAH 468

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
                   +    +N+++L   K+  G    + D E    W  +PHF    FYVY YA G
Sbjct: 469 AASERGESLTPEFLNQLYLNLVKKYFGEELVIDD-EVQYEWARIPHFYR-PFYVYVYATG 526

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                ++ +       +   +KYL  L  G+S +  + L    ++L+ P   +  L+   
Sbjct: 527 YSTAVAISEGILHGGKEKV-QKYLEFLSMGSSAYPIDELKHAGVDLTTPEPIDIALEKFA 585

Query: 618 KMIDDVEK 625
           K++DD E+
Sbjct: 586 KILDDAEE 593


>gi|229823282|ref|ZP_04449351.1| hypothetical protein GCWU000282_00580 [Catonella morbi ATCC 51271]
 gi|229787448|gb|EEP23562.1| hypothetical protein GCWU000282_00580 [Catonella morbi ATCC 51271]
          Length = 603

 Score =  433 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 141/608 (23%), Positives = 257/608 (42%), Gaps = 19/608 (3%)

Query: 25  TTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC 84
            T+ ++E       W+L  LY   D  +   + +  E       + ++G L      +  
Sbjct: 4   ETLRTREQQLEAFTWDLTSLYADADQWQ--AEYDKAEAMVADLAS-FKGTLD-----QGG 55

Query: 85  HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL 144
             L   I   +  C ++ R+ +YA L+Y+ + ++   +          +   + + FF  
Sbjct: 56  AHLVTVIEAIQAACLVVERLYAYAHLTYDQDSTNSAAQVLNARAMQLYSKLAEAIAFFDP 115

Query: 145 EINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRF 204
           E+ +L    LE  + + P    Y  ++ +I + + H LS   E LL+   ++       F
Sbjct: 116 ELLSLPSETLEAYFQETPELDFYRQYLDDITRGRAHTLSASEETLLAQLGEIFNSPYSTF 175

Query: 205 FCENIESLRFKI------NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSF 258
              +     F           ++      +    +DR VR+   +     +N+  +  + 
Sbjct: 176 SLLDNADFVFPTIEGPEGQAVQLTHGTYGRLLESTDRRVRRDTFQQYYTVYNQFKNTLAN 235

Query: 259 ITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKK 318
           + +T  K +  + + R Y     +    NNV   V + L+      +    HRY  L+K 
Sbjct: 236 VLSTNIKTDNYKAKVRHYPSARAAALFRNNVPESVYDTLL-ETVGDHLGLLHRYTALRKD 294

Query: 319 WLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAP 378
            L LD++  +D   PL G +        ARD+V+++ A   P    I  K F   WID  
Sbjct: 295 LLGLDSLEMYDLYTPLLGDAPIKFSQAEARDIVMEALAPMGPDYLEIMAKAFDERWIDWY 354

Query: 379 QYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNS 438
           +  GK SGA++ G   S  PY+LLN+      + TL HELGH  H  LS   Q  + ++ 
Sbjct: 355 ENKGKRSGAYSGGMYDSK-PYVLLNWQDNINWLFTLVHELGHSAHSYLSRTNQPYVYSDY 413

Query: 439 SLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHT 498
           S+ LAE AS   E L  D LL+     + R  +L + ++ +  ++ RQ  F +FE  +H 
Sbjct: 414 SIFLAEIASTTNENLLTDYLLKKYQDPQIRLYVLNHFLDGVKGTVFRQTQFAEFEHFMHQ 473

Query: 499 ERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGN 558
                  +    + E + +   +  GP+ + SD E G  W  +PHF   ++YV+ YA G 
Sbjct: 474 ADAEGTPLTHEFLTENYRKLNAKYYGPSVN-SDSEIGLEWARIPHFY-YNYYVFQYATGF 531

Query: 559 CLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
                  D   ++      E Y   L++G S +  + +    ++++  ++ E  L+  E 
Sbjct: 532 SAATFFADKI-ASGDSALLEAYKGFLKSGCSLYPIDTMKKAGLDMTQRDYIEATLKVFEA 590

Query: 619 MIDDVEKM 626
            +++ E +
Sbjct: 591 RLNEFEAL 598


>gi|325842029|ref|ZP_08167566.1| oligoendopeptidase F [Turicibacter sp. HGF1]
 gi|325489751|gb|EGC92107.1| oligoendopeptidase F [Turicibacter sp. HGF1]
          Length = 599

 Score =  433 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 149/606 (24%), Positives = 275/606 (45%), Gaps = 20/606 (3%)

Query: 27  MDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS 86
           + S+  +    +W ++ +Y S ++ E   D + ++ ++   K  ++G L + T       
Sbjct: 7   LKSRNEIEEESKWKIDKVYASTEAWE--KDFQAVKEKAPKLKE-FQGRLGNIT------D 57

Query: 87  LGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEI 146
           L   +   E +  ++ ++  +A +  + + S+   +     I+  +A F     FF  EI
Sbjct: 58  LKEYLKVEEELSRVLEKLYVFAHMKSHEDTSNSEFQTLVNKIDPFMAQFSSYNAFFTPEI 117

Query: 147 NTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFC 206
            +L++  +E+    D     Y  + K + K K H+LS +ME LL+  S     +   +  
Sbjct: 118 LSLEDGTIEKMLESDDELKVYDTFFKVLLKEKPHILSKEMEELLASASDCLGASESIYTM 177

Query: 207 ENIESLRFKI------NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFIT 260
                + F         D ++            DR VR+ A K L +T+ K  +  +   
Sbjct: 178 LTNADMTFGTIKGEKGQDIELTEGNYSSLIKSKDRRVREDAFKLLFNTYKKYENTIATSL 237

Query: 261 NTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWL 320
            +  K      + RKY    ++    N++   V +  +Q++ N   K+ HRY  LKKK L
Sbjct: 238 TSSLKTFIFYAKTRKYASSLEASLKPNDIPVEVYKNAIQTI-NNNLKSLHRYVGLKKKLL 296

Query: 321 KLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQY 380
            LD ++ +D    +    +  I +  A ++V +       +   I ++     W+D  + 
Sbjct: 297 GLDEIHMYDLYVSVIDIPKQHIEYSDAIEMVKEGLKPLGQEYLDIFDEGIKDGWVDVYEN 356

Query: 381 DGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSL 440
            GK SGA++ G+  ++ PY+LLNY  +  DV TLAHE+GH IH   + + Q  +  N +L
Sbjct: 357 KGKKSGAYSWGSYDTM-PYVLLNYNYELNDVSTLAHEMGHSIHSYYTRKEQPYVYGNYTL 415

Query: 441 TLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTER 500
             AE AS   E L  + L+     K ++  L+  ++E +  ++ RQ+ F +FEL  H   
Sbjct: 416 FCAEVASTTNEILLINDLINKEQDKNKKLYLINQELEQIRATVYRQLMFAEFELITHETL 475

Query: 501 RSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCL 560
            + G + +   + IW +  K+  GP   + D E  S W  +PHF  S FYVY YA G   
Sbjct: 476 ENGGALTSDDFDNIWYDLNKKYFGPEM-IVDEEIKSEWERIPHFY-SDFYVYQYATGYAA 533

Query: 561 VNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMI 620
            ++       N  +   EKY   L+AG S +  + L    ++++     E  ++   +++
Sbjct: 534 ASAFAKSILENG-EAAVEKYKGFLKAGGSLYPIDTLKNAGVDMTTSMPLEATIERFNELL 592

Query: 621 DDVEKM 626
           D +E++
Sbjct: 593 DMLEEL 598


>gi|51893573|ref|YP_076264.1| oligoendopeptidase [Symbiobacterium thermophilum IAM 14863]
 gi|51857262|dbj|BAD41420.1| oligoendopeptidase [Symbiobacterium thermophilum IAM 14863]
          Length = 597

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 139/603 (23%), Positives = 240/603 (39%), Gaps = 19/603 (3%)

Query: 30  QENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGA 89
           +  +     WNL DL+PSH++ E     + IE +  A  T+++G LA     +   +L A
Sbjct: 5   RNEVPVELTWNLHDLFPSHEAWEAEG--KAIEADLPA-VTQYKGRLA-----EGPATLAA 56

Query: 90  AIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTL 149
           A+  +E + E + R  +YA L  + + S P  +       A  A F     F   EI  L
Sbjct: 57  ALKAFETLLERMVRWGTYANLLASGDGSDPENQGMLAKAYALQAQFMAATAFIKSEILAL 116

Query: 150 DEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENI 209
            E       A DP    Y   ++ +   + + L    E  L+  S+V       +     
Sbjct: 117 PEGQAAAWMAADPELAVYRPALEQVLIERPYKLHPQTEEALAALSEVSEAPFIIYERARS 176

Query: 210 ESLRFKINDQKIPLTKAYKSFFDSDR-------EVRKSAAKALSHTFNKSSHIFSFITNT 262
             + F+        +         D         VR++A  + +       +  +    T
Sbjct: 177 SDMTFEPITAPDGRSLPVSFSLYEDELELSADTAVRRAAFDSFTRGLKAYQNTLAATFAT 236

Query: 263 LAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKL 322
             K   +  R R YE +       + ++  V   L+  +++       RY  L+K+ L L
Sbjct: 237 EVKKNIVLSRLRGYESVTHMLLAPHRIDHGVYHNLLDVIQSELAPHMRRYARLRKRVLGL 296

Query: 323 DTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDG 382
           D M + D  APL       +  E A +L+L + +   P+   I E+ F   WID     G
Sbjct: 297 DEMRYCDIEAPLDPGYNPQVTREEAANLILDALSVLGPEYRAIIERAFNERWIDWADNVG 356

Query: 383 KGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTL 442
           K +GAF        H YILL + G  +   TLAHELGH  HF L++  Q +L    SL  
Sbjct: 357 KQAGAFCTS-PYGAHSYILLTFTGHMRSAFTLAHELGHAGHFELANRHQRLLNVEPSLFF 415

Query: 443 AETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRS 502
            E  S   E L  D +L+    K  R+ ++   +    ++ VR +   + + +++ +   
Sbjct: 416 VEAPSTMNEVLLADHILKGTDDKRMRRWVITQLLMTYHHNFVRHLLEAELQRRIYAQAEK 475

Query: 503 TGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVN 562
              +    ++E      ++  G    + D      WM  PH+     Y Y Y+ G     
Sbjct: 476 GVPVTAQLLSETKGAILEQFWGGEVVI-DEGAKLTWMRQPHYY-MGLYPYTYSAGLTCGT 533

Query: 563 SLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
            +    K        E+++ +L+ G S    EL+    ++++ P    + +  V  +ID+
Sbjct: 534 LMAQRIKEEGQPAA-EQWVEVLKLGGSLPPMELMARAGVDMTSPEPIRKAIAYVGSLIDE 592

Query: 623 VEK 625
           +E 
Sbjct: 593 LEA 595


>gi|239636485|ref|ZP_04677487.1| oligoendopeptidase F [Staphylococcus warneri L37603]
 gi|239597840|gb|EEQ80335.1| oligoendopeptidase F [Staphylococcus warneri L37603]
          Length = 603

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 132/612 (21%), Positives = 260/612 (42%), Gaps = 22/612 (3%)

Query: 24  MTTMDSQENLG---NLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
           M+   S+E          W+L  ++PS D+       + +E +    + +++G+L     
Sbjct: 2   MSQQLSREEQEHKYPEYTWDLTTIFPSDDA--FEEAFKDVESDIGK-EEQFKGHLGD--- 55

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
             +  +L  A+A  + I   + ++  YA L  + + ++          +  +  F     
Sbjct: 56  --SADTLYQALALEDEIGTKLEKVYVYAHLKQDQDTANDQYTGMEARAHQLIIKFSSAWS 113

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           F   EI  LDE  ++     +    +Y   ++ I + + H+L  D E LL++        
Sbjct: 114 FLVPEILQLDEKTIQTFIQSNDKLKQYEFDLQLINEKRPHILDADTEKLLTEAQDALSTP 173

Query: 201 LKRFFCENIESLRFKI------NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              +   +   L F+           +      K     DR +R+SA + +   +   ++
Sbjct: 174 SNVYGMFSNADLEFEDAIDKDGKAHPLTQGTFIKYLESDDRVLRESAFRNVYKAYGSHNN 233

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
                     K      R   Y+   +    +N++   V + L+++V  Y     HRY  
Sbjct: 234 TLGATLAGEVKKNVFNARTHHYKSAREKALSNNHIPEEVYDNLVKTVHKY-LPLLHRYTR 292

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+++ L +D +  +D   PL    +  +P+E A+  +L++      +   + ++   + W
Sbjct: 293 LRQELLGIDDLKMYDLYTPLVKDVKFEMPYEEAKSWMLKALEPMGEEYLNVVKEGLDNRW 352

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D  +  GK SG ++ G     +P+ILLN+     D+ TL HE GH  H   S + Q   
Sbjct: 353 VDVYENKGKRSGGYSSGAHL-TNPFILLNWSDTVSDLYTLVHEFGHSAHSYFSRQNQPSN 411

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
            ++ ++ +AE AS   E L  D + +     ++R +LL  ++E    ++ RQ  F +FE 
Sbjct: 412 LSDYTIFVAEVASTCNEALLSDYMDKHLD-DDKRLLLLNQELERFRATLFRQTMFAEFEH 470

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
           K+H    +   +   R+NE + +  K+  G A + +D +    W  +PHF   ++YVY Y
Sbjct: 471 KIHQIEEAGEPLTPTRMNEEYAKLNKQYFGDAVE-TDEDISKEWSRIPHFY-MNYYVYQY 528

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     SL     +      +      L+ G+S +  E+L    ++++ P   E+  +
Sbjct: 529 ATGYSAAQSLSHQILTEGQPAVERYINEFLKKGSSNYPIEILKNAGVDMTSPEPIEQACE 588

Query: 615 TVEKMIDDVEKM 626
             E+ +D  EK+
Sbjct: 589 VFEQKLDAFEKL 600


>gi|288556741|ref|YP_003428676.1| oligoendopeptidase F [Bacillus pseudofirmus OF4]
 gi|288547901|gb|ADC51784.1| oligoendopeptidase F [Bacillus pseudofirmus OF4]
          Length = 595

 Score =  433 bits (1112), Expect = e-119,   Method: Composition-based stats.
 Identities = 145/607 (23%), Positives = 270/607 (44%), Gaps = 20/607 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           M+T  S++ +    +W++ D+Y S D      D+  IE  ++  K  ++G +      ++
Sbjct: 1   MSTYSSRKEVPEHEKWDVSDIYSSLDEWR--EDVAVIEEMTVKLKE-FDGKI------ED 51

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
            HSL   ++  E++   + ++  YA L  + +           +           + FF 
Sbjct: 52  GHSLYDFLSMQEKLSFHLSKVVVYARLQVDVDTRDKKAESILDEATQLSVKASTAVSFFR 111

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
             I +LD++ L++  ++      +   + ++ + K H+LS + E +L+   +      K 
Sbjct: 112 PFILSLDKSTLQEYISEVEGLTYFEDDLMDLFRYKPHVLSKEKEEVLTQLGEALSSPSKT 171

Query: 204 FFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           F   N   ++F +  +       +      K   + DR  RK A  A    + + ++  +
Sbjct: 172 FGMINNADIKFGLVTKDDGEKVELTRGMYEKLLKNEDRNKRKEAYHAYYKPYVELNNTIA 231

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
              ++  K      + + Y    +    ++ V   V + L+++ KN+     HRY +++K
Sbjct: 232 STLSSAIKTNVTVSKMKNYPSALEKSLFADQVPKEVYDKLIEATKNHLAP-YHRYQKIRK 290

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           + L +D +  +D   PL       IP+  A DL+L++ A    +      +F    +ID 
Sbjct: 291 EMLGVDELRQYDLSIPLVKGVDKDIPYNEAYDLMLKALAPLGEEYVETLAEFKDKRYIDV 350

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK SGA+  G    VHP++LLN+      + TLAHE+GH +H  LS++ Q  +T  
Sbjct: 351 RETPGKRSGAYNMGL-YGVHPFVLLNHQDNLNSLFTLAHEMGHAMHSYLSAKHQPQITAG 409

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
            ++ +AE AS   E L    LL  ++  + RK L+ + I+    +   Q+ F +FE   H
Sbjct: 410 YTIFVAEVASTVNEVLLIHYLLNQSTDDKTRKYLVNDFIDKFKGTFFTQVMFANFEKDTH 469

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
               +   +     NE++ +  +E  GP     D E    W  +PHF    FYVY YA G
Sbjct: 470 ELAEAGKPLTAEVFNEVYEQLFREYNGPDMVF-DEEVKYGWSRIPHFYR-PFYVYKYATG 527

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                 L +    N  +  KE YL  L++G+S +  ELL    ++L+     E+ L    
Sbjct: 528 FAAAIQLANGLLEN-KEGAKEAYLEFLQSGSSDYPLELLKKAGVDLTTSEPIEKALAFFT 586

Query: 618 KMIDDVE 624
           +++D+ E
Sbjct: 587 ELVDEFE 593


>gi|327441290|dbj|BAK17655.1| oligoendopeptidase F [Solibacillus silvestris StLB046]
          Length = 602

 Score =  432 bits (1110), Expect = e-119,   Method: Composition-based stats.
 Identities = 139/599 (23%), Positives = 258/599 (43%), Gaps = 18/599 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
              + ++E +     W+L  ++ S ++ E   +++ +E  S    + ++G +A      +
Sbjct: 2   AKQILTREEVPEQLTWDLTSIFESDEAWE--AELKEVEQLSKQ-ASNYKGKVAD-----S 53

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
             SL   +   + + E + ++  Y+ L ++ + ++   +     + + L +      F  
Sbjct: 54  AESLYNTLQFSDALYERLHKLYVYSHLKHDQDTTNSKYQDLDGRVRSVLTNVGAAWSFIT 113

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            EI  LDEA L            Y   +K +   + H+LS + E LL+  S+V   A K 
Sbjct: 114 PEILALDEATLNSYVESYEPLSLYEQSLKELNLGRPHILSAEKEELLAQFSEVTSTAGKT 173

Query: 204 FFCENIESLRFKIN------DQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           F   N   L F         + +I            +REVR++A KA+  T+ +  + F+
Sbjct: 174 FSALNNADLEFPKIKGEDGEEVQITHGNYITMLESDNREVREAAFKAVYKTYGQYKNTFA 233

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
                  K   +  + R Y     +   +N +   V + L+ ++ +Y     HRY EL+K
Sbjct: 234 TTLAGNVKAHNVNAKVRNYNSARHAALSNNFIPEKVYDQLVSTIHDY-LPALHRYVELRK 292

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           K L +D ++ +D   PL    +  + ++ A+  +++S+A    +   I EK     W+D 
Sbjct: 293 KVLGVDELHMYDLFTPLVKEVKMEVTYDEAKKTMVESFAPLGKEYQEIVEKGLESRWVDV 352

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK SGA++ GT    +PY+L+N+     ++ TLAHE GH +H   S   Q    ++
Sbjct: 353 LENKGKRSGAYSSGTF-GTNPYVLMNWQNNVNNLYTLAHEFGHSMHSYYSRANQPYQYSD 411

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
            S+ +AE AS   E L FD L++     +++  LL   ++    ++ RQ  F +FE  +H
Sbjct: 412 YSIFVAEVASTCNEELLFDHLMKTLDDDKQKIYLLNQWLDGFRGTVFRQTMFAEFEHMIH 471

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
                   I + ++  I+ +  K+  G A  + D E G  W  +PHF  + +     A G
Sbjct: 472 ELDAKGESITSEKLTSIYYDLNKQYFGDAMTV-DEEIGLEWARIPHFYYNYYVYQY-ATG 529

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTV 616
                +L            +    N L+AG S    E+L    +++  P       Q  
Sbjct: 530 QSAATALSKQILEEGEPAVERYINNFLKAGCSDFPIEVLKAAGVDMESPEPIALACQVF 588


>gi|116747980|ref|YP_844667.1| pepF/M3 family oligoendopeptidase [Syntrophobacter fumaroxidans
           MPOB]
 gi|116697044|gb|ABK16232.1| oligoendopeptidase, pepF/M3 family [Syntrophobacter fumaroxidans
           MPOB]
          Length = 589

 Score =  432 bits (1110), Expect = e-119,   Method: Composition-based stats.
 Identities = 208/587 (35%), Positives = 327/587 (55%), Gaps = 11/587 (1%)

Query: 39  WNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERIC 98
           WNL DLY   D+  +  D +     ++ F  R+ G +A      +     AAI EYE + 
Sbjct: 10  WNLNDLYSGPDAPAMEQDRQSANDLAVQFAARYRGKVAAL----SPEEASAAIREYEALQ 65

Query: 99  ELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSY 158
           E++ ++ +YA L +      P+       I    +   +  +FF LE   +D+     + 
Sbjct: 66  EILQKLDAYAALHFATRTRDPSTGALLQAIREFRSQVHRDTLFFELEWAQIDDEAFAAAL 125

Query: 159 AQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND 218
                   Y  +++  R+ + HLL+   E +L++   V  ++    F + +  LR     
Sbjct: 126 RHSA-LGPYRHYLELSRRYRPHLLTEPEEKILAEKEPVANDSWTTLFDKVLGHLR--FGP 182

Query: 219 QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEK 278
            +   ++     +  DR VR+ AA+ L+    +   + + I NT+  D+ + DR R+Y  
Sbjct: 183 GERTESEVLSDLYAGDRTVRQQAARELTQGLTEMLPVLTHIFNTILLDKAVTDRLRRYPH 242

Query: 279 IADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTS 338
              +R+L+N  E  ++EAL+++  +       RYY LK+  L  + ++ +DR AP+PG  
Sbjct: 243 WLRARNLANEAEDVMVEALVEA-VSSRYDVVRRYYRLKRTLLGYEELFDYDRYAPIPGLP 301

Query: 339 QDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP 398
           +    +E A+ LVL  +  FSP+ + IA  FF HNWI AP   GK SGAF+H T+PS HP
Sbjct: 302 KKAFSWEEAKHLVLSGFEAFSPEFAEIASDFFRHNWIHAPVLPGKRSGAFSHPTVPSCHP 361

Query: 399 YILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSL 458
           Y+L+N+ G  +DV TLAHELGHG+H VL+ + QG+L  ++ LTLAETAS+FGE + F  L
Sbjct: 362 YVLVNFTGTSRDVATLAHELGHGVHQVLARK-QGLLNADTPLTLAETASVFGEMIVFRHL 420

Query: 459 LQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLET 518
           L+   S++ER  LL +K+ED   ++ RQ+S   FE  +H +RRS G++   RI++ WL++
Sbjct: 421 LERVESRKERAALLCSKLEDSFATVFRQVSMNRFESAVHNQRRSGGELDPERISQFWLDS 480

Query: 519 QKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKE 578
           QK+  G +  L+  +Y  +W  +PHFI S  YVYAYAFG  LV SLY  Y+      F  
Sbjct: 481 QKQMFGDSVTLTG-DYRIWWSYIPHFIHSPGYVYAYAFGELLVLSLYRQYRQTGA-SFVP 538

Query: 579 KYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEK 625
            + ++L AG     +ELL P  I+LSDP+FW+RGL+ +E M+D+ E+
Sbjct: 539 LFRDLLEAGGKASPNELLSPFGIDLSDPSFWKRGLEVIEGMLDEAEQ 585


>gi|317057023|ref|YP_004105490.1| oligoendopeptidase F [Ruminococcus albus 7]
 gi|315449292|gb|ADU22856.1| oligoendopeptidase F [Ruminococcus albus 7]
          Length = 600

 Score =  432 bits (1110), Expect = e-118,   Method: Composition-based stats.
 Identities = 137/606 (22%), Positives = 256/606 (42%), Gaps = 19/606 (3%)

Query: 27  MDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS 86
           +  +  +     W LED++P+ ++ E    +E  +         ++G L      ++  +
Sbjct: 6   IPKRSEVAKENTWALEDIFPTDEAWE--AALEEFKK-LPERVAAYKGRLG-----ESADT 57

Query: 87  LGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEI 146
           L   +   + I      I +YA    + + +    + +   +      F     F + E+
Sbjct: 58  LLEFLKLSDDISVAADSIVNYAQRKSDEDTAVAKYQGYVGQMMNVFVAFNAASSFESPEL 117

Query: 147 NTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFC 206
            ++ + +LE  Y Q+     Y   +  IR  K H+LS   E +++   ++G  A K +  
Sbjct: 118 ISIPDDVLEGFYKQNSGLELYRRQLDRIRLRKDHVLSEAEERIIALAGEMGNSADKIYSM 177

Query: 207 ENIESLRFKI------NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFIT 260
            +   L+F+          ++           +DRE+RKSA  ++   +    +  +   
Sbjct: 178 FSDADLKFEDAVDSEGKTHQVTHGSYIPLVKSTDRELRKSAFASIYKGYGNFRNTCAATL 237

Query: 261 NTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWL 320
           ++  K  E   + R Y    +    SN V   V   L+++  +      + Y  L+KK L
Sbjct: 238 DSQMKALEFYTKARNYNSALEGSLSSNEVPVEVYHNLIKA-VHDNINYMYDYVALRKKLL 296

Query: 321 KLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQY 380
            +D ++F+D   P+       + FE A++ VL++ A        I ++ F + WID  + 
Sbjct: 297 GVDELHFYDLYTPIVSDFTMKVTFEEAKETVLKALAPMGEDYIAILKEGFENRWIDVYEN 356

Query: 381 DGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSL 440
           + K SGA++ G    VHP+++LN+      + TLAHE+GH IH  LS++ Q ++ ++  +
Sbjct: 357 ENKASGAYSAGA--RVHPFVMLNHKDTLDCMFTLAHEMGHAIHSYLSNKNQPVVYSDYVI 414

Query: 441 TLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTER 500
            +AE AS   E L    LL     ++E+  L+   +E    ++ RQ  F +FELK     
Sbjct: 415 FVAEVASTCNEALLMQYLLAHTDDRKEKAYLINYFLEQFRTTLYRQTMFAEFELKCSEIC 474

Query: 501 RSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCL 560
            S   +   ++ EI+ +  K   G    + D +    W  +PHF   +FYVY YA G   
Sbjct: 475 ASGDTLTADKLCEIYGDLNKLYFGDGIVM-DEDIKMEWARIPHFY-YNFYVYQYATGYSA 532

Query: 561 VNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMI 620
             +L            K+     L  G S     LL    +++S        L     +I
Sbjct: 533 AIALSQRILKEGAPAVKDYIEGFLMGGCSADPITLLKRAGVDMSTTKPVTDALALFGDLI 592

Query: 621 DDVEKM 626
             ++++
Sbjct: 593 KQMDEL 598


>gi|227524030|ref|ZP_03954079.1| oligoendopeptidase F [Lactobacillus hilgardii ATCC 8290]
 gi|227088769|gb|EEI24081.1| oligoendopeptidase F [Lactobacillus hilgardii ATCC 8290]
          Length = 610

 Score =  431 bits (1109), Expect = e-118,   Method: Composition-based stats.
 Identities = 138/612 (22%), Positives = 266/612 (43%), Gaps = 20/612 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           S+   +  ++++     W+L  +Y S D  +   D   +E    + K +  G L      
Sbjct: 11  SETQKLPLRKDVPADLTWDLTTIYQSDD--QFEKDFVSVEKTLPSLK-KLSGTLT----- 62

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
           ++  +L  A          + ++  YA L  + + S  + +  Y    A  A F     +
Sbjct: 63  QSAAALLTATETMLTAARKLEKVYVYAQLKNDQDTSEDSYQAMYAKAQALAAQFGAATAW 122

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
           F  E+  L++  +   Y   P    Y          + H+LSN++E +L+    +     
Sbjct: 123 FDPELLKLNDKQMTSYYEAQPKLRDYKRLYDQTFAKRTHILSNEVEEVLAGADDIFSSGE 182

Query: 202 KRFFCENIESLRFKI------NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
           K F   +   L F        +  ++           ++R+VR+ A + L   +++  H 
Sbjct: 183 KTFGVLDNTDLSFPTVTDENGHQVQLSQGVYGILLESTNRDVRRQAFQKLYEVYSQFQHT 242

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
            +    T  K+   +   R+Y    ++   S  +   V + L+ S  N +    HRY  L
Sbjct: 243 LAATLTTNVKNHNFKANVRQYHSALEAALSSTEIPVKVYDNLI-SEVNKHLDLLHRYVAL 301

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L +D ++ +D   PL G       F+ ++ + L +     PQ     ++ F + WI
Sbjct: 302 RKRILGVDELHMYDLYTPLIGGKSPKYTFDESKKVALDALQVMGPQYVNHVKEEFNNRWI 361

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +   K SG ++ GT    +P+ILLN+     ++ TL HE GH +H   +S  Q    
Sbjct: 362 DVVENRYKRSGGYSSGTYD-TNPFILLNWKDNLDNLYTLIHETGHSMHSYYASHNQPYQY 420

Query: 436 NNSSLTLAETASIFGETLTFDSLL-QAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
            + S+ +AE AS   E +  D LL +     + ++ +L   ++    ++ RQ  F +FE 
Sbjct: 421 GDYSIFVAEIASTTNENILTDYLLDKFKDDDKMKRYILNYYLDGFKGTVFRQTQFAEFEQ 480

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
            +H +      +  + ++  + +  ++  G +  +SD E G  W  +PHF   +FYVY Y
Sbjct: 481 YIHEQDAKGQPLTANFLDNYYRQLNQKYYGESV-ISDKEIGLEWSRIPHFY-YNFYVYQY 538

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G    ++L D   +   +   EKYLN L++G+S     ++    ++++ P + E+  +
Sbjct: 539 ATGFAAASTLADNIVNGDAEHV-EKYLNYLKSGSSDTPINVMKKAGVDMTQPEYLEKAFR 597

Query: 615 TVEKMIDDVEKM 626
             E+ +D+ EK+
Sbjct: 598 IFEERLDEFEKL 609


>gi|227512239|ref|ZP_03942288.1| oligoendopeptidase F [Lactobacillus buchneri ATCC 11577]
 gi|227084517|gb|EEI19829.1| oligoendopeptidase F [Lactobacillus buchneri ATCC 11577]
          Length = 610

 Score =  431 bits (1109), Expect = e-118,   Method: Composition-based stats.
 Identities = 139/612 (22%), Positives = 265/612 (43%), Gaps = 20/612 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           S+   +  ++++     W+L  +Y S D  +   D   +E    + K +  G L      
Sbjct: 11  SETQKLPLRKDVPADLTWDLTTIYQSDD--QFEKDFVSVEKTLPSLK-KLSGTLT----- 62

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
           +   +L  A          + R+  YA L  + + S  + +  Y    A  A F     +
Sbjct: 63  QGAAALLTATETMLTAARKLERVYVYAQLKNDQDTSEDSYQAMYAKAQALAAQFGAATAW 122

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
           F  E+  L++  +   Y   P    Y          + H+LSN++E +L+    +     
Sbjct: 123 FDPELLKLNDKQMTSYYEAQPKLRDYKRLYDQTFAKRTHILSNEVEEVLAGADDIFSSGE 182

Query: 202 KRFFCENIESLRFKI------NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
           K F   +   L F        +  ++           ++R+VR+ A + L   +++  H 
Sbjct: 183 KTFGVLDNTDLSFPTVTDENGHQVQLSQGVYGILLESTNRDVRRQAFQKLYEVYSQFQHT 242

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
            +    T  K+   +   R+Y    ++   S  +   V + L+ S  N +    HRY  L
Sbjct: 243 LAATLTTNVKNHNFKANVRQYHSALEAALSSTEIPVKVYDNLI-SEVNKHLDLLHRYVAL 301

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L +D ++ +D   PL G       F+ ++ + L +     PQ     ++ F + WI
Sbjct: 302 RKRILGVDELHMYDLYTPLIGGKSPKYTFDESKKVALDALQVMGPQYVNHVKEEFNNRWI 361

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +   K SG ++ GT    +P+ILLN+     ++ TL HE GH +H   +S  Q    
Sbjct: 362 DVVENRYKRSGGYSSGTYD-TNPFILLNWKDNLDNLYTLIHETGHSMHSYYASHNQPYQY 420

Query: 436 NNSSLTLAETASIFGETLTFDSLL-QAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
            + S+ +AE AS   E +  D LL +     + ++ +L   ++    ++ RQ  F +FE 
Sbjct: 421 GDYSIFVAEIASTTNENILTDYLLDKFKDDDKMKRYILNYYLDGFKGTVFRQTQFAEFEQ 480

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
            +H +      +  + ++  + +  ++  G +  +SD E G  W  +PHF   +FYVY Y
Sbjct: 481 YIHEQDAKGQPLTANFLDNYYRQLNQKYYGESV-ISDKEIGLEWSRIPHFY-YNFYVYQY 538

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G    ++L D   +   +   EKYLN L++G+S     ++    ++++ P + E+  +
Sbjct: 539 ATGFAAASTLADNIVNGDAEHV-EKYLNYLKSGSSDTPINVMKKAGVDMTQPEYLEKAFR 597

Query: 615 TVEKMIDDVEKM 626
             E+ +D+ EK+
Sbjct: 598 IFEERLDEFEKL 609


>gi|302875742|ref|YP_003844375.1| oligoendopeptidase F [Clostridium cellulovorans 743B]
 gi|307689175|ref|ZP_07631621.1| oligoendopeptidase F [Clostridium cellulovorans 743B]
 gi|302578599|gb|ADL52611.1| oligoendopeptidase F [Clostridium cellulovorans 743B]
          Length = 598

 Score =  431 bits (1109), Expect = e-118,   Method: Composition-based stats.
 Identities = 139/608 (22%), Positives = 270/608 (44%), Gaps = 20/608 (3%)

Query: 25  TTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNC 84
             +  +  + +  +W++  ++ S D  E     +  + E+    + ++G L      K  
Sbjct: 5   KKLLKRSEIPDTAKWDVNKIFASDDKWE--EAFKVAKEEAKKL-SEYQGKL------KEA 55

Query: 85  HSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFAL 144
           + L   +   E+I   + +I  YA L  + +  + T +     +N+ +A+ +    FF  
Sbjct: 56  NMLLEFLKLDEKISRDVEKIMMYAFLKSDEDTKNTTYQGIKGRVNSYVAELQGSTAFFVP 115

Query: 145 EINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRF 204
           EI + ++  +E+   ++     Y  +++ I   K H+L+ + E LL+  S++       +
Sbjct: 116 EILSFEDDFVEKVIKENKELELYRFYLERIMSKKPHILTKEKEELLASASELFDAPHSIY 175

Query: 205 FCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSF 258
                  L+F           ++      +     DR VR++A ++L  T+ +  +  + 
Sbjct: 176 SIFANADLKFPKIKNEENEEMQLTEAMYSQFIKSKDRNVRENAFRSLFKTYGEFRNTIAT 235

Query: 259 ITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKK 318
              +  K      + R Y    +S    NN+   V +  ++++        HRY +LKKK
Sbjct: 236 SLVSSIKTWNFNAKIRSYSNAIESALAPNNIPVSVYDNTIEAINKN-LPLLHRYVKLKKK 294

Query: 319 WLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAP 378
            LKLD ++ +D   P+  T ++ I F+ A  +  ++      +   I      ++WID  
Sbjct: 295 MLKLDEIHMYDLYVPVIDTPKEHIEFKEAVTIANEALKPLGDEYLSIFNSGIENSWIDIY 354

Query: 379 QYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNS 438
             +GK SGA++ G   ++ PY+LLNY  +  DV T  HE+GH IH   S ++Q  + ++ 
Sbjct: 355 PNEGKRSGAYSWGCYDTM-PYVLLNYTYELNDVSTFVHEMGHSIHSYYSRKSQPYIYSDY 413

Query: 439 SLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHT 498
            +  AE AS   E L  + L+     K ++  L+ +++E +  ++ RQ+ F +FE   H 
Sbjct: 414 VIFCAEVASTTNEILLINHLIHKEKDKTKKLYLINSQLEQIRATVFRQVMFAEFEKITHE 473

Query: 499 ERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGN 558
                  +    +  IW     +  GP   + D E    W  +PHF  S FYVY YA G 
Sbjct: 474 TLEKGDSLTADDLCSIWHNLNVKYFGPDMVV-DEEIDMEWARIPHFY-SDFYVYQYATGY 531

Query: 559 CLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEK 618
              +S   +      +   EKY   L++G S +  E+L    ++++     E  + T  +
Sbjct: 532 AAASSFAKMILEE-KEGALEKYKGFLKSGGSNYPIEILKEAGVDMTTAKPIEDTMDTFRQ 590

Query: 619 MIDDVEKM 626
           ++D +E++
Sbjct: 591 LLDMIEEI 598


>gi|323443865|gb|EGB01477.1| thimet oligopeptidase [Staphylococcus aureus O46]
          Length = 602

 Score =  431 bits (1108), Expect = e-118,   Method: Composition-based stats.
 Identities = 129/612 (21%), Positives = 260/612 (42%), Gaps = 22/612 (3%)

Query: 24  MTTMDSQENLG---NLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
           M+   S+E          W+L  ++   D +      + +E+E    + +++G++     
Sbjct: 1   MSQQLSREEQERKYPEYTWDLTTIFK--DDEAFEAAFKEVENELGK-EEQFKGHIGD--- 54

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
             +  +L  A+   + +   + ++  YA L  + + ++       +  +  +  F     
Sbjct: 55  --SAETLYNALELEDTLGTKLEKVYVYAHLKQDQDTTNDKYTGMESRAHQLIIKFSSAWS 112

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           F   EI  +DE  ++          K++  +K I + + H+L  + E LL++        
Sbjct: 113 FLVPEILQIDEDKIQSFVNSYDKLQKFAFDLKLINEKRPHILDAETEKLLTEAQDALSTP 172

Query: 201 LKRFFCENIESL------RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              +   +   L          N   +      K     DR++R+SA + +   +   ++
Sbjct: 173 SNVYGMFSNADLVFEDAIDKDGNAHPLTQGTFIKYLESDDRKLRESAFRNVYKAYGAHNN 232

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
                     K      R   Y+   +    +N++   V + L+++V  Y     HRY E
Sbjct: 233 TLGATLAGEVKKNVFNARTHNYKTAREKALSNNHIPENVYDNLVKTVHKY-LPLLHRYTE 291

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+K+ L LD +  +D   PL    +  +P+E A++ +L++      +   + ++   + W
Sbjct: 292 LRKELLGLDDLKMYDLYTPLIKDIKFEMPYEEAKEWMLKALEPMGEEYLNVVKEGLNNRW 351

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D  +  GK SG ++ G     +P+ILLN+     D+ TL HE GH  H   S + Q   
Sbjct: 352 VDVYENKGKRSGGYSSGAHL-TNPFILLNWSNTISDLYTLVHEFGHSAHSYFSRKFQPSN 410

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
           +++ ++ +AE AS   E L  D + +     E+R +LL  ++E    ++ RQ  F +FE 
Sbjct: 411 SSDYTIFVAEVASTCNEALLSDYMDKHFDD-EKRLLLLNQELERFRATLFRQTMFAEFEH 469

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
           K+H    +   +   R+NE + +  K   G + + +D +    W  +PHF   ++YVY Y
Sbjct: 470 KIHAIEEAGEPLTPTRMNEEYAKLNKLYFGDSVE-TDEDISKEWSRIPHFY-MNYYVYQY 527

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     SL     +             L+ G+S +  E+L    ++++ P   E+  +
Sbjct: 528 ATGYSAAQSLSHQILTEGKPAVDRYINEFLKKGSSNYPIEILKNAGVDMTTPEPIEQACE 587

Query: 615 TVEKMIDDVEKM 626
             E+ ++  EK+
Sbjct: 588 VFEQKLNAFEKL 599


>gi|227509364|ref|ZP_03939413.1| oligoendopeptidase F [Lactobacillus brevis subsp. gravesensis ATCC
           27305]
 gi|227191076|gb|EEI71143.1| oligoendopeptidase F [Lactobacillus brevis subsp. gravesensis ATCC
           27305]
          Length = 610

 Score =  431 bits (1108), Expect = e-118,   Method: Composition-based stats.
 Identities = 139/612 (22%), Positives = 264/612 (43%), Gaps = 20/612 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           S+   +  ++++     W+L  +Y S D  +   D   +E    + K +  G L      
Sbjct: 11  SETQKLPLRKDVPADLTWDLTTIYQSDD--QFEKDFVSVEKTLPSLK-KLSGTLT----- 62

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
           +   +L  A          + ++  YA L  + + S    +  Y    A  A F     +
Sbjct: 63  QGAAALLTATETMLTAARKLEKVYVYAQLKNDQDTSEDGYQAMYAKAQALAAQFGAATAW 122

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
           F  E+  L++  +   Y   P    Y          + H+LSN++E +L+    +     
Sbjct: 123 FDPELLKLNDKQMTSYYEAQPKLRDYKRLYDQTFAKRAHILSNEVEEVLAGADDIFSSGE 182

Query: 202 KRFFCENIESLRFKI------NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
           K F   +   L F        +  ++           ++R+VR+ A + L   +++  H 
Sbjct: 183 KTFGVLDNTDLSFPTVTDENGHQVQLSQGVYGILLESTNRDVRRQAFQKLYEVYSQFQHT 242

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
            +    T  K+   +   R+Y    ++   S  +   V + L+ S  N +    HRY  L
Sbjct: 243 LAATLTTNVKNHNFKANVRQYHSALEAALSSTEIPVKVYDNLI-SEVNKHLDLLHRYVAL 301

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           +K+ L LD ++ +D   PL G       F+ ++ + L +     PQ     ++ F + WI
Sbjct: 302 RKRILGLDELHMYDLYTPLIGEKSPKYTFDESKKVALDALQVMGPQYVNHVKEEFNNRWI 361

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +   K SG ++ GT    +P+ILLN+     ++ TL HE GH +H   +S  Q    
Sbjct: 362 DVVENRYKRSGGYSSGTYD-TNPFILLNWKDNLDNLYTLIHETGHSMHSYYASHNQPYQY 420

Query: 436 NNSSLTLAETASIFGETLTFDSLL-QAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
            + S+ +AE AS   E +  D LL +     + ++ +L   ++    ++ RQ  F +FE 
Sbjct: 421 GDYSIFVAEIASTTNENILTDYLLDKFKDDDKMKRYILNYYLDGFKGTVFRQTQFAEFEQ 480

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
            +H +      +  + ++  + +  ++  G +  +SD E G  W  +PHF   +FYVY Y
Sbjct: 481 YIHEQDAKGQPLTANFLDNYYRQLNQKYYGESV-ISDKEIGLEWSRIPHFY-YNFYVYQY 538

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G    ++L D   +   +   EKYLN L++G+S     ++    ++++ P + E+  +
Sbjct: 539 ATGFAAASTLADNIVNGDAEHV-EKYLNYLKSGSSDTPINVMKKAGVDMTQPEYLEKAFR 597

Query: 615 TVEKMIDDVEKM 626
             E+ +D+ EK+
Sbjct: 598 IFEERLDEFEKL 609


>gi|28211583|ref|NP_782527.1| oligoendopeptidase F [Clostridium tetani E88]
 gi|28204024|gb|AAO36464.1| oligoendopeptidase F [Clostridium tetani E88]
          Length = 626

 Score =  431 bits (1108), Expect = e-118,   Method: Composition-based stats.
 Identities = 148/621 (23%), Positives = 274/621 (44%), Gaps = 20/621 (3%)

Query: 10  FSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKT 69
            +  +F       +  T+ S++ +    +WN+  LY   D+ E  +D + ++  +    +
Sbjct: 16  LNAHYFYGGFYMENTKTLKSRDEIDEKSKWNINKLYEDIDAWE--SDFQHLKEITPKL-S 72

Query: 70  RWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDIN 129
            ++G L      K+   L       E I  L  +++ YA    + + ++ T +   + I+
Sbjct: 73  NFQGKL------KDPKLLLEYFKTEESILRLAEKLSVYAHCRSDEDTTNTTFQGLKSKID 126

Query: 130 AKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECL 189
           +   +   +  FF  EI ++++  L     + P    Y   ++NI  +K H+LS + E +
Sbjct: 127 SFFPEILGLSSFFIPEILSINKKDLLNGLNEIPELKTYKFLLENILNLKPHILSKEEEMI 186

Query: 190 LSDTSQVGREALKRFFCENIESLRFKINDQKIPLT------KAYKSFFDSDREVRKSAAK 243
           L+  S         +   +   + F     +                   DR VRK A +
Sbjct: 187 LASVSDCLNAPSDIYNMLSNADISFPKIKNEQGEEVELTDKNYSVFISSKDRRVRKDAFE 246

Query: 244 ALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKN 303
           AL  T+ K  + FS    +  K+     + RK+    +S    NN+   V +  ++++ N
Sbjct: 247 ALFDTYEKYKNTFSTALTSSIKNFIFNSKMRKFNSSLESSLKPNNIPLEVYDTTIKTI-N 305

Query: 304 YYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMS 363
               + HRY ++KKK L L+ M+ +D   PL  T    IPFE   ++V +       +  
Sbjct: 306 DNLSSLHRYVKIKKKLLGLEEMHMYDLYVPLIKTPDIHIPFEEGINMVEKGLKPLGEEYL 365

Query: 364 IIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIH 423
            + +K     WID  +  GK  GA++ G+  ++ PY+LLNY  K  DV TLAHE+GH IH
Sbjct: 366 NVFKKGINDGWIDIYENKGKRGGAYSSGSYDTM-PYVLLNYNYKLNDVSTLAHEMGHSIH 424

Query: 424 FVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSI 483
              S E Q  + +N ++  AE AS   E L  + +++  S K  +   +  ++E +  ++
Sbjct: 425 SYYSKENQPYIYSNYTIFCAEVASTTNECLLSNYMIENESDKNMKLYFINQQLEQIRTTV 484

Query: 484 VRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPH 543
            RQ+ F +FE   H +      + ++ +  IW +   +  G    +   +    W  +PH
Sbjct: 485 FRQVMFAEFERITHKKLEEGIPLTSYDLCSIWHDLNLKYFGEDIIID-TQIDIEWSRIPH 543

Query: 544 FIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINL 603
           F  S FYVY YA G    NS          +   +KY+  L++G++ +   +L    I++
Sbjct: 544 FY-SPFYVYQYATGYAAANSFATKILK-GEEGALDKYIGFLKSGDNDYPINILKKACIDM 601

Query: 604 SDPNFWERGLQTVEKMIDDVE 624
           +     E  ++    ++D +E
Sbjct: 602 TTSKPMEDIVKRFNDLLDMLE 622


>gi|90961375|ref|YP_535291.1| oligoendopeptidase F [Lactobacillus salivarius UCC118]
 gi|90820569|gb|ABD99208.1| Oligoendopeptidase F [Lactobacillus salivarius UCC118]
          Length = 605

 Score =  431 bits (1107), Expect = e-118,   Method: Composition-based stats.
 Identities = 143/612 (23%), Positives = 270/612 (44%), Gaps = 19/612 (3%)

Query: 21  SSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
                 +  +  +     W+L  ++ S +  E   + + ++ E   F+          T 
Sbjct: 3   EKKAKRLLQRNEVPEELTWDLTKVFKSDE--EFEKEYQTVKDEVQNFRKL------QGTM 54

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
            +        I  +  I     ++  YA +  + + ++   + +   ++A  A+F + + 
Sbjct: 55  DQGSQRFLQIIENFLSINRKFEKVYVYASMRNDQDTTNAKYQGYNEMVDALAAEFSESIS 114

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           +F  E+  LDE  L+Q + +     +Y   I+++  ++KH L    E LL+  S +   +
Sbjct: 115 WFEPELLELDEDKLKQYFVEKKELKQYEHLIESMLVMRKHTLDKKSESLLAGASDIFGTS 174

Query: 201 LKRFFCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              F   N   L+F I         ++      K    ++R+VRK+A K L   +++  H
Sbjct: 175 QNVFGILNNADLKFPIVKDDNGDDIQLSHGVYGKLIESTNRKVRKAAFKGLYSVYDQFKH 234

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
             +       K    + R R Y+   ++   SN++   V + L+    +      HRY +
Sbjct: 235 TMATTLIGNVKVHNFKARVRNYKDAREAATTSNHIPTEVYDVLL-EQVHKNLPLLHRYVK 293

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+KK L +D ++ +D   PL   S+    +  A+    ++             + F + W
Sbjct: 294 LRKKILGVDELHMYDMYTPLTEDSKLTYNYIQAQIEAKKALEVLGMDYLTHVSEAFENRW 353

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           ID  +  GK SGA++ G   +  PYILLN+    +++ TL HE+GH +H   +S  Q   
Sbjct: 354 IDVVENKGKRSGAYSSGVYDTP-PYILLNWQDNLENLFTLVHEMGHSMHSYYTSHNQPYQ 412

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
             +  + LAE AS   E +  D LL+    KE    +L + ++    ++ RQ  F +FE 
Sbjct: 413 YGDYPIFLAEIASTTNENILTDYLLKNNDEKEILIYILNHYLDGFKGTVYRQTQFAEFEK 472

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
            +H +      +    I+E +LE  K+  G    +SD E    W  +PHF   +FYVY Y
Sbjct: 473 WIHEQNSKGVPLTAKSISEYYLELNKKYYGNDV-VSDPEIALEWARIPHFY-YNFYVYQY 530

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     +L +   S   +    KYL  L+AG+SK+  E++    ++++D ++ E+  +
Sbjct: 531 ATGFAAATTLAENILS-GDENKLNKYLTYLKAGSSKYPLEVMKDAGVDMTDSSYLEKAFK 589

Query: 615 TVEKMIDDVEKM 626
             E+ ++ +E +
Sbjct: 590 VFEERLNQLETL 601


>gi|57650193|ref|YP_185873.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus COL]
 gi|87161444|ref|YP_493602.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|88194694|ref|YP_499490.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|151221082|ref|YP_001331904.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|161509198|ref|YP_001574857.1| M03 family oligopeptidase F [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|221142145|ref|ZP_03566638.1| M03 family oligopeptidase F [Staphylococcus aureus subsp. aureus
           str. JKD6009]
 gi|253731607|ref|ZP_04865772.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|258452049|ref|ZP_05700065.1| oligoendopeptidase F [Staphylococcus aureus A5948]
 gi|262049347|ref|ZP_06022221.1| hypothetical protein SAD30_1645 [Staphylococcus aureus D30]
 gi|262052359|ref|ZP_06024561.1| hypothetical protein SA930_0101 [Staphylococcus aureus 930918-3]
 gi|282923679|ref|ZP_06331358.1| oligoendopeptidase F [Staphylococcus aureus A9765]
 gi|294847985|ref|ZP_06788732.1| oligoendopeptidase F [Staphylococcus aureus A9754]
 gi|304381445|ref|ZP_07364096.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|57284379|gb|AAW36473.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus COL]
 gi|87127418|gb|ABD21932.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87202252|gb|ABD30062.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|150373882|dbj|BAF67142.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|160368007|gb|ABX28978.1| M03 family oligopeptidase F [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|253724606|gb|EES93335.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|257860264|gb|EEV83096.1| oligoendopeptidase F [Staphylococcus aureus A5948]
 gi|259159731|gb|EEW44773.1| hypothetical protein SA930_0101 [Staphylococcus aureus 930918-3]
 gi|259162579|gb|EEW47147.1| hypothetical protein SAD30_1645 [Staphylococcus aureus D30]
 gi|269940499|emb|CBI48877.1| putative oligopeptidase [Staphylococcus aureus subsp. aureus TW20]
 gi|282593065|gb|EFB98065.1| oligoendopeptidase F [Staphylococcus aureus A9765]
 gi|294824785|gb|EFG41207.1| oligoendopeptidase F [Staphylococcus aureus A9754]
 gi|302750825|gb|ADL65002.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus str.
           JKD6008]
 gi|304340018|gb|EFM05961.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|315197546|gb|EFU27882.1| M03 family oligopeptidase F [Staphylococcus aureus subsp. aureus
           CGS01]
 gi|320141183|gb|EFW33030.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus MRSA131]
 gi|320143240|gb|EFW35030.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus MRSA177]
 gi|329313670|gb|AEB88083.1| Oligoendopeptidase F [Staphylococcus aureus subsp. aureus T0131]
 gi|329731132|gb|EGG67503.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus 21189]
          Length = 602

 Score =  431 bits (1107), Expect = e-118,   Method: Composition-based stats.
 Identities = 129/612 (21%), Positives = 260/612 (42%), Gaps = 22/612 (3%)

Query: 24  MTTMDSQENLG---NLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
           M+   S+E          W+L  ++   D +      + +E+E    + +++G++     
Sbjct: 1   MSQQLSREEQERKYPEYTWDLTTIFK--DDEAFEAAFKEVENELGK-EEQFKGHIGD--- 54

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
             +  +L  A+   + +   + ++  YA L  + + ++       +  +  +  F     
Sbjct: 55  --SAETLYNALELEDTLGTKLEKVYVYAHLKQDQDTTNDKYTGMESRAHQLIIKFSSAWS 112

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           F   EI  +DE  ++          K++  +K I + + H+L  + E LL++        
Sbjct: 113 FLVPEILQIDEDKIQSFVNSYDKLQKFAFDLKLINEKRPHILDAETEKLLTEAQDALSTP 172

Query: 201 LKRFFCENIESL------RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              +   +   L          N   +      K     DR++R+SA + +   +   ++
Sbjct: 173 SNVYGMFSNADLVFEDAIDKDGNAHPLTQGTFIKYLETDDRKLRESAFRNVYKAYGAHNN 232

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
                     K      R   Y+   +    +N++   V + L+++V  Y     HRY E
Sbjct: 233 TLGATLAGEVKKNVFNARTHNYKTAREKALSNNHIPENVYDNLVKTVHKY-LPLLHRYTE 291

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+K+ L LD +  +D   PL    +  +P+E A++ +L++      +   + ++   + W
Sbjct: 292 LRKELLGLDDLKMYDLYTPLIKDIKFEMPYEEAKEWMLKALEPMGEEYLNVVKEGLNNRW 351

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D  +  GK SG ++ G     +P+ILLN+     D+ TL HE GH  H   S + Q   
Sbjct: 352 VDVYENKGKRSGGYSSGAHL-TNPFILLNWSNTISDLYTLVHEFGHSAHSYFSRKFQPSN 410

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
           +++ ++ +AE AS   E L  D + +     E+R +LL  ++E    ++ RQ  F +FE 
Sbjct: 411 SSDYTIFVAEVASTCNEALLSDYMDKH-LDDEKRLLLLNQELERFRATLFRQTMFAEFEH 469

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
           K+H    +   +   R+NE + +  K   G + + +D +    W  +PHF   ++YVY Y
Sbjct: 470 KIHAIEEAGEPLTPTRMNEEYAKLNKLYFGDSVE-TDEDISKEWSRIPHFY-MNYYVYQY 527

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     SL     +             L+ G+S +  E+L    ++++ P   E+  +
Sbjct: 528 ATGYSAAQSLSHQILTEGKPAVDRYINEFLKKGSSNYPIEILKNAGVDMTTPEPIEQACE 587

Query: 615 TVEKMIDDVEKM 626
             E+ ++  EK+
Sbjct: 588 VFEQKLNAFEKL 599


>gi|302332611|gb|ADL22804.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus JKD6159]
          Length = 602

 Score =  431 bits (1107), Expect = e-118,   Method: Composition-based stats.
 Identities = 129/612 (21%), Positives = 260/612 (42%), Gaps = 22/612 (3%)

Query: 24  MTTMDSQENLG---NLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
           M+   ++E          W+L  ++   D +      + +E E    + +++G++     
Sbjct: 1   MSQQLTREEQERKYPEYTWDLTTIFK--DDEAFEAAFKEVESELGK-EEQFKGHIGD--- 54

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
             +  +L  A+   + +   + ++  YA L  + + ++       +  +  +  F     
Sbjct: 55  --SAETLYNALELEDTLGTKLEKVYVYAHLKQDQDTTNDKYTGMESRAHQLIIKFSSAWS 112

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           F   EI  +DE  ++          K++  +K I + + H+L  + E LL++        
Sbjct: 113 FLVPEILQIDEDKIQSFVNSYDKLQKFAFDLKLINEKRPHILDAETEKLLTEAQDALSTP 172

Query: 201 LKRFFCENIESL------RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              +   +   L          N   +      K     DR++R+SA + +   +   ++
Sbjct: 173 SNVYGMFSNADLVFEDAIDKDGNAHPLTQGTFIKYLESDDRKLRESAYRNVYKAYGAHNN 232

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
                     K      R   Y+   +    +N++   V + L+++V  Y     HRY E
Sbjct: 233 TLGATLAGEVKKNVFNARTHNYKTAREKALSNNHIPENVYDNLVKTVHKY-LPLLHRYTE 291

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+K+ L LD +  +D   PL    +  +P+E A++ +L++      +   + ++   + W
Sbjct: 292 LRKELLGLDDLKMYDLYTPLIKDIKFEMPYEEAKEWMLKALEPMGEEYLNVVKEGLNNRW 351

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D  +  GK SG ++ G     +P+ILLN+     D+ TL HE GH  H   S + Q   
Sbjct: 352 VDVYENKGKRSGGYSSGAHL-TNPFILLNWSNTISDLYTLVHEFGHSAHSYFSRKFQPSN 410

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
           +++ ++ +AE AS   E L  D + +     E+R +LL  ++E    ++ RQ  F +FE 
Sbjct: 411 SSDYTIFVAEVASTCNEALLSDYMDKH-LDDEKRLLLLNQELERFRATLFRQTMFAEFEH 469

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
           K+HT   +   +   R+NE + +  K   G + + +D +    W  +PHF   ++YVY Y
Sbjct: 470 KIHTIEEAGEPLTPTRMNEEYAKLNKLYFGDSVE-TDEDISKEWSRIPHFY-MNYYVYQY 527

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     SL     +             L+ G+S +  E+L    ++++ P   E+  +
Sbjct: 528 ATGYSAAQSLSHQILTEGKPAVDRYINEFLKKGSSNYPIEILKNAGVDMTTPEPIEQACE 587

Query: 615 TVEKMIDDVEKM 626
             E+ ++  EK+
Sbjct: 588 VFEQKLNAFEKL 599


>gi|15923990|ref|NP_371524.1| thimet oligopeptidase-like protein [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|15926589|ref|NP_374122.1| hypothetical protein SA0859 [Staphylococcus aureus subsp. aureus
           N315]
 gi|21282611|ref|NP_645699.1| hypothetical protein MW0882 [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49485776|ref|YP_042997.1| putative oligopeptidase [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|148267433|ref|YP_001246376.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus JH9]
 gi|150393486|ref|YP_001316161.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus JH1]
 gi|156979326|ref|YP_001441585.1| thimet oligopeptidase homologue [Staphylococcus aureus subsp.
           aureus Mu3]
 gi|253316162|ref|ZP_04839375.1| hypothetical protein SauraC_08467 [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|253732642|ref|ZP_04866807.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus TCH130]
 gi|255005789|ref|ZP_05144390.2| hypothetical protein SauraM_04950 [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|257795266|ref|ZP_05644245.1| oligoendopeptidase F [Staphylococcus aureus A9781]
 gi|258406915|ref|ZP_05680068.1| thimet oligopeptidase [Staphylococcus aureus A9763]
 gi|258421883|ref|ZP_05684804.1| oligoendopeptidase F [Staphylococcus aureus A9719]
 gi|258423506|ref|ZP_05686396.1| oligoendopeptidase F [Staphylococcus aureus A9635]
 gi|258441493|ref|ZP_05690853.1| thimet oligopeptidase [Staphylococcus aureus A8115]
 gi|258446973|ref|ZP_05695126.1| oligoendopeptidase F [Staphylococcus aureus A6300]
 gi|258455047|ref|ZP_05703010.1| oligoendopeptidase F [Staphylococcus aureus A5937]
 gi|269202615|ref|YP_003281884.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus ED98]
 gi|282894026|ref|ZP_06302257.1| oligoendopeptidase F [Staphylococcus aureus A8117]
 gi|282916252|ref|ZP_06324014.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus D139]
 gi|282927222|ref|ZP_06334844.1| oligoendopeptidase F [Staphylococcus aureus A10102]
 gi|283770067|ref|ZP_06342959.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus H19]
 gi|295405804|ref|ZP_06815613.1| oligoendopeptidase F [Staphylococcus aureus A8819]
 gi|296275565|ref|ZP_06858072.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus MR1]
 gi|297208366|ref|ZP_06924796.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297245395|ref|ZP_06929266.1| oligoendopeptidase F [Staphylococcus aureus A8796]
 gi|300912442|ref|ZP_07129885.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus TCH70]
 gi|13700804|dbj|BAB42100.1| SA0859 [Staphylococcus aureus subsp. aureus N315]
 gi|14246770|dbj|BAB57162.1| thimet oligopeptidase homologue [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|21204049|dbj|BAB94747.1| MW0882 [Staphylococcus aureus subsp. aureus MW2]
 gi|49244219|emb|CAG42645.1| putative oligopeptidase [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|147740502|gb|ABQ48800.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus JH9]
 gi|149945938|gb|ABR51874.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus JH1]
 gi|156721461|dbj|BAF77878.1| thimet oligopeptidase homologue [Staphylococcus aureus subsp.
           aureus Mu3]
 gi|253729420|gb|EES98149.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus TCH130]
 gi|257789238|gb|EEV27578.1| oligoendopeptidase F [Staphylococcus aureus A9781]
 gi|257841454|gb|EEV65895.1| thimet oligopeptidase [Staphylococcus aureus A9763]
 gi|257842216|gb|EEV66644.1| oligoendopeptidase F [Staphylococcus aureus A9719]
 gi|257846207|gb|EEV70231.1| oligoendopeptidase F [Staphylococcus aureus A9635]
 gi|257852283|gb|EEV76209.1| thimet oligopeptidase [Staphylococcus aureus A8115]
 gi|257854305|gb|EEV77255.1| oligoendopeptidase F [Staphylococcus aureus A6300]
 gi|257862927|gb|EEV85692.1| oligoendopeptidase F [Staphylococcus aureus A5937]
 gi|262074905|gb|ACY10878.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus ED98]
 gi|282319692|gb|EFB50040.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus D139]
 gi|282590911|gb|EFB95986.1| oligoendopeptidase F [Staphylococcus aureus A10102]
 gi|282763512|gb|EFC03641.1| oligoendopeptidase F [Staphylococcus aureus A8117]
 gi|283460214|gb|EFC07304.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus H19]
 gi|285816679|gb|ADC37166.1| Oligoendopeptidase F [Staphylococcus aureus 04-02981]
 gi|294969239|gb|EFG45259.1| oligoendopeptidase F [Staphylococcus aureus A8819]
 gi|296887105|gb|EFH26008.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297177698|gb|EFH36948.1| oligoendopeptidase F [Staphylococcus aureus A8796]
 gi|298694239|gb|ADI97461.1| thimet oligopeptidase [Staphylococcus aureus subsp. aureus ED133]
 gi|300886688|gb|EFK81890.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus TCH70]
 gi|312829396|emb|CBX34238.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus ECT-R 2]
 gi|315130421|gb|EFT86408.1| hypothetical protein CGSSa03_03333 [Staphylococcus aureus subsp.
           aureus CGS03]
 gi|323440846|gb|EGA98554.1| thimet oligopeptidase [Staphylococcus aureus O11]
 gi|329728217|gb|EGG64656.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus 21172]
          Length = 602

 Score =  430 bits (1106), Expect = e-118,   Method: Composition-based stats.
 Identities = 129/612 (21%), Positives = 260/612 (42%), Gaps = 22/612 (3%)

Query: 24  MTTMDSQENLG---NLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
           M+   S+E          W+L  ++   D +      + +E+E    + +++G++     
Sbjct: 1   MSQQLSREEQERKYPEYTWDLTTIFK--DDEAFEAAFKEVENELGK-EEQFKGHIGD--- 54

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
             +  +L  A+   + +   + ++  YA L  + + ++       +  +  +  F     
Sbjct: 55  --SAETLYNALELEDTLGTKLEKVYVYAHLKQDQDTTNDKYTGMESRAHQLIIKFSSAWS 112

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           F   EI  +DE  ++          K++  +K I + + H+L  + E LL++        
Sbjct: 113 FLVPEILQIDEDKIQSFVNSYDKLQKFAFDLKLINEKRPHILDAETEKLLTEAQDALSTP 172

Query: 201 LKRFFCENIESL------RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              +   +   L          N   +      K     DR++R+SA + +   +   ++
Sbjct: 173 SNVYGMFSNADLVFEDAIDKDGNAHPLTQGTFIKYLESDDRKLRESAFRNVYKAYGAHNN 232

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
                     K      R   Y+   +    +N++   V + L+++V  Y     HRY E
Sbjct: 233 TLGATLAGEVKKNVFNARTHNYKTAREKALSNNHIPENVYDNLVKTVHKY-LPLLHRYTE 291

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+K+ L LD +  +D   PL    +  +P+E A++ +L++      +   + ++   + W
Sbjct: 292 LRKELLGLDDLKMYDLYTPLIKDIKFEMPYEEAKEWMLKALEPMGEEYLNVVKEGLNNRW 351

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D  +  GK SG ++ G     +P+ILLN+     D+ TL HE GH  H   S + Q   
Sbjct: 352 VDVYENKGKRSGGYSSGAHL-TNPFILLNWSNTISDLYTLVHEFGHSAHSYFSRKFQPSN 410

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
           +++ ++ +AE AS   E L  D + +     E+R +LL  ++E    ++ RQ  F +FE 
Sbjct: 411 SSDYTIFVAEVASTCNEALLSDYMDKH-LDDEKRLLLLNQELERFRATLFRQTMFAEFEH 469

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
           K+H    +   +   R+NE + +  K   G + + +D +    W  +PHF   ++YVY Y
Sbjct: 470 KIHAIEEAGEPLTPTRMNEEYAKLNKLYFGDSVE-TDEDISKEWSRIPHFY-MNYYVYQY 527

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     SL     +             L+ G+S +  E+L    ++++ P   E+  +
Sbjct: 528 ATGYSAAQSLSHQILTEGKPAVDRYINEFLKKGSSNYPIEILKNAGVDMTTPEPIEQACE 587

Query: 615 TVEKMIDDVEKM 626
             E+ ++  EK+
Sbjct: 588 VFEQKLNAFEKL 599


>gi|283470212|emb|CAQ49423.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus ST398]
          Length = 602

 Score =  430 bits (1106), Expect = e-118,   Method: Composition-based stats.
 Identities = 130/612 (21%), Positives = 260/612 (42%), Gaps = 22/612 (3%)

Query: 24  MTTMDSQENLG---NLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
           M+   S+E          W+L  ++   D +      + +E+E    + +++G++     
Sbjct: 1   MSQQLSREEQERKYPEYTWDLTTIFK--DDEAFEAAFKEVENELGK-EEQFKGHIGD--- 54

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
             +  +L  A+   + +   + ++  YA L  + + ++       +  +  +  F     
Sbjct: 55  --SAETLYNALELEDTLGTKLEKVYVYAHLKQDQDTTNDKYTGMESRAHQLIIKFSSAWS 112

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           F   EI  +DE  ++          K++  +K I + + H+L  + E LL++        
Sbjct: 113 FLVPEILQIDEDKIQSFVNSYDKLQKFAFDLKLINEKRPHILDAETEKLLTEAQDALSTP 172

Query: 201 LKRFFCENIESL------RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              +   +   L          N   +      K     DR++R+SA + +   +   ++
Sbjct: 173 SNVYGMFSNADLVFEDAIDKDGNAHPLTQGTFIKYLESDDRKLRESAFRNVYKAYGAHNN 232

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
                     K      R   Y+   +    +N++   V + L+++V  Y     HRY E
Sbjct: 233 TLGATLAGEVKKNVFNARTHNYKTAREKALSNNHIPENVYDNLVKTVHKY-LPLLHRYTE 291

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+K+ L LD +  +D   PL    +  +P+E A++ +L++      +   + ++   + W
Sbjct: 292 LRKELLGLDDLKMYDLYTPLIKDIKFEMPYEEAKEWMLKALEPMGEEYLNVVKEGLNNRW 351

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D  +  GK SG ++ G     +P+ILLN+     D+ TL HE GH  H   S + Q   
Sbjct: 352 VDVYENKGKRSGGYSSGAHL-TNPFILLNWSNTISDLYTLVHEFGHSAHSYFSRKFQPSN 410

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
           +++ ++ +AE AS   E L  D + +     E+R +LL  ++E    ++ RQ  F +FE 
Sbjct: 411 SSDYTIFVAEVASTCNEALLSDYMDKH-LDDEKRLLLLNQELERFRATLFRQTMFAEFEH 469

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
           K+H    S   +   R+NE + +  K   G + + +D +    W  +PHF   ++YVY Y
Sbjct: 470 KIHAIEESGEPLTPTRMNEEYAKLNKLYFGDSVE-TDEDISKEWSRIPHFY-MNYYVYQY 527

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     SL     +             L+ G+S +  E+L    ++++ P   E+  +
Sbjct: 528 ATGYSAAQSLSHQILTEGKPAVDRYINEFLKKGSSNYPIEILKNAGVDMTTPEPIEQACE 587

Query: 615 TVEKMIDDVEKM 626
             E+ ++  EK+
Sbjct: 588 VFEQKLNAFEKL 599


>gi|284023927|ref|ZP_06378325.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus 132]
          Length = 602

 Score =  430 bits (1106), Expect = e-118,   Method: Composition-based stats.
 Identities = 129/612 (21%), Positives = 260/612 (42%), Gaps = 22/612 (3%)

Query: 24  MTTMDSQENLG---NLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
           M+   S+E          W+L  ++   D +      + +E+E    + +++G++     
Sbjct: 1   MSQQLSREEQERKYPEYTWDLTTIFK--DDEAFEAAFKEVENELGK-EEQFKGHIGD--- 54

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
             +  +L  A+   + +   + ++  YA L  + + ++       +  +  +  F     
Sbjct: 55  --SAETLYNALELEDTLGTKLEKVYVYAHLKQDQDTTNDKYTGMESRAHQLIIKFSSAWS 112

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           F   EI  +DE  ++          K++  +K I + + H+L  + E LL++        
Sbjct: 113 FLVPEILQIDEDKIQSFVNSYDKLQKFAFDLKLINEKRPHILDAETEKLLTEAQDALSTP 172

Query: 201 LKRFFCENIESL------RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              +   +   L          N   +      K     DR++R+SA + +   +   ++
Sbjct: 173 SNVYGMFSNADLVFEDAIDKDGNAHPLTQGTFIKYLETDDRKLRESAFRNVYKAYGAHNN 232

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
                     K      R   Y+   +    +N++   V + L+++V  Y     HRY E
Sbjct: 233 TLGATLAGEVKKNVFNARTHNYKTAREKALSNNHIPENVYDNLVKTVHKY-LPLLHRYTE 291

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+K+ L LD +  +D   PL    +  +P+E A++ +L++      +   + ++   + W
Sbjct: 292 LRKELLGLDDLKMYDLYTPLIKDIKFEMPYEEAKEWMLKALEPMGEEYLNVVKEGLNNRW 351

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D  +  GK SG ++ G     +P+ILLN+     D+ TL HE GH  H   S + Q   
Sbjct: 352 VDVYENKGKRSGGYSSGAHL-TNPFILLNWSNTISDLYTLVHEFGHSAHSYFSRKFQPSN 410

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
           +++ ++ +AE AS   E L  D + +     E+R +LL  ++E    ++ RQ  F +FE 
Sbjct: 411 SSDYTIFVAEVASTCNEALLSDYMDKH-LDDEKRLLLLNQELERFRATLFRQTMFAEFEH 469

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
           K+H    +   +   R+NE + +  K   G + + +D +    W  +PHF   ++YVY Y
Sbjct: 470 KIHAIEEAGEPLTPTRMNEEYAKLNKLYFGGSVE-TDEDISKEWSRIPHFY-MNYYVYQY 527

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     SL     +             L+ G+S +  E+L    ++++ P   E+  +
Sbjct: 528 ATGYSAAQSLSHQILTEGKPAVDRYINEFLKKGSSNYPIEILKNAGVDMTTPEPIEQACE 587

Query: 615 TVEKMIDDVEKM 626
             E+ ++  EK+
Sbjct: 588 VFEQKLNAFEKL 599


>gi|255028527|ref|ZP_05300478.1| hypothetical protein LmonL_03731 [Listeria monocytogenes LO28]
          Length = 564

 Score =  430 bits (1106), Expect = e-118,   Method: Composition-based stats.
 Identities = 131/571 (22%), Positives = 254/571 (44%), Gaps = 16/571 (2%)

Query: 62  HESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTI 121
            +      +++G L+     ++  +L  A+   ++  +LI  +  YA L  + + ++   
Sbjct: 2   QKITEESDQFKGRLS-----ESSQTLYEALQFRDKAYDLISNLYVYAHLKMDQDTANAKY 56

Query: 122 RKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHL 181
           +  ++   + +      L ++  EI  +DE +L+Q   ++     Y   ++ +   + ++
Sbjct: 57  QGLHSRAGSLVTKLMSALSYYDPEILAMDENVLKQFLDENKDLQLYDHLLEELNLSRPYI 116

Query: 182 LSNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDR 235
           LS   E LL++  +V   +   F   N   ++F     +      I   +  K    +D 
Sbjct: 117 LSEKEEALLANAGEVLGSSSNTFNTLNNADMKFPTIKDENGEDIEITHGRFGKLLESNDP 176

Query: 236 EVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIE 295
            VR+ A   +   +    +  +   N   K        R Y    ++    N++   V +
Sbjct: 177 RVRRDAFHGVYSVYEGLKNTLASTLNGQVKKSNFYASTRGYTSAREAALSGNHIPETVYD 236

Query: 296 ALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSY 355
           +L++S  N      HRY +L+K+ L L+ ++ +D   PL         +E A++LVL++ 
Sbjct: 237 SLLKS-VNANASLLHRYVKLRKELLGLEELHMYDLYTPLSDDVNLEFTYEEAKELVLEAL 295

Query: 356 AKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLA 415
                +   I ++ F   WID  +  GK           S +PYILLN+     +V TLA
Sbjct: 296 KPLGDEYQAILKEAFDSRWIDVMENKGKR-SGAYSSGSYSTNPYILLNWQDNINNVYTLA 354

Query: 416 HELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANK 475
           HELGH +H   + + Q  +  + S+ LAE AS   E L  D LL+     + R  LL + 
Sbjct: 355 HELGHSVHSYYTRKNQPFVYGDYSIFLAEVASTTNENLLTDYLLKKYDDPKVRAYLLNHY 414

Query: 476 IEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYG 535
           ++    ++ RQ  F +FE  +H   +    +    + E + +  K+  G A    D E G
Sbjct: 415 LDGFKGTVFRQTQFAEFEHAIHQADQQGVALTADFLTETYFDINKKYYGEAMVY-DAEIG 473

Query: 536 SFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSEL 595
             W  +PHF   ++YV+ YA G    ++L     +   D     Y++ L+AG+S +  ++
Sbjct: 474 YEWSRIPHFY-MNYYVFQYATGFSAASALSAKILTEGQDAVTA-YIDFLKAGSSDYPIDV 531

Query: 596 LLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           L    ++++ PN  +  L+  E+ +D++E++
Sbjct: 532 LKKAGVDMATPNPVDDALKVFEQRLDELEEL 562


>gi|300214244|gb|ADJ78660.1| Oligoendopeptidase F [Lactobacillus salivarius CECT 5713]
          Length = 605

 Score =  430 bits (1106), Expect = e-118,   Method: Composition-based stats.
 Identities = 143/612 (23%), Positives = 270/612 (44%), Gaps = 19/612 (3%)

Query: 21  SSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
                 +  +  +     W+L  ++ S +  E   + + ++ E   F+          T 
Sbjct: 3   EKKAKRLLQRNEVPEELTWDLTKVFKSDE--EFEKEYQAVKDEVQNFRKL------QGTM 54

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
            +        I  +  I     ++  YA +  + + ++   + +   ++A  A+F + + 
Sbjct: 55  DQGSQRFLQIIENFLSINRKFEKVYVYASMKNDQDTTNAKYQGYNEMVDALAAEFSESIS 114

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           +F  E+  LDE  L+Q + +     +Y   I+++  ++KH L    E LL+  S +   +
Sbjct: 115 WFEPELLELDEDKLKQYFVEKKELKQYEHLIESMLVMRKHTLDKKSESLLAGASDIFGTS 174

Query: 201 LKRFFCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              F   N   L+F I         ++      K    ++R+VRK+A K L   +++  H
Sbjct: 175 QNVFGILNNADLKFPIVKDDNGDDIQLSHGVYGKLIESTNRKVRKAAFKGLYSVYDQFKH 234

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
             +       K    + R R Y+   ++   SN++   V + L+    +      HRY +
Sbjct: 235 TMATTLIGNVKVHNFKARVRNYKDAREAATTSNHIPTEVYDVLL-EQVHKNLPLLHRYVK 293

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+KK L +D ++ +D   PL   S+    +  A+    ++             + F + W
Sbjct: 294 LRKKILGVDELHMYDMYTPLTEDSKLTYNYIQAQIEAKKALEVLGMDYLTHVSEAFENRW 353

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           ID  +  GK SGA++ G   +  PYILLN+    +++ TL HE+GH +H   +S  Q   
Sbjct: 354 IDVVENKGKRSGAYSSGVYDTP-PYILLNWQDNLENLFTLVHEMGHSMHSYYTSHNQPYQ 412

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
             +  + LAE AS   E +  D LL+    KE    +L + ++    ++ RQ  F +FE 
Sbjct: 413 YGDYPIFLAEIASTTNENILTDYLLKNNDEKEILIYILNHYLDGFKGTVYRQTQFAEFEK 472

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
            +H +      +    I+E +LE  K+  G    +SD E    W  +PHF   +FYVY Y
Sbjct: 473 WIHEQNSKGVPLTAKSISEYYLELNKKYYGNDV-VSDPEIALEWARIPHFY-YNFYVYQY 530

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     +L +   S   +    KYL  L+AG+SK+  E++    ++++D ++ E+  +
Sbjct: 531 ATGFAAATTLAENILS-GDENKLNKYLTYLKAGSSKYPLEVMKDAGVDMTDSSYLEKAFK 589

Query: 615 TVEKMIDDVEKM 626
             E+ ++ +E +
Sbjct: 590 VFEERLNQLETL 601


>gi|255279844|ref|ZP_05344399.1| oligoendopeptidase F [Bryantella formatexigens DSM 14469]
 gi|255269617|gb|EET62822.1| oligoendopeptidase F [Bryantella formatexigens DSM 14469]
          Length = 615

 Score =  430 bits (1106), Expect = e-118,   Method: Composition-based stats.
 Identities = 148/604 (24%), Positives = 265/604 (43%), Gaps = 20/604 (3%)

Query: 29  SQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG 88
            +        WN++D+Y + +   ++ D+E +      F +R        +  K+   L 
Sbjct: 20  KRCEQKIEDTWNMQDMYENEEL--MAQDVEKLRELMKEFASR------QNSLAKSGEQLL 71

Query: 89  AAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINT 148
            A+   E +  L  ++  YA   Y+ + +    +K   ++     +      +   E+  
Sbjct: 72  RALKLQEEMNCLYEKLHVYANQKYHEDTAEAKYQKLSGEMQILGTELSGCTAWLEPELLA 131

Query: 149 LDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCEN 208
           L +  L + +A+ P    Y   ++ I + ++H+L    E LL+  S++G+     F   N
Sbjct: 132 LPQQKLAEFFAETPELADYRWVVEQIVRQREHVLDVQTEELLAKLSELGQAPANIFSMFN 191

Query: 209 IESLRFKI------NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNT 262
              +RF        N   +          DSDR +R+SA  AL   + +  +  +     
Sbjct: 192 NADIRFPDAVDSAGNAHPLTQGNYIPMLKDSDRVLRRSAFTALYGVYAQYCNTLAATYYA 251

Query: 263 LAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKL 322
            AK  +I  +  K+    +    +N +   V E L+++++  +    HRY  L+KK L L
Sbjct: 252 NAKQADIFAKQHKFAGAMEQALSANAIPMAVYENLVKTIRE-HLPLMHRYTGLRKKMLGL 310

Query: 323 DTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDG 382
           D ++ +D   P+    Q   PF  A+++V ++ A      + + ++ F + WID  + +G
Sbjct: 311 DELHMYDNYVPIVEMPQKKYPFAEAKEIVKKALAPLGEDYTALLQEGFDNRWIDVYENEG 370

Query: 383 KGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTL 442
           K +GA++ G     HPY+LLNY G    V TLAHE+GH +H   S   Q        + +
Sbjct: 371 KRTGAYSWG-AYGTHPYVLLNYQGTLNAVFTLAHEMGHALHSWHSDHRQPYRYAGYRIFV 429

Query: 443 AETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTER-R 501
           AE AS   E L    LL+ +S + ER  L+   ++    ++ RQ  F +FE+  H +  +
Sbjct: 430 AEVASTCNEALLIHYLLENSSDETERNYLINYFLDQFKGTMYRQTMFAEFEMMTHRDIVQ 489

Query: 502 STGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLV 561
             G +   ++  I+ +  K+  G    +SD E    W  +PHF  + FYVY YA G    
Sbjct: 490 EGGVLTAEKLCGIYHKLNKDYFGEQM-VSDEEIQYEWARIPHFY-TPFYVYQYATGFAAA 547

Query: 562 NSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMID 621
            ++             EKY   L  G+S    +LL    +++S P      L+  E+ + 
Sbjct: 548 IAISSKIL-AGEPGIVEKYKEFLSGGSSMDPIDLLKICGVDMSSPEPVAAALRVFEEYLG 606

Query: 622 DVEK 625
            +EK
Sbjct: 607 MLEK 610


>gi|300710280|ref|YP_003736094.1| oligoendopeptidase F [Halalkalicoccus jeotgali B3]
 gi|299123963|gb|ADJ14302.1| oligoendopeptidase F [Halalkalicoccus jeotgali B3]
          Length = 596

 Score =  430 bits (1105), Expect = e-118,   Method: Composition-based stats.
 Identities = 130/609 (21%), Positives = 259/609 (42%), Gaps = 20/609 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           M+++  +E +     W+LE +Y S D  E     E +       +  +EG+       + 
Sbjct: 1   MSSIPEREEIATEYTWDLESIYASDDDWE--AAYESLSERIPELEA-YEGH-----TTEG 52

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
             +L   ++  E +   + ++A+YA +  + +      +       +  ++    + F  
Sbjct: 53  GETLYELLSLREDVMRDLSQVAAYARMRRDEDTRDQEYQALTARAQSLASEASSAVSFLE 112

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            E+  L E  L++   ++P   +Y  +  ++ ++K H  S ++E LL++  ++   + + 
Sbjct: 113 PELQDLSEDELDELIDEEPALAEYDHYFDDVLRMKPHTRSAEVEALLAELGEITGASGEI 172

Query: 204 FFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           +   +   + F   +        I      K   + +R  R+   +A   T+ +  +   
Sbjct: 173 YTMLSNADMEFPTVEDPDGEAVEITQANFTKLQKNPNRTFRREVYEAFYDTWEEVRNAVG 232

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
                  K +    R R Y+   ++     N+   V + L+ +V+       HR+ +LK+
Sbjct: 233 TSYKNSVKADVKLARARNYDTAREAALDGPNIPVEVYDNLVDTVREN-LDALHRHSDLKR 291

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           K L +D +  WD   P+  +    I ++ A + V+++ A           +     W+D 
Sbjct: 292 KALDVDELRMWDLYMPVAQSESPDIGYDEAAEHVVEAVAPLGEDYQSRVAEGLDSRWVDV 351

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK +GA++ GT     P+IL+NY      + TLAHE GH +H  L+SE Q    + 
Sbjct: 352 YENAGKQAGAYSGGTYD-TQPFILMNYQDDIPSMYTLAHEFGHSLHSQLTSEHQPYTYSG 410

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
             + +AE AS   E L    LL+    +  R  +L   +E   +++ RQ  F +FE + H
Sbjct: 411 YEIFVAEVASTVNEALLTHHLLETVEDERFRLHVLNEYLERFRSTLYRQTMFAEFEHRAH 470

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
                 G +    ++E++ E + +   PA    D      WM +PHF  + +YVY Y+ G
Sbjct: 471 EIDEEGGALTPDALDELYGELKADFYDPAVV--DDRIAREWMRIPHFYRA-YYVYQYSTG 527

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                SL             + Y   LR+G++++  ELL    +++  P   E  L   +
Sbjct: 528 ISAAVSLSKRILEEGESAAAD-YREFLRSGSTEYPLELLDIAGVDMRSPEPIEDALAVYD 586

Query: 618 KMIDDVEKM 626
           + + ++E +
Sbjct: 587 EYLGEMESL 595


>gi|313904497|ref|ZP_07837873.1| oligoendopeptidase F [Eubacterium cellulosolvens 6]
 gi|313470639|gb|EFR65965.1| oligoendopeptidase F [Eubacterium cellulosolvens 6]
          Length = 608

 Score =  430 bits (1105), Expect = e-118,   Method: Composition-based stats.
 Identities = 138/609 (22%), Positives = 243/609 (39%), Gaps = 21/609 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
              +  +  +    +W+L  LY    + E   ++E            ++G L      K+
Sbjct: 2   AELLKERSEIAEEFKWDLTKLYADDGAWE--KELENFGQLVDR-AASYQGKL------KD 52

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
             ++   +     +  ++  + +YA L  + +      +  Y  I ++     +   F  
Sbjct: 53  AENIRKYLDAATELERMLSNLFAYASLRKSEDTREEAAQSLYARIYSRYVQAVQATAFAD 112

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            EI  LDE  L ++ A+DPL   Y   +  + + K H L+   E LL+   +V     + 
Sbjct: 113 PEILLLDEETL-KAVAEDPLLADYKYPMTKLIRQKAHTLTAPEEKLLAGFGEVFAAPREA 171

Query: 204 FFCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
                   + F           ++  +         DR +RK+A  +    +    + F+
Sbjct: 172 ASNLQNADMVFASCKDGEGRDTEVTGSNYILLQSSKDRVLRKNAFMSYYDGYRHHINTFA 231

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
                  K    +   R +            V   V + L+ SV+ +     +RY  L+K
Sbjct: 232 ATYAGCVKKAAAEAAARHFASSRQMYTFYEGVPELVYDNLIASVRKFM-PEMYRYVRLRK 290

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           K L +D ++++D  APL         +  A+ +VL +      +   +  K F   WID 
Sbjct: 291 KLLGVDELHYYDLYAPLSDGVTKTYTYPEAKQMVLDAVRPLGEEYGKVVRKGFEERWIDV 350

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
               GK  GAF+ GT  SV PYIL N++G    V T+AHE+GH +H   S+  Q      
Sbjct: 351 YPNKGKRGGAFSEGTYDSV-PYILSNFVGTLDSVSTIAHEMGHSMHTWYSNHAQLPQNAE 409

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
            ++ +AE AS   E L  + LL   +  +ER  LL   +E    ++ RQ  F +FE + H
Sbjct: 410 YTIFVAEVASTVNENLLIEQLLSDCTDPKERMALLNQYLEGFKGTVYRQTMFAEFEKEAH 469

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
                   +    +N ++    +E  GP   + D E    W  +PHF  + FYVY YA  
Sbjct: 470 AMAERGEALSAGALNALYRRLIEEYFGPDLVVDD-EVDMEWARIPHFY-TPFYVYKYATS 527

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                ++ +   +       +KYL  L  G S+   E L    ++L      +  L+   
Sbjct: 528 YSAAVAVSEAVLAQGEPAV-KKYLEFLSLGGSQDPLEELKHAGVDLGTSAPIDAALEKFG 586

Query: 618 KMIDDVEKM 626
           +++D+ E +
Sbjct: 587 RVLDEAEAL 595


>gi|258435281|ref|ZP_05689020.1| thimet oligopeptidase [Staphylococcus aureus A9299]
 gi|257848942|gb|EEV72925.1| thimet oligopeptidase [Staphylococcus aureus A9299]
          Length = 602

 Score =  430 bits (1105), Expect = e-118,   Method: Composition-based stats.
 Identities = 129/612 (21%), Positives = 260/612 (42%), Gaps = 22/612 (3%)

Query: 24  MTTMDSQENLG---NLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
           M+   S+E          W+L  ++   D +      + +E+E    + +++G++     
Sbjct: 1   MSQQLSREEQERKYPEYTWDLTTIFK--DDEAFEAAFKEVENELGK-EEQFKGHIGD--- 54

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
             +  +L  A+   + +   + ++  YA L  + + ++       +  +  +  F     
Sbjct: 55  --SAETLYNALELEDTLGTKLEKVYVYAHLKQDQDTTNDKYTGMESRAHQLIIKFSSAWS 112

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           F   EI  +DE  ++          K++  +K I + + H+L  + E LL++        
Sbjct: 113 FLVPEILQIDEDKIQSFVNSYDKLQKFAFDLKLINEKRPHILDAETEKLLTEAQDALSTP 172

Query: 201 LKRFFCENIESL------RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              +   +   L          N   +      K     DR++R+SA + +   +   ++
Sbjct: 173 SNVYGMFSNADLVFEDAIDKDRNAHPLTQGTFIKYLESDDRKLRESAFRNVYKAYGAHNN 232

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
                     K      R   Y+   +    +N++   V + L+++V  Y     HRY E
Sbjct: 233 TLGATLAGEVKKNVFNARTHNYKTAREKALSNNHIPENVYDNLVKTVHKY-LPLLHRYTE 291

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+K+ L LD +  +D   PL    +  +P+E A++ +L++      +   + ++   + W
Sbjct: 292 LRKELLGLDDLKMYDLYTPLIKDIKFEMPYEEAKEWMLKALEPMGEEYLNVVKEGLNNRW 351

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D  +  GK SG ++ G     +P+ILLN+     D+ TL HE GH  H   S + Q   
Sbjct: 352 VDVYENKGKRSGGYSSGAHL-TNPFILLNWSNTISDLYTLVHEFGHSAHSYFSRKFQPSN 410

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
           +++ ++ +AE AS   E L  D + +     E+R +LL  ++E    ++ RQ  F +FE 
Sbjct: 411 SSDYTIFVAEVASTCNEALLSDYMDKH-LDDEKRLLLLNQELERFRATLFRQTMFAEFEH 469

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
           K+H    +   +   R+NE + +  K   G + + +D +    W  +PHF   ++YVY Y
Sbjct: 470 KIHAIEEAGEPLTPTRMNEEYAKLNKLYFGDSVE-TDEDISKEWSRIPHFY-MNYYVYQY 527

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     SL     +             L+ G+S +  E+L    ++++ P   E+  +
Sbjct: 528 ATGYSAAQSLSHQILTEGKPAVDRYINEFLKKGSSNYPIEILKNAGVDMTTPEPIEQACE 587

Query: 615 TVEKMIDDVEKM 626
             E+ ++  EK+
Sbjct: 588 VFEQKLNAFEKL 599


>gi|227891654|ref|ZP_04009459.1| oligoendopeptidase F [Lactobacillus salivarius ATCC 11741]
 gi|227866570|gb|EEJ73991.1| oligoendopeptidase F [Lactobacillus salivarius ATCC 11741]
          Length = 620

 Score =  430 bits (1105), Expect = e-118,   Method: Composition-based stats.
 Identities = 143/612 (23%), Positives = 270/612 (44%), Gaps = 19/612 (3%)

Query: 21  SSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
                 +  +  +     W+L  ++ S +  E   + + ++ E   F+          T 
Sbjct: 18  EKKAKRLLQRNEVPEELTWDLTKVFKSDE--EFEKEYQTVKDEVQNFRKL------QGTM 69

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
            +        I  +  I     ++  YA +  + + ++   + +   ++A  A+F + + 
Sbjct: 70  DQGSQRFLQIIENFLSINRKFEKVYVYASMRNDQDTTNAKYQGYNEMVDALAAEFSESIS 129

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           +F  E+  LDE  L+Q + +     +Y   I+++  ++KH L    E LL+  S +   +
Sbjct: 130 WFEPELLELDEDKLKQYFVEKKELKQYEHLIESMLVMRKHTLDKKSESLLAGASDIFGTS 189

Query: 201 LKRFFCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              F   N   L+F I         ++      K    ++R+VRK+A K L   +++  H
Sbjct: 190 QNVFGILNNADLKFPIVKDDNGDDIQLSHGVYGKLIESTNRKVRKAAFKGLYSVYDQFKH 249

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
             +       K    + R R Y+   ++   SN++   V + L+    +      HRY +
Sbjct: 250 TMATTLIGNVKVHNFKARVRNYKDAREAATTSNHIPTEVYDVLL-EQVHKNLPLLHRYVK 308

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+KK L +D ++ +D   PL   S+    +  A+    ++             + F + W
Sbjct: 309 LRKKILGVDELHMYDMYTPLTEDSKLTYNYIQAQIEAKKALEVLGMDYLTHVSEAFENRW 368

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           ID  +  GK SGA++ G   +  PYILLN+    +++ TL HE+GH +H   +S  Q   
Sbjct: 369 IDVVENKGKRSGAYSSGVYDTP-PYILLNWQDNLENLFTLVHEMGHSMHSYYTSHNQPYQ 427

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
             +  + LAE AS   E +  D LL+    KE    +L + ++    ++ RQ  F +FE 
Sbjct: 428 YGDYPIFLAEIASTTNENILTDYLLKNNDEKEILIYILNHYLDGFKGTVYRQTQFAEFEK 487

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
            +H +      +    I+E +LE  K+  G    +SD E    W  +PHF   +FYVY Y
Sbjct: 488 WIHEQNSKGVPLTAKSISEYYLELNKKYYGNDV-VSDPEIALEWARIPHFY-YNFYVYQY 545

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     +L +   S   +    KYL  L+AG+SK+  E++    ++++D ++ E+  +
Sbjct: 546 ATGFAAATTLAENILS-GDENKLNKYLTYLKAGSSKYPLEVMKDAGVDMTDSSYLEKAFK 604

Query: 615 TVEKMIDDVEKM 626
             E+ ++ +E +
Sbjct: 605 VFEERLNQLETL 616


>gi|168186767|ref|ZP_02621402.1| oligoendopeptidase F [Clostridium botulinum C str. Eklund]
 gi|169295366|gb|EDS77499.1| oligoendopeptidase F [Clostridium botulinum C str. Eklund]
          Length = 596

 Score =  429 bits (1104), Expect = e-118,   Method: Composition-based stats.
 Identities = 141/609 (23%), Positives = 268/609 (44%), Gaps = 20/609 (3%)

Query: 22  SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQ 81
           ++ T +  +  +    +W++E +Y + ++ E   D   +   +   K +++G L+     
Sbjct: 2   NESTKIKIRYEIMPQDKWDIEKVYSNTENWE--QDFNKLTEMAQELK-KFQGKLS----- 53

Query: 82  KNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIF 141
            +   L   +   E +  L  ++  YA L  + + ++   +   + I    ++   +  +
Sbjct: 54  -DPKKLLGFLKLDEEVSRLGEKLLVYAFLKADEDTANNKNQALKSKIEGYFSELASMGAY 112

Query: 142 FALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREAL 201
           F  EI +  + +++ +  + P    Y   I  I K K H LS +ME +L+  S       
Sbjct: 113 FVPEILSYPKEVIKNAIDEIPELKMYELMIDRILKKKPHTLSKEMEEMLASVSDALNAPS 172

Query: 202 KRFFCENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHI 255
             F       + F     +      +            DR VRK A +AL +T+    + 
Sbjct: 173 NIFSILTNADMTFPKIKDENGNEVELTEGNYSVFIKSKDRRVRKEAFEALFNTYYHFKNT 232

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
            +       K+     + R Y    +S    N++   V + +++++ N    + HRY ++
Sbjct: 233 IATSLTASIKNFSFLAKKRNYSSSIESSLEPNDIPVEVYDNVIKTI-NDNLDSLHRYVKI 291

Query: 316 KKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWI 375
           KKK L LD ++ +D   P+  T ++ I F  A  +V ++      +   I  +   + WI
Sbjct: 292 KKKLLALDEIHMYDLYVPIIDTPKEHIEFSKAVSMVNEALRPLGEEYLNIFNEGIKNRWI 351

Query: 376 DAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILT 435
           D  +  GK  GA++ GT  ++ PY+LLNY  +  DV TLAHE+GH IH   S + Q  + 
Sbjct: 352 DIYENKGKRKGAYSWGTYDTM-PYVLLNYNYELNDVSTLAHEMGHSIHSYYSRKEQPYIY 410

Query: 436 NNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELK 495
            N +L  AE AS   E L  + L++    K ++  L+  ++E +  ++ RQ+ F +FE  
Sbjct: 411 ANYTLFCAEVASTVNENLLINDLIKKEKDKNKKLYLINTQLEQIRTTVFRQVMFAEFEKI 470

Query: 496 LHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYA 555
            H +      + +  + +I+ +   +  G    + D E    W  +PHF  S FYVY YA
Sbjct: 471 THEKIDKGVPLTSEDLCKIYRDLNVKYFGKDMII-DKEVDMEWARIPHFY-SDFYVYQYA 528

Query: 556 FGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQT 615
            G    NS       +  +   +KY   L+AG S +   +L    ++++ P   +  +  
Sbjct: 529 TGYSAANSFVKQILESGEEGV-KKYKGFLKAGGSDYPINILKQAGVDMTTPKPIQDTINR 587

Query: 616 VEKMIDDVE 624
             +++D +E
Sbjct: 588 FNELLDMLE 596


>gi|225390440|ref|ZP_03760164.1| hypothetical protein CLOSTASPAR_04193 [Clostridium asparagiforme
           DSM 15981]
 gi|225043496|gb|EEG53742.1| hypothetical protein CLOSTASPAR_04193 [Clostridium asparagiforme
           DSM 15981]
          Length = 612

 Score =  429 bits (1104), Expect = e-118,   Method: Composition-based stats.
 Identities = 136/612 (22%), Positives = 249/612 (40%), Gaps = 19/612 (3%)

Query: 21  SSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
              +  M  +        W LED+ P + + E     E        +   + G LA    
Sbjct: 14  ERRVQAMKKRSEADMNHTWKLEDMMPDNQTWEAL--FEKTAARVKQY-GEFRGTLA---- 66

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
            ++  +L   +   + I   I R+  YA +  + + +  T +  +  + +   +  +   
Sbjct: 67  -ESADALYRCLKFDDGISLDIERLYVYARMRSDEDTAEQTYQDMFGRVQSLSFEAAERSS 125

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           F   EI  +D ALL      +     Y   ++ I   ++H LS  ME LL+ +    + A
Sbjct: 126 FIVPEILEMDPALLASYMESENGIGLYRRLMERILGKREHTLSGPMEELLAQSYDATQGA 185

Query: 201 LKRFFCENIESLRFKI------NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
            + F   N   ++F         +  I            DR +R+ A   L   + +  +
Sbjct: 186 SQIFNMFNNADVKFPSITGENGQEVPITHGNYISLMEHKDRRIRRDAFLGLYSVYRQFRN 245

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
             +   +   K      + R Y          N V   V + L+ +V+       HRY +
Sbjct: 246 TLAAAFSANVKQAVFYAKARNYASSRQHSLAENEVPELVYDNLVAAVRKN-LPLLHRYVK 304

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           ++K+ L L+ ++ +D   P+         +E A+ +V +  A    +   I  + F + W
Sbjct: 305 VRKETLGLNDIHMYDLYVPMVAEFDRTYTYEEAKAIVTEGLAPLGEEYGKILREGFENRW 364

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D  + +GK SGA++ G     HPY+LLN+ G   DV TLAHE+GH IH   S   Q  +
Sbjct: 365 VDVYENEGKRSGAYSWGV-YGSHPYVLLNFHGTLNDVFTLAHEMGHSIHSYYSDAAQPYV 423

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
                + +AE AS   E L    LL      +E++ L+ + +E    ++ RQ  F +FE 
Sbjct: 424 YAGYKIFVAEVASTCNEALLIRHLLNRTEETQEKRYLINHFLESFRGTLFRQTMFAEFEA 483

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
             H + +    +    + E++ +  ++  GP   + D E    W  +PHF  + FYVY Y
Sbjct: 484 ASHRKAQEGETLTASALGELYHKLNEDYFGPEMVV-DPEIDYEWERIPHFY-TPFYVYQY 541

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     ++     S   +     Y   L+ G S    +LL    +++S     +  L+
Sbjct: 542 ATGFSAAVAISSRILS-GDEAALAGYKKFLQGGCSLPPIDLLKLCGVDMSTTKPVDEALK 600

Query: 615 TVEKMIDDVEKM 626
              +++++  ++
Sbjct: 601 VFGELVEEFCRL 612


>gi|251810362|ref|ZP_04824835.1| oligoendopeptidase F [Staphylococcus epidermidis BCM-HMP0060]
 gi|282875506|ref|ZP_06284377.1| oligoendopeptidase F [Staphylococcus epidermidis SK135]
 gi|293367019|ref|ZP_06613693.1| oligoendopeptidase F [Staphylococcus epidermidis M23864:W2(grey)]
 gi|251806099|gb|EES58756.1| oligoendopeptidase F [Staphylococcus epidermidis BCM-HMP0060]
 gi|281295533|gb|EFA88056.1| oligoendopeptidase F [Staphylococcus epidermidis SK135]
 gi|291318874|gb|EFE59246.1| oligoendopeptidase F [Staphylococcus epidermidis M23864:W2(grey)]
 gi|329729820|gb|EGG66213.1| oligoendopeptidase F [Staphylococcus epidermidis VCU144]
 gi|329733383|gb|EGG69716.1| oligoendopeptidase F [Staphylococcus epidermidis VCU028]
 gi|329738114|gb|EGG74332.1| oligoendopeptidase F [Staphylococcus epidermidis VCU045]
          Length = 602

 Score =  429 bits (1104), Expect = e-118,   Method: Composition-based stats.
 Identities = 131/612 (21%), Positives = 259/612 (42%), Gaps = 22/612 (3%)

Query: 24  MTTMDSQENLG---NLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
           M+   ++E          W+L  ++ S ++       + IE +    + +++G+L     
Sbjct: 1   MSQQLTREEQERKYPEYTWDLTTIFKSDEA--FEEAFKSIEAKIGE-EEKFKGHLG---- 53

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
            ++  +L  A++  + +   + ++  YA L  + + ++          +  +  +     
Sbjct: 54  -ESAETLYEALSLEDELGTKLEKVYVYAHLKQDQDTANDKYTGLEARAHQLVIKYSSAWS 112

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           F   EI  LDEA ++     +    +Y   +K I + + H+L  + E LL++        
Sbjct: 113 FLVPEILQLDEATIQSFIDSNDDLKRYEFDLKLINEKRPHILDANTEKLLTEAQDALSTP 172

Query: 201 LKRFFCENIESLRFKI------NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              +   +   L F+           +      K     DRE+R SA + +   +   ++
Sbjct: 173 SNVYGMFSNADLEFEDAIDKDGQAYPLTQGTFIKYLESDDRELRASAFRNVYKAYGAHNN 232

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
                     K      R   Y    +    +N++   V + L+++V  Y     HRY +
Sbjct: 233 TLGATLAGEVKKNVFNARTHHYRSARERALSNNHIPEAVYDNLIKTVHKY-LPLLHRYTK 291

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+++ L LD +  +D   PL    +  +P+E A+  +L++      +   + ++   + W
Sbjct: 292 LRQELLGLDDLKMYDLYTPLVKDVKFEMPYEEAKSWMLKALEPMGEEYLNVVKEGLDNRW 351

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D  +  GK SG ++ G     +P+ILLN+     D+ TL HE GH  H   S + Q   
Sbjct: 352 VDVYENKGKRSGGYSSGGHL-TNPFILLNWSDTVSDLYTLVHEFGHSAHSYFSRQNQPSN 410

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
            ++ ++ +AE AS   E L  D + +     E R +LL  ++E    ++ RQ  F +FE 
Sbjct: 411 LSDYTIFVAEVASTCNEALLSDYMDKHLD-DERRLLLLNQELERFRATLFRQTMFAEFEH 469

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
           K+H    +   +  +R+NE + +  K   G A + +D +    W  +PHF   ++YVY Y
Sbjct: 470 KIHQIEEAGEPLTPNRMNEEYAKLNKLYFGEAVE-TDDDISKEWSRIPHFY-MNYYVYQY 527

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     SL     +      +      L+ G+S +  E+L    ++++ P   E   +
Sbjct: 528 ATGYSAAQSLSHQILTEGQPAVERYINEFLKKGSSNYPIEILKNAGVDMTTPQPIEEACE 587

Query: 615 TVEKMIDDVEKM 626
             E+ +D  EK+
Sbjct: 588 VFEQKLDAFEKL 599


>gi|242242278|ref|ZP_04796723.1| oligoendopeptidase F [Staphylococcus epidermidis W23144]
 gi|242234294|gb|EES36606.1| oligoendopeptidase F [Staphylococcus epidermidis W23144]
 gi|319401734|gb|EFV89942.1| oligoendopeptidase F [Staphylococcus epidermidis FRI909]
          Length = 602

 Score =  429 bits (1104), Expect = e-118,   Method: Composition-based stats.
 Identities = 131/612 (21%), Positives = 259/612 (42%), Gaps = 22/612 (3%)

Query: 24  MTTMDSQENLG---NLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
           M+   ++E          W+L  ++ S ++       + IE +    + +++G+L     
Sbjct: 1   MSQQLTREEQERKYPEYTWDLTTIFKSDEA--FEEAFKSIEAKIGE-EEKFKGHLG---- 53

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
            ++  +L  A++  + +   + ++  YA L  + + ++          +  +  +     
Sbjct: 54  -ESAETLYEALSLEDELGTKLEKVYVYAHLKQDQDTANDKYTGLEARAHQLVIKYSSAWS 112

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           F   EI  LDEA ++     +    +Y   +K I + + H+L  + E LL++        
Sbjct: 113 FLVPEILQLDEATIQSFIDSNDDLKRYEFDLKLINEKRPHILDANTEKLLTEAQDALSTP 172

Query: 201 LKRFFCENIESLRFKI------NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              +   +   L F+           +      K     DRE+R SA + +   +   ++
Sbjct: 173 SNVYGMFSNADLEFEDAIDKDGQAYPLTQGTFIKYLESDDRELRASAFRNVYKAYGAHNN 232

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
                     K      R   Y    +    +N++   V + L+++V  Y     HRY +
Sbjct: 233 TLGATLAGEVKKNVFNARTHHYRSARERALSNNHIPEAVYDNLIKTVHKY-LPLLHRYTK 291

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+++ L LD +  +D   PL    +  +P+E A+  +L++      +   + ++   + W
Sbjct: 292 LRQELLGLDDLKMYDLYTPLVKDVKFEMPYEEAKSWMLKALEPMGEEYLNVVKEGLDNRW 351

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D  +  GK SG ++ G     +P+ILLN+     D+ TL HE GH  H   S + Q   
Sbjct: 352 VDVYENKGKRSGGYSSGGHL-TNPFILLNWSDTVSDLYTLVHEFGHSAHSYFSRQNQPSN 410

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
            ++ ++ +AE AS   E L  D + +     E R +LL  ++E    ++ RQ  F +FE 
Sbjct: 411 LSDYTIFVAEVASTCNEALLSDYMDKHLD-DERRLLLLNQELERFRATLFRQTMFAEFEH 469

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
           K+H    +   +  +R+NE + +  K   G A + +D +    W  +PHF   ++YVY Y
Sbjct: 470 KIHQIEEAGEPLTPNRMNEEYAKLNKLYFGEAVE-TDEDISKEWSRIPHFY-MNYYVYQY 527

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     SL     +      +      L+ G+S +  E+L    ++++ P   E   +
Sbjct: 528 ATGYSAAQSLSHQILTEGQPAVERYINEFLKKGSSNYPIEILKNAGVDMTTPQPIEEACE 587

Query: 615 TVEKMIDDVEKM 626
             E+ +D  EK+
Sbjct: 588 VFEQKLDAFEKL 599


>gi|49483163|ref|YP_040387.1| oligopeptidase [Staphylococcus aureus subsp. aureus MRSA252]
 gi|257425051|ref|ZP_05601477.1| thimet oligopeptidase [Staphylococcus aureus subsp. aureus 55/2053]
 gi|257427715|ref|ZP_05604113.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257430350|ref|ZP_05606732.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257433054|ref|ZP_05609412.1| thimet oligopeptidase [Staphylococcus aureus subsp. aureus E1410]
 gi|257435951|ref|ZP_05611998.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus M876]
 gi|282903547|ref|ZP_06311435.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus C160]
 gi|282905321|ref|ZP_06313176.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282908294|ref|ZP_06316125.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282910578|ref|ZP_06318381.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus WBG10049]
 gi|282913774|ref|ZP_06321561.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus M899]
 gi|282918699|ref|ZP_06326434.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus C427]
 gi|282923807|ref|ZP_06331483.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus C101]
 gi|283957744|ref|ZP_06375195.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|293500812|ref|ZP_06666663.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus 58-424]
 gi|293509767|ref|ZP_06668476.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus M809]
 gi|293526353|ref|ZP_06671038.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus M1015]
 gi|295427489|ref|ZP_06820121.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|297591562|ref|ZP_06950200.1| M03 oligoendopeptidase F [Staphylococcus aureus subsp. aureus MN8]
 gi|49241292|emb|CAG39973.1| putative oligopeptidase [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|257272027|gb|EEV04159.1| thimet oligopeptidase [Staphylococcus aureus subsp. aureus 55/2053]
 gi|257274556|gb|EEV06043.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257278478|gb|EEV09097.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257281147|gb|EEV11284.1| thimet oligopeptidase [Staphylococcus aureus subsp. aureus E1410]
 gi|257284233|gb|EEV14353.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus M876]
 gi|282313779|gb|EFB44171.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus C101]
 gi|282316509|gb|EFB46883.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus C427]
 gi|282321842|gb|EFB52166.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus M899]
 gi|282325183|gb|EFB55492.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus WBG10049]
 gi|282327959|gb|EFB58241.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282330613|gb|EFB60127.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282595165|gb|EFC00129.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus C160]
 gi|283789893|gb|EFC28710.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|290920425|gb|EFD97488.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus M1015]
 gi|291095817|gb|EFE26078.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus 58-424]
 gi|291467217|gb|EFF09734.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus M809]
 gi|295127847|gb|EFG57481.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|297576448|gb|EFH95164.1| M03 oligoendopeptidase F [Staphylococcus aureus subsp. aureus MN8]
 gi|312438627|gb|ADQ77698.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus TCH60]
 gi|315193660|gb|EFU24055.1| putative oligopeptidase [Staphylococcus aureus subsp. aureus CGS00]
          Length = 602

 Score =  429 bits (1104), Expect = e-118,   Method: Composition-based stats.
 Identities = 129/612 (21%), Positives = 260/612 (42%), Gaps = 22/612 (3%)

Query: 24  MTTMDSQENLG---NLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
           M+   S+E          W+L  ++   D +      + +E+E    + +++G++     
Sbjct: 1   MSQQLSREEQERKYPEYTWDLTTIFK--DDEAFEAAFKEVENELGK-EEQFKGHIGD--- 54

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
             +  +L  A+   + +   + ++  YA L  + + ++       +  +  +  F     
Sbjct: 55  --SAETLYNALELEDTLGTKLEKVYVYAHLKQDQDTTNDKYTGMESRAHQLIIKFSSAWS 112

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           F   EI  +DE  ++          K++  +K I + + H+L  + E LL++        
Sbjct: 113 FLVPEILQIDEDKIQSFVNSYDKLQKFAFDLKLINEKRPHILDAETEKLLTEAQDALSTP 172

Query: 201 LKRFFCENIESL------RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              +   +   L          N   +      K     DR++R+SA + +   +   ++
Sbjct: 173 SNVYGMFSNADLVFEDAIDKDENAHPLTQGTFIKYLESDDRKLRESAFRNVYKAYGAHNN 232

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
                     K      R   Y+   +    +N++   V + L+++V  Y     HRY E
Sbjct: 233 TLGATLAGEVKKNVFNARTHNYKTAREKALSNNHIPENVYDNLVKTVHKY-LPLLHRYTE 291

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+K+ L LD +  +D   PL    +  +P+E A++ +L++      +   + ++   + W
Sbjct: 292 LRKELLGLDDLKMYDLYTPLIKDIKFEMPYEEAKEWMLKALEPMGEEYLNVVKEGLNNRW 351

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D  +  GK SG ++ G     +P+ILLN+     D+ TL HE GH  H   S + Q   
Sbjct: 352 VDVYENKGKRSGGYSSGAHL-TNPFILLNWSNTISDLYTLVHEFGHSAHSYFSRKFQPSN 410

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
           +++ ++ +AE AS   E L  D + +     E+R +LL  ++E    ++ RQ  F +FE 
Sbjct: 411 SSDYTIFVAEVASTCNEALLSDYMDKH-LDDEKRLLLLNQELERFRATLFRQTMFAEFEH 469

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
           K+H    +   +   R+NE + +  K   G + + +D +    W  +PHF   ++YVY Y
Sbjct: 470 KIHAIEEAGEPLTPTRMNEEYAKLNKLYFGDSVE-TDEDISKEWSRIPHFY-MNYYVYQY 527

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     SL     +             L+ G+S +  E+L    ++++ P   E+  +
Sbjct: 528 ATGYSAAQSLSHQILTEGKPAVDRYINEFLKKGSSNYPIEILKNAGVDMTTPEPIEQACE 587

Query: 615 TVEKMIDDVEKM 626
             E+ ++  EK+
Sbjct: 588 VFEQKLNAFEKL 599


>gi|82750613|ref|YP_416354.1| thimet oligopeptidase [Staphylococcus aureus RF122]
 gi|82656144|emb|CAI80555.1| thimet oligopeptidase [Staphylococcus aureus RF122]
          Length = 602

 Score =  429 bits (1103), Expect = e-118,   Method: Composition-based stats.
 Identities = 130/612 (21%), Positives = 260/612 (42%), Gaps = 22/612 (3%)

Query: 24  MTTMDSQENLG---NLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
           M+   S+E          W+L  ++   D +      + +E+E    + +++G++     
Sbjct: 1   MSQQLSREEQERKYPEYTWDLTTIFK--DDEAFEAAFKEVENELGK-EEQFKGHIGD--- 54

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
             +  +L  A+   + +   + ++  YA L  + + ++       +  +  +  F     
Sbjct: 55  --SAETLYNALELEDTLGTKLEKVYVYAHLKQDQDTTNDKYTGMESRAHQLIIKFSSAWS 112

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           F    I  +DE  ++          K++  +K I + + H+L  + E LL++        
Sbjct: 113 FLVPAILQIDEDKIQSFVNSYDKLQKFAFDLKLINEKRPHILDAETEKLLTEAQDALSTP 172

Query: 201 LKRFFCENIESL------RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              +   +   L          N   +      K     DR++R+SA K +   +   ++
Sbjct: 173 SNVYGMFSNADLVFEDAIDKDGNAHPLTQGTFIKYLESDDRKLRESAFKNVYKAYGAHNN 232

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
                     K      R   Y+   +    +N++   V + L+++V  Y     HRY E
Sbjct: 233 TLGATLAGEVKKNVFNARTHNYKTAREKALSNNHIPENVYDNLVKTVHKY-LPLLHRYTE 291

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+K+ L LD +  +D   PL    +  +P+E A++ +L++      +   + ++   + W
Sbjct: 292 LRKELLGLDDLKMYDLYTPLIKDIKFEMPYEEAKEWMLKALEPMGEEYLNVVKEGLNNRW 351

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D  +  GK SG ++ G     +P+ILLN+     D+ TL HE GH  H   S + Q   
Sbjct: 352 VDVYENKGKRSGGYSSGAHL-TNPFILLNWSNTISDLYTLVHEFGHSAHSYFSRKFQPSN 410

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
           +++ ++ +AE AS   E L  D + +     E+R +LL  ++E    ++ RQ  F +FE 
Sbjct: 411 SSDYTIFVAEVASTCNEALLSDYMDKH-LDDEKRLLLLNQELERFRATLFRQTMFAEFEH 469

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
           K+HT   +   +   R+NE + +  K   G + + +D +    W  +PHF   ++YVY Y
Sbjct: 470 KIHTIEEAGEPLTPTRMNEEYAKLNKLYFGDSVE-TDEDISKEWSRIPHFY-MNYYVYQY 527

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     SL     +             L+ G+S +  E+L    ++++ P   E+  +
Sbjct: 528 ATGYSAAQSLSHQILTEGKPAVDRYINEFLKKGSSNYPIEILKNAGVDMTTPEPIEQACE 587

Query: 615 TVEKMIDDVEKM 626
             E+ ++  EK+
Sbjct: 588 VFEQKLNAFEKL 599


>gi|154484570|ref|ZP_02027018.1| hypothetical protein EUBVEN_02284 [Eubacterium ventriosum ATCC
           27560]
 gi|149734418|gb|EDM50335.1| hypothetical protein EUBVEN_02284 [Eubacterium ventriosum ATCC
           27560]
          Length = 599

 Score =  429 bits (1103), Expect = e-118,   Method: Composition-based stats.
 Identities = 147/603 (24%), Positives = 261/603 (43%), Gaps = 20/603 (3%)

Query: 29  SQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLG 88
            +E       W +ED+Y S  + E  ND++        +  +++ N++     KN  +L 
Sbjct: 2   KREEQKIENTWKMEDMYSSDQAME--NDLDKALKMISEYN-KYKDNVS-----KNKETLL 53

Query: 89  AAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINT 148
             +   + I  +  ++  Y+   Y+ ++++   + +       + +      FF  EI  
Sbjct: 54  EYLKFNDEINLMAEKVYVYSNQKYHEDMTNSKYQTYSGKAQKLVVELGSATAFFEPEILE 113

Query: 149 LDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCEN 208
           +DE +L++          Y  +I  I + K H L    E +L+ + ++   A   +   N
Sbjct: 114 MDENVLKEWLENKEF-ADYRRYISEILRAKAHTLDKKTEEILAKSKRMASAADNIYAMYN 172

Query: 209 IESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNT 262
              + F     K      I           +DR++RK+A KAL  T+ K  +  +   N 
Sbjct: 173 GADIDFPTVKDKDGNEIKITHGNFVPILSGADRQLRKAAFKALYGTYGKMKNTIAATYNA 232

Query: 263 LAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKL 322
             +        R Y          +N+   V + L++ V  +     HRY  L+KK L +
Sbjct: 233 NVEQACFYADVRNYPSTRAMYLDESNIPEEVYDNLIEVVHEHM-DLMHRYVSLRKKALGV 291

Query: 323 DTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDG 382
           D ++ +D  AP+  T    IPFE A+++V    A          ++ F + WID  + +G
Sbjct: 292 DQLHMYDVYAPIVETPDKKIPFEKAKEMVKAGLAPMGKDYINKLQEGFDNRWIDIYENEG 351

Query: 383 KGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTL 442
           K SGA++ G    +HPY+LLNY G    V TLAHE+GH +H   S   Q  +     + +
Sbjct: 352 KRSGAYSWG-AYGIHPYVLLNYQGTLDHVFTLAHEMGHALHSYYSDSNQSYINAGYKIFV 410

Query: 443 AETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRS 502
           AE AS   E+L    LL+   +K E+  L+ + +E    ++ RQ  F +FE   H     
Sbjct: 411 AEVASTCNESLLIHYLLKNTDNKAEKAYLINHFLEQFKGTLYRQTMFAEFEKITHKMVEE 470

Query: 503 TGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVN 562
              + +  + +++ +  K+  G    L D E    W  +PHF    FYVY YA G     
Sbjct: 471 GETLTSDILCKVYYDLNKQYFGEDMVL-DEEIALEWARIPHFYN-PFYVYQYATGISAAI 528

Query: 563 SLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDD 622
           +L         +   + Y+  L  G SK   +LL    ++++     E+ L+  ++++D 
Sbjct: 529 ALSKKIMEQG-EAGVKDYMKFLTGGGSKDPIDLLKLAGVDMTTKEPIEKALELFKELLDQ 587

Query: 623 VEK 625
           +E+
Sbjct: 588 MEQ 590


>gi|27467608|ref|NP_764245.1| thimet oligopeptidase-like protein [Staphylococcus epidermidis ATCC
           12228]
 gi|27315152|gb|AAO04287.1|AE016746_77 thimet oligopeptidase-like protein [Staphylococcus epidermidis ATCC
           12228]
          Length = 602

 Score =  429 bits (1103), Expect = e-118,   Method: Composition-based stats.
 Identities = 131/612 (21%), Positives = 259/612 (42%), Gaps = 22/612 (3%)

Query: 24  MTTMDSQENLG---NLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
           M+   ++E          W+L  ++ S ++       + IE +    + +++G+L     
Sbjct: 1   MSQQLTREEQERKYPEYTWDLTTIFKSDEA--FEEAFKSIEAKIGE-EEKFKGHLG---- 53

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
            ++  +L  A++  + +   + ++  YA L  + + ++          +  +  +     
Sbjct: 54  -ESAETLYEALSLEDELGTKLEKVYVYAHLKQDQDTANDKYTGLEARAHQLVIKYSSAWS 112

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           F   EI  LDEA ++     +    +Y   +K I + + H+L  + E LL++        
Sbjct: 113 FLVPEILQLDEATIQSFIDSNDDLKRYEFDLKLINEKRPHILDANTEKLLTEAQDALSTP 172

Query: 201 LKRFFCENIESLRFKI------NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              +   +   L F+           +      K     DRE+R SA + +   +   ++
Sbjct: 173 SNVYGMFSNADLEFEDAIDKDGQAYPLTQGTFIKYLESDDRELRASAFRNVYKAYGAHNN 232

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
                     K      R   Y    +    +N++   V + L+++V  Y     HRY +
Sbjct: 233 TLGATLAGEVKKNVFNARTHHYHSARERALSNNHIPEAVYDNLIKTVHKY-LPLLHRYTK 291

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+++ L LD +  +D   PL    +  +P+E A+  +L++      +   + ++   + W
Sbjct: 292 LRQELLGLDDLKMYDLYTPLVKDVKFEMPYEEAKSWMLKALEPMGEEYLNVVKEGLDNRW 351

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D  +  GK SG ++ G     +P+ILLN+     D+ TL HE GH  H   S + Q   
Sbjct: 352 VDVYENKGKRSGGYSSGGHL-TNPFILLNWSDTVSDLYTLVHEFGHSAHSYFSRQNQPSN 410

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
            ++ ++ +AE AS   E L  D + +     E R +LL  ++E    ++ RQ  F +FE 
Sbjct: 411 LSDYTIFVAEVASTCNEALLSDYMDKHLD-DERRLLLLNQELERFRATLFRQTMFAEFEH 469

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
           K+H    +   +  +R+NE + +  K   G A + +D +    W  +PHF   ++YVY Y
Sbjct: 470 KIHQIEEAGEPLTPNRMNEEYAKLNKLYFGEAVE-TDDDISKEWSRIPHFY-MNYYVYQY 527

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     SL     +      +      L+ G+S +  E+L    ++++ P   E   +
Sbjct: 528 ATGYSAAQSLSHQILTEGQPAVERYINEFLKKGSSNYPIEILKNAGVDMTTPQPIEEACE 587

Query: 615 TVEKMIDDVEKM 626
             E+ +D  EK+
Sbjct: 588 VFEQKLDAFEKL 599


>gi|239627223|ref|ZP_04670254.1| oligopeptidase [Clostridiales bacterium 1_7_47_FAA]
 gi|239517369|gb|EEQ57235.1| oligopeptidase [Clostridiales bacterium 1_7_47FAA]
          Length = 594

 Score =  429 bits (1103), Expect = e-118,   Method: Composition-based stats.
 Identities = 140/606 (23%), Positives = 252/606 (41%), Gaps = 19/606 (3%)

Query: 27  MDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS 86
           M  +  +     W LED+  S    E     E    +   +   ++G L      ++  +
Sbjct: 1   MKKRSEVEIKDTWKLEDMVASDSQWE--QLFEEASSKVKQY-ADYKGRLD-----ESADT 52

Query: 87  LGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEI 146
           L A +   + I      +  Y+ +  + + +    +  ++   +      +   +   EI
Sbjct: 53  LYACLKFDDEISRETELLYVYSRMRSDQDTADQKYQDMFSRAQSLSYKASEYSSYIVPEI 112

Query: 147 NTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFC 206
            ++ E  L+     D     +   ++ +   ++H LS +ME LL+ +    + A + F  
Sbjct: 113 LSMPEEKLDAYMKADNGISHFKRALEMVLNKREHTLSGEMEELLAQSYDATQGASQIFTM 172

Query: 207 ENIESLRFKIND------QKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFIT 260
            N   ++F +         +I          + DR +RK A + L   + + S+  +   
Sbjct: 173 FNNADVKFPVITGENGEAVQITHGNYISLMENQDRRIRKDAFEGLYSVYAQYSNTLAAAF 232

Query: 261 NTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWL 320
           +T  K      R +KYE         N V   V + L+++         HRY  ++KK L
Sbjct: 233 STNIKQAVFYARAKKYESSRQYYLAGNEVPELVYDNLVRA-VRDNLPKLHRYAGVRKKLL 291

Query: 321 KLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQY 380
            +D ++ +D   P+         +E A+ +V +  A    +   I ++ F   WID  + 
Sbjct: 292 GVDELHMYDLYVPMVAEYDRRYTYEEAKAIVKEGLAPLGEEYLSILQEGFDSRWIDVYEN 351

Query: 381 DGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSL 440
           +GK SGA++ GT    HPY+LLN+ G   DV TLAHE+GH IH   S + Q        +
Sbjct: 352 EGKRSGAYSWGT-YGSHPYVLLNFHGTLNDVFTLAHEMGHSIHSWYSDKNQPFTYAGYKI 410

Query: 441 TLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTER 500
            +AE AS   E L    LL+ A S+EE+  LL + +E    ++ RQ  F +FE   H + 
Sbjct: 411 FVAEVASTCNEALLIRHLLKKAGSREEKAYLLNHFLESFRGTLFRQTMFAEFEDMAHKKG 470

Query: 501 RSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCL 560
            +   +    +  ++ +   +  GP  ++ D +    W  +PHF  + FYVY YA G   
Sbjct: 471 AAGESLTAQSLCRMYRQLNVDYFGPEMNV-DAQIDYEWERIPHFY-TPFYVYQYATGFSA 528

Query: 561 VNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMI 620
             ++         +   E Y   L  G S    ELL    +++S     +  L    +++
Sbjct: 529 AVAISSRIMK-GEEGALEGYKKFLSGGCSMTPIELLKLCGVDMSTTRPVDEALAFFGELL 587

Query: 621 DDVEKM 626
           D+ E +
Sbjct: 588 DEFEGL 593


>gi|258449951|ref|ZP_05698049.1| oligoendopeptidase F [Staphylococcus aureus A6224]
 gi|257856871|gb|EEV79774.1| oligoendopeptidase F [Staphylococcus aureus A6224]
          Length = 602

 Score =  429 bits (1103), Expect = e-118,   Method: Composition-based stats.
 Identities = 129/612 (21%), Positives = 259/612 (42%), Gaps = 22/612 (3%)

Query: 24  MTTMDSQENLG---NLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
           M+   S+E          W+L  ++   D +      + +E+E    + +++G++     
Sbjct: 1   MSQQLSREEQERKYPEYTWDLTTIFK--DDEAFEAAFKEVENELGK-EEQFKGHIGD--- 54

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
             +  +L  A+   + +   + ++  YA L  + + ++       +  +  +  F     
Sbjct: 55  --SAETLYNALELEDTLGTKLEKVYVYAHLKQDQDTTNDKYTGMESRAHQLIIKFSSAWS 112

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           F   EI  +DE   +          K++  +K I + + H+L  + E LL++        
Sbjct: 113 FLVPEILQIDEDKNQSFVNSYDKLQKFAFDLKLINEKRPHILDAETEKLLTEAQDALSTP 172

Query: 201 LKRFFCENIESL------RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              +   +   L          N   +      K     DR++R+SA + +   +   ++
Sbjct: 173 SNVYGMFSNADLVFEDAIDKDGNAHPLTQGTFIKYLESDDRKLRESAFRNVYKAYGAHNN 232

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
                     K      R   Y+   +    +N++   V + L+++V  Y     HRY E
Sbjct: 233 TLGATLAGEVKKNVFNARTHNYKTAREKALSNNHIPENVYDNLVKTVHKY-LPLLHRYTE 291

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+K+ L LD +  +D   PL    +  +P+E A++ +L++      +   + ++   + W
Sbjct: 292 LRKELLGLDDLKMYDLYTPLIKDIKFEMPYEEAKEWMLKALEPMGEEYLNVVKEGLNNRW 351

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D  +  GK SG ++ G     +P+ILLN+     D+ TL HE GH  H   S + Q   
Sbjct: 352 VDVYENKGKRSGGYSSGAHL-TNPFILLNWSNTISDLYTLVHEFGHSAHSYFSRKFQPSN 410

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
           +++ ++ +AE AS   E L  D + +     E+R +LL  ++E    ++ RQ  F +FE 
Sbjct: 411 SSDYTIFVAEVASTCNEALLSDYMDKH-LDDEKRLLLLNQELERFRATLFRQTMFAEFEH 469

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
           K+H    +   +   R+NE + +  K   G + + +D +    W  +PHF   ++YVY Y
Sbjct: 470 KIHAIEEAGEPLTPTRMNEEYAKLNKLYFGDSVE-TDEDISKEWSRIPHFY-MNYYVYQY 527

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     SL     +             L+ G+S +  E+L    ++++ P   E+  +
Sbjct: 528 ATGYSAAQSLSHQILTEGKPAVDRYINEFLKKGSSNYPIEILKNAGVDMTTPEPIEQACE 587

Query: 615 TVEKMIDDVEKM 626
             E+ ++  EK+
Sbjct: 588 VFEQKLNAFEKL 599


>gi|312127387|ref|YP_003992261.1| oligoendopeptidase f [Caldicellulosiruptor hydrothermalis 108]
 gi|311777406|gb|ADQ06892.1| oligoendopeptidase F [Caldicellulosiruptor hydrothermalis 108]
          Length = 626

 Score =  429 bits (1102), Expect = e-118,   Method: Composition-based stats.
 Identities = 142/620 (22%), Positives = 265/620 (42%), Gaps = 23/620 (3%)

Query: 13  AFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWE 72
           +F    +       +  +  + +  +WNLED+Y S +    + D+  + +  +     ++
Sbjct: 17  SFIVTTVIGFASEGVKKRSEIPDKYKWNLEDIYSSPEKW--NADLNKVLNYYIPKFKNYK 74

Query: 73  GNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKL 132
           G L+      + + L   +   + +  +  ++  YA +  + N +   + +  +      
Sbjct: 75  GKLS------DKNKLLECLKLRDEMMRIADKVYVYAHMKADENQADNKVSEMRSKSETMY 128

Query: 133 ADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSD 192
           A     + F   E+  L E  L+    QD     Y  ++  + K K H LS + E LL+ 
Sbjct: 129 AQVSAAVSFIQPELLRLPEKTLKSYM-QDKSFADYKMYLDAVLKQKPHTLSPEGEELLAL 187

Query: 193 TSQVGREALKRFFCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALS 246
                      F       L F           ++      K   + DR+ RK A + + 
Sbjct: 188 AQDFAGSPYNIFTQLKYADLTFPKIKDDKGNEIQLTEASYGKYLENKDRDFRKRAFEGIY 247

Query: 247 HTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYP 306
            +F+K  +  +       K      + RKY    ++      +   V + L+++  N   
Sbjct: 248 SSFDKVKNTLAATLTAEVKKNVFFAKARKYNSALEASLAQEFIPRSVYDNLIKA-VNNNI 306

Query: 307 KTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIA 366
           K  H+Y EL+KK L LD ++ +D   PL    +  I +E A+ L+L+           + 
Sbjct: 307 KYLHKYVELRKKVLNLDKVHIYDMYVPLVANYEMNIDYEQAKKLILEGLKPLGNDYLKVL 366

Query: 367 EKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVL 426
              F + WID  + + K +G +  G     HPYIL+NY      V+TLAHELGH I+   
Sbjct: 367 NIAFNNRWIDVFETENKYTGGYQWGAYD-THPYILMNYNNTMDSVLTLAHELGHAINSYY 425

Query: 427 SSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQ 486
           +++TQ  + +N  +  AE AS   E L  + LL+ A S +ER  LL   +E++  ++  Q
Sbjct: 426 TNKTQKYINSNVPIFTAEVASTTNELLMINYLLKKAKSDDERLYLLNTLVENIRGTVYTQ 485

Query: 487 ISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIE 546
           + + +FE ++H        +    ++ IW    K+  G +F++  L    +W  +PHF  
Sbjct: 486 VMYAEFEKEIHERVEKGEALSAETLSNIWGNLMKKYYGDSFEVDKLA-TLWWARIPHFY- 543

Query: 547 SSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDP 606
            +FYVY YA      N +    +         KY+  L+AG+S +   +L    ++++  
Sbjct: 544 MNFYVYKYATSMAAANEVVKNIEKGD----TAKYIEFLKAGSSDYPINVLKKAGVDMTST 599

Query: 607 NFWERGLQTVEKMIDDVEKM 626
              +  L    +++D++EK+
Sbjct: 600 KPVDNLLTYFGQLVDEMEKI 619


>gi|57866543|ref|YP_188171.1| oligoendopeptidase F [Staphylococcus epidermidis RP62A]
 gi|57637201|gb|AAW53989.1| oligoendopeptidase F [Staphylococcus epidermidis RP62A]
          Length = 602

 Score =  429 bits (1102), Expect = e-118,   Method: Composition-based stats.
 Identities = 131/612 (21%), Positives = 259/612 (42%), Gaps = 22/612 (3%)

Query: 24  MTTMDSQENLG---NLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
           M+   ++E          W+L  ++ S ++       + IE +    + +++G+L     
Sbjct: 1   MSQQLTREEQERKYPEYTWDLTTIFKSDEA--FEEAFKSIEAKIGE-EEKFKGHLG---- 53

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
            ++  +L  A++  + +   + ++  YA L  + + ++          +  +  +     
Sbjct: 54  -ESAETLYEALSLEDELGTKLEKVYVYAHLKQDQDTANDKYTGLEARAHQLVIKYSSAWS 112

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           F   EI  LDEA ++     +    +Y   +K I + + H+L  + E LL++        
Sbjct: 113 FLVPEILQLDEATIQSFIDSNDNLKRYEFDLKLINEKRPHILDTNTEKLLTEAQDALSTP 172

Query: 201 LKRFFCENIESLRFKI------NDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              +   +   L F+           +      K     DRE+R SA + +   +   ++
Sbjct: 173 SNVYGMFSNADLEFEDAIDKDGQAYPLTQGTFIKYLESDDRELRASAFRNVYKAYGAHNN 232

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
                     K      R   Y    +    +N++   V + L+++V  Y     HRY +
Sbjct: 233 TLGATLAGEVKKNVFNARTHHYRSARERALSNNHIPEAVYDNLIKTVHKY-LPLLHRYTK 291

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+++ L LD +  +D   PL    +  +P+E A+  +L++      +   + ++   + W
Sbjct: 292 LRQELLGLDDLKMYDLYTPLVKDVKFEMPYEEAKSWMLKALEPMGEEYLNVVKEGLDNRW 351

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D  +  GK SG ++ G     +P+ILLN+     D+ TL HE GH  H   S + Q   
Sbjct: 352 VDVYENKGKRSGGYSSGGHL-TNPFILLNWSDTVSDLYTLVHEFGHSAHSYFSRQNQPSN 410

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
            ++ ++ +AE AS   E L  D + +     E R +LL  ++E    ++ RQ  F +FE 
Sbjct: 411 LSDYTIFVAEVASTCNEALLSDYMDKHLD-DERRLLLLNQELERFRATLFRQTMFAEFEH 469

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
           K+H    +   +  +R+NE + +  K   G A + +D +    W  +PHF   ++YVY Y
Sbjct: 470 KIHQIEEAGEPLTPNRMNEEYAKLNKLYFGEAVE-TDEDISKEWSRIPHFY-MNYYVYQY 527

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     SL     +      +      L+ G+S +  E+L    ++++ P   E   +
Sbjct: 528 ATGYSAAQSLSHQILTEGQPAVERYINEFLKKGSSNYPIEILKNAGVDMTTPQPIEEACE 587

Query: 615 TVEKMIDDVEKM 626
             E+ +D  EK+
Sbjct: 588 VFEQKLDAFEKL 599


>gi|240144112|ref|ZP_04742713.1| oligoendopeptidase F [Roseburia intestinalis L1-82]
 gi|257203904|gb|EEV02189.1| oligoendopeptidase F [Roseburia intestinalis L1-82]
          Length = 600

 Score =  428 bits (1101), Expect = e-117,   Method: Composition-based stats.
 Identities = 147/609 (24%), Positives = 262/609 (43%), Gaps = 19/609 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
              +  +  +     WNL+D+Y S +      D++ I+        + EG +A       
Sbjct: 2   AKELLKRSEVKEEYTWNLKDMYASDEDW--KKDLDEIDKILDEI-GKMEGKVAAC----- 53

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
             +L   +    +  E +    +YA   ++ +  +   +     + + L        F  
Sbjct: 54  AQNLLFVLERAAKAEEKLDYDFNYAERLFDEDQKNTAHQAMSQKMYSMLTKVSSQTAFIV 113

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
            EI  +DEA+LE  Y + P    Y   I+ I + K H LS +ME L++ T  +   + + 
Sbjct: 114 PEILAMDEAVLEGYYKELPELELYRKQIEEIERTKAHTLSAEMEKLVAMTGDMAETSGQV 173

Query: 204 FFCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           +   N     F           ++           +DR VRK A +     + + ++  +
Sbjct: 174 YSIINNADFVFPEIKDEEGDTVRLSHGNFVPFEESADRRVRKDAFEGFYGVYKQYANTLA 233

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
            + N   K +      R Y    ++   +NNV P V   L+ ++        HRY  L+K
Sbjct: 234 ALYNGQVKQQVFYANARHYHSTLEAAVDANNVSPTVYHNLIDTINKNM-DKMHRYVRLRK 292

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           K L +D ++ +D   P+   +   I FE A++ VL++ A    +     ++ F   WID 
Sbjct: 293 KCLGVDELHMYDVYTPMIADAAKKISFEEAKETVLKALAPLGEEYVAKVKEGFESRWIDV 352

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            + +GK SGA++ G     HPY+LLN+     ++ TLAHE+GH +H   S+ +Q  + + 
Sbjct: 353 YENEGKRSGAYSAG-AYGSHPYVLLNHNDTLDNMFTLAHEMGHAMHSYYSNSSQPYIYSQ 411

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
             + +AE AS   E L  + LL+  + K+ER  LL + ++    ++ RQ  F ++E+  +
Sbjct: 412 YKIFVAEVASTCNEVLLMEYLLKNTTDKKERAYLLNHYLDSFKGTVYRQTMFAEYEMLSN 471

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
                   +    +N+++ +   +  GP   +SD E    W  +PHF   +FYVY YA G
Sbjct: 472 KMVEEGESLTAETLNKLYYDLNCKYFGPDM-VSDSEIAYEWARIPHFY-YNFYVYQYATG 529

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                +L             E+Y   L  G S    ELL    +NL  P   +  L    
Sbjct: 530 FSSAVALAHGILKEGAPAV-ERYKKFLSGGCSASPVELLKIAGVNLETPKPIQEALDVFG 588

Query: 618 KMIDDVEKM 626
           +++D++E +
Sbjct: 589 EVLDEIEAL 597


>gi|238917506|ref|YP_002931023.1| oligoendopeptidase F [Eubacterium eligens ATCC 27750]
 gi|238872866|gb|ACR72576.1| oligoendopeptidase F [Eubacterium eligens ATCC 27750]
          Length = 590

 Score =  428 bits (1101), Expect = e-117,   Method: Composition-based stats.
 Identities = 134/602 (22%), Positives = 258/602 (42%), Gaps = 19/602 (3%)

Query: 27  MDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHS 86
           M ++  + +  +W + DLY S ++ E   D   I   +    +  +G +      ++   
Sbjct: 1   MPARSEIDDKFKWAVSDLYSSDEAWE--KDYNSILELTDQ-PSELKGRMG-----ESAGM 52

Query: 87  LGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEI 146
           L  A+ EYE++  +  R+  YA + Y  +  +   ++             +   F   E+
Sbjct: 53  LYKALKEYEQVEYITERVYVYAFMKYYEDTGNSKYQEISGKAQMAAMKVSEKYAFLEPEL 112

Query: 147 NTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFC 206
            ++D  +L++  ++D     Y  +I +    K+H LS   E LL+  SQ+     + F  
Sbjct: 113 ISIDADVLDKYISEDERLGMYKHFIDDCLAGKEHTLSEKEEALLAKASQMSTVPDEVFSK 172

Query: 207 ENIESLRF------KINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFIT 260
            N   ++F         + ++            DR VRK+A +AL   +    +  +   
Sbjct: 173 FNNADVKFGKVKRENGQEDELTNGNFATFMESHDRAVRKAAFEALYKQYGAYINTIAAAF 232

Query: 261 NTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWL 320
               K        R Y+   +     + +   V + L+++  N      + Y +++KK L
Sbjct: 233 YGNVKQAMFYADARGYKSTLNMYLDGSFIPENVYKNLIKT-VNDNLDKMYCYVDIRKKAL 291

Query: 321 KLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQY 380
            +D ++F+D  AP+       I ++ A+D+V+++ A    +     ++ F + W+D  + 
Sbjct: 292 GVDELHFYDIYAPMVEDIDWKISYDEAKDIVVKALAPMGEEYVSHIKEGFNNGWVDVYEN 351

Query: 381 DGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSL 440
            GK SGAF+ G     HPY+ LNY     DV T+ HE+GH +H   S+  Q  +     +
Sbjct: 352 TGKRSGAFSWG-AYGTHPYVFLNYSDTLNDVFTVIHEMGHAMHTYYSNANQPYIYAGYKI 410

Query: 441 TLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTER 500
            +AE AS   E +    +L+    +++++ LL +  E    ++ RQ  F +FE++ H + 
Sbjct: 411 FVAEVASTCNEAILMQYMLKNTDDEKKKRYLLNHFFEQFKGTLYRQTMFAEFEMEAHAKA 470

Query: 501 RSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCL 560
                +    +  ++ +  ++  GP   + D E    W  +PHF  + FYVY YA G   
Sbjct: 471 EQGEVLSAESLCAMYKKLNEKYFGPDMVIDD-EIALEWARIPHFY-TPFYVYQYATGYSA 528

Query: 561 VNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMI 620
             ++         +     Y   L  G+S H  ELL    I+++ P+  +  L    K++
Sbjct: 529 AIAISTKIL-AGDEQVIAGYRKFLSGGSSMHPIELLKLCGIDMTRPDVVQEALDVFGKLL 587

Query: 621 DD 622
             
Sbjct: 588 KQ 589


>gi|329729003|gb|EGG65415.1| oligoendopeptidase F [Staphylococcus aureus subsp. aureus 21193]
          Length = 602

 Score =  428 bits (1101), Expect = e-117,   Method: Composition-based stats.
 Identities = 128/612 (20%), Positives = 260/612 (42%), Gaps = 22/612 (3%)

Query: 24  MTTMDSQENLG---NLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN 80
           M+   S+E          W+L  ++   D +      + +E+E    + +++G++     
Sbjct: 1   MSQQLSREEQERKYPEYTWDLTTIFK--DDEAFEAAFKEVENELGK-EEQFKGHIGD--- 54

Query: 81  QKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLI 140
             +  +L  A+   + +   + ++  YA L  + + ++       +  +  +  F     
Sbjct: 55  --SAETLYNALELEDTLGTKLEKVYVYAHLKQDQDTTNDKYTGMESRAHQLIIKFSSAWS 112

Query: 141 FFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREA 200
           F   EI  +DE  ++          K++  +K I + + H+L  + E LL++        
Sbjct: 113 FLVPEILQIDEDKIQSFVNSYDKLQKFAFDLKLINEKRPHILDAETEKLLTEAQDALSTP 172

Query: 201 LKRFFCENIESL------RFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSH 254
              +   +   L          N   +      K     DR++R+SA + +   +   ++
Sbjct: 173 SNVYGMFSNADLVFEDAIDKDGNAHPLTQGTFIKYLESDDRKLRESAFRNVYKAYGAHNN 232

Query: 255 IFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
                     K      R   Y+   +    +N++   V + L+++V  Y     HRY E
Sbjct: 233 TLGATLAGQVKKNVFNARTHNYKTAREKALSNNHIPENVYDNLVKTVHKY-LPLLHRYTE 291

Query: 315 LKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNW 374
           L+K+ L LD +  +D   PL    +  +P+E A++ +L++      +   + ++   + W
Sbjct: 292 LRKELLGLDDLKMYDLYTPLIKDIKFEMPYEEAKEWMLKALEPMGEEYLNVVKEGLNNRW 351

Query: 375 IDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGIL 434
           +D  +  GK SG ++ G     +P+ILLN+     D+ TL HE GH  H   S + Q   
Sbjct: 352 VDVYENKGKRSGGYSSGAHL-TNPFILLNWSNTISDLYTLVHEFGHSAHSYFSRKFQPSN 410

Query: 435 TNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL 494
           +++ ++ +AE AS   E L  D + +     E+R +LL  ++E    ++ RQ  F +FE 
Sbjct: 411 SSDYTIFVAEVASTCNEALLSDYMDKH-LDDEKRLLLLNQELERFRATLFRQTMFAEFEH 469

Query: 495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAY 554
           K++    +   +   R+NE + +  K   G + + +D +    W  +PHF   ++YVY Y
Sbjct: 470 KINAIEEAGEPLTPTRMNEEYAKLNKLYFGDSVE-TDEDISKEWSRIPHFY-MNYYVYQY 527

Query: 555 AFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQ 614
           A G     SL     +             L+ G+S +  E+L    ++++ P   E+  +
Sbjct: 528 ATGYSAAQSLSHQILTEGKPAVDRYINEFLKKGSSNYPIEILKNAGVDMTTPEPIEQACE 587

Query: 615 TVEKMIDDVEKM 626
             E+ ++  EK+
Sbjct: 588 VFEQKLNAFEKL 599


>gi|228992196|ref|ZP_04152130.1| Oligoendopeptidase F [Bacillus pseudomycoides DSM 12442]
 gi|228767559|gb|EEM16188.1| Oligoendopeptidase F [Bacillus pseudomycoides DSM 12442]
          Length = 597

 Score =  428 bits (1101), Expect = e-117,   Method: Composition-based stats.
 Identities = 139/609 (22%), Positives = 250/609 (41%), Gaps = 20/609 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           MT   ++ ++ +  +W+L D+Y + ++ E  ND + IE  +   K ++ G +       +
Sbjct: 3   MTEFKNRMDVSDQEKWDLTDIYKTIENWE--NDYQKIETLTEDLK-KFNGTIH------D 53

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
             SL A + + E I  L   + +YA L  + +      +      +           FF+
Sbjct: 54  GQSLLAYLTKSEEISSLFNLVYAYARLQSDLDTRDTEAQSLVDKASQLHVKISAARSFFS 113

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
             + ++DE +L     ++     +   +  + + KKH+L+ D E +LS   +        
Sbjct: 114 PFLLSIDEKILHSYIEENEGLQYFKEDLFELYRYKKHVLNEDKEEILSQMGEALSSPQHT 173

Query: 204 FFCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           +   N   + F            +      K   D  R+ RK A KA    + +  +  +
Sbjct: 174 YGMLNNADITFGEVTTKDGNKVNLTRGMYSKLIKDESRDKRKEAYKAYYQPYVQLKNSIA 233

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
                  K+     + R Y    +     + V   V + L+ + K       H Y  L+K
Sbjct: 234 STLTAAIKNNVTISKIRNYPSALERSLFGDMVPKEVYDTLIDTTKKNIASL-HTYNHLRK 292

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           + L+LD +  +D    L    +  IP++ A +++L S +    +       F    +ID 
Sbjct: 293 EKLQLDELRQYDLHVDLVKGVKQEIPYDEAFEIMLTSLSPLGEEYLQTLRGFKDKRYIDV 352

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK SGA+  G     HP+ILLN+      + TL HE GHG+H   S + Q  ++ +
Sbjct: 353 RELPGKRSGAYNFGV-YGAHPFILLNHNDDLNSLFTLTHECGHGMHTYYSHKFQPRISAH 411

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
            S+ +AE AS   E L    LL+ A   + R  L+ + I+    +   Q+ F +FE   H
Sbjct: 412 YSIFVAEVASTVNEILLIHHLLKEAKDIDVRNHLINHFIDQFKGTFFTQVMFAEFEKITH 471

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
                   +     N+++ +  +E  G    + D E    W  +PHF    FYVY YA G
Sbjct: 472 EMAHQGKPLNAQAFNDVYEKLFREYNGDTL-IFDEEVKYGWARIPHFYR-PFYVYKYATG 529

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                 + D   S      ++ Y+  L+ G+S +   LL    ++L+ P   E  L    
Sbjct: 530 FASAIQIADQLLS-GDPTAQQNYIEFLKGGSSDYPLNLLKKTGVDLTTPKPIESALGRFS 588

Query: 618 KMIDDVEKM 626
           K+I++   +
Sbjct: 589 KLIEEFSSL 597


>gi|228998262|ref|ZP_04157859.1| Oligoendopeptidase F [Bacillus mycoides Rock3-17]
 gi|228761523|gb|EEM10472.1| Oligoendopeptidase F [Bacillus mycoides Rock3-17]
          Length = 597

 Score =  428 bits (1100), Expect = e-117,   Method: Composition-based stats.
 Identities = 139/609 (22%), Positives = 250/609 (41%), Gaps = 20/609 (3%)

Query: 24  MTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKN 83
           MT   ++ ++ +  +W+L D+Y + ++ E  ND + IE  +   K ++ G +       +
Sbjct: 3   MTEFKNRMDVSDQEKWDLTDIYKTIENWE--NDYQKIETLTEDLK-KFNGTIH------D 53

Query: 84  CHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFA 143
             SL A + + E I  L   + +YA L  + +      +      +           FF+
Sbjct: 54  GQSLLAYLTKSEEISSLFNLVYAYARLQSDLDTRDTEAQSLVDKASQLHVKISAARSFFS 113

Query: 144 LEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKR 203
             + ++DE  L     ++     +   +  + + KKH+L+ D E +LS   +        
Sbjct: 114 PFLLSIDEKTLHSYIEENEGLQYFKEDLFELYRYKKHVLNKDKEEILSQMGEALSSPQHT 173

Query: 204 FFCENIESLRFKINDQ------KIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFS 257
           +   N   + F            +      K   D  R+ RK A KA    + +  +  +
Sbjct: 174 YGMLNNADITFGEVTTKDGNKVNLTRGMYSKLIKDESRDKRKEAYKAYYQPYVQLKNSIA 233

Query: 258 FITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKK 317
                  K+     + R Y    +     + V   V + L+ + K       H Y  L+K
Sbjct: 234 STLTAAIKNNVTISKIRNYPSALERSLFGDMVPKEVYDTLIDTTKKNIASL-HTYNHLRK 292

Query: 318 KWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDA 377
           + L+LD +  +D    L    +  IP++ A +++L S +    +       F    +ID 
Sbjct: 293 EKLQLDELRQYDLHVDLVKGVKQEIPYDEAFEIMLTSLSPLGEEYLQTLRGFKDKRYIDV 352

Query: 378 PQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNN 437
            +  GK SGA+  G    VHP+ILLN+      + TL HE GHG+H   S + Q  ++ +
Sbjct: 353 SELPGKRSGAYNFGV-YGVHPFILLNHNDDLNSLFTLTHECGHGMHTYYSHKFQPRISAH 411

Query: 438 SSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLH 497
            S+ +AE AS   E L    LL+ A   + R  L+ + I+    +   Q+ F +FE   H
Sbjct: 412 YSIFVAEVASTVNEILLIHHLLKEAKDIDVRNHLINHFIDQFKGTFFTQVMFAEFEKITH 471

Query: 498 TERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFG 557
                   +     N+++ +  +E  G    + D E    W  +PHF    FYVY YA G
Sbjct: 472 EMAHQGKPLNAQAFNDVYEKLFREYNGDTL-IFDEEVKYGWARIPHFYR-PFYVYKYATG 529

Query: 558 NCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVE 617
                 + D   S      ++ Y+  L+ G+S +   LL    ++L+ P   E  L    
Sbjct: 530 FASAIQIADQLLS-GDPTAQQNYIEFLKGGSSDYPLNLLKKTGVDLTTPKPIESALGRFS 588

Query: 618 KMIDDVEKM 626
           K++++   +
Sbjct: 589 KLVEEFSSL 597


>gi|291522067|emb|CBK80360.1| oligoendopeptidase F [Coprococcus catus GD/7]
          Length = 607

 Score =  428 bits (1100), Expect = e-117,   Method: Composition-based stats.
 Identities = 133/606 (21%), Positives = 268/606 (44%), Gaps = 19/606 (3%)

Query: 26  TMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCH 85
           T+  +E +    +W++ED++ + D+   ++ +E       A    ++ +L       +  
Sbjct: 8   TLPLREEVPAKDKWHIEDIFANDDA--FTSALEACRTHIDALAA-FKDHLGD-----SAE 59

Query: 86  SLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALE 145
           +L   + E E++   +  +  YA    + + S+P  +     ++     F +   F   E
Sbjct: 60  TLCTYLTEKEKVLVELDSLYCYAGHRSDEDTSNPHYQDLRGQVDFTGNHFYETTAFEDPE 119

Query: 146 INTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFF 205
           + +L E  + +S       + ++ +++N  ++K H LS + E L+S T  +       F+
Sbjct: 120 LLSLSEDFIPESLKNYSELIPFTHYLENTLRMKSHTLSKEEEALMSLTMDLDSTPQSIFY 179

Query: 206 CENIESLRFKINDQK------IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFI 259
             N   +RF+    +      I   +       SDR++R+   ++   +F++  +  + I
Sbjct: 180 MFNNADIRFESVTDRQGNEIGISHGRFVPLLESSDRDLRRKVFQSYYRSFDQYKNTVAAI 239

Query: 260 TNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKW 319
                K E    + R Y    ++    NN+   V + L+++  +      +RY  L++K 
Sbjct: 240 FAANLKKELFYTKARHYASSMEAHLSQNNIPTAVYDQLIEA-VHDALPEMYRYVRLRRKM 298

Query: 320 LKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQ 379
           L ++ ++ +D   PL       IPF+ A ++V +  A        +  +     WID  +
Sbjct: 299 LGVEELHMYDVYTPLVSGEHASIPFDEAMEIVSRGLAPLGESYIQLLNEGMHGGWIDRYE 358

Query: 380 YDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSS 439
             GK +GA++ G   + HP++L+NY G   +V TLAHE+GH +H   ++ T   +  + S
Sbjct: 359 NKGKRTGAYSGG-DYAHHPFVLMNYQGTLDNVFTLAHEMGHSLHSWYANHTHHYVDASYS 417

Query: 440 LTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTE 499
           + +AE AS   E L    LL+  S   E+  LL + ++    ++ RQ  F +FE   H +
Sbjct: 418 IFVAEIASTCNEALLMHDLLERCSDPHEKLWLLNHYLDMFKGTLFRQTMFAEFEKITHEK 477

Query: 500 RRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNC 559
             +   +    + +I+ +      GP   ++D E    W  +PHF    FYVY YA G  
Sbjct: 478 TAAGETLNAQSLCQIYGDLNALYFGPDM-VNDPEISLEWARIPHFY-MPFYVYQYATGFS 535

Query: 560 LVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKM 619
              +L     ++     ++ Y++ L+AG S +   +L    ++++        L     +
Sbjct: 536 AAIALSHRILTDGAPAVRD-YIDFLKAGGSDYPINVLKKAGVDMTTKAPVASALSVFSSV 594

Query: 620 IDDVEK 625
           +D+ E 
Sbjct: 595 LDETEA 600


>gi|256763305|ref|ZP_05503885.1| peptidase M3B [Enterococcus faecalis T3]
 gi|256961073|ref|ZP_05565244.1| peptidase M3B [Enterococcus faecalis Merz96]
 gi|257420072|ref|ZP_05597066.1| peptidase M3B [Enterococcus faecalis T11]
 gi|293384019|ref|ZP_06629913.1| oligoendopeptidase F [Enterococcus faecalis R712]
 gi|293386832|ref|ZP_06631402.1| oligoendopeptidase F [Enterococcus faecalis S613]
 gi|312908031|ref|ZP_07767014.1| oligoendopeptidase F [Enterococcus faecalis DAPTO 512]
 gi|312978441|ref|ZP_07790179.1| oligoendopeptidase F [Enterococcus faecalis DAPTO 516]
 gi|256684556|gb|EEU24251.1| peptidase M3B [Enterococcus faecalis T3]
 gi|256951569|gb|EEU68201.1| peptidase M3B [Enterococcus faecalis Merz96]
 gi|257161900|gb|EEU91860.1| peptidase M3B [Enterococcus faecalis T11]
 gi|291078499|gb|EFE15863.1| oligoendopeptidase F [Enterococcus faecalis R712]
 gi|291083666|gb|EFE20629.1| oligoendopeptidase F [Enterococcus faecalis S613]
 gi|310626122|gb|EFQ09405.1| oligoendopeptidase F [Enterococcus faecalis DAPTO 512]
 gi|311288590|gb|EFQ67146.1| oligoendopeptidase F [Enterococcus faecalis DAPTO 516]
          Length = 603

 Score =  428 bits (1100), Expect = e-117,   Method: Composition-base