RPSBLAST alignment of GI: 254780915 and protein with PDBid: 2h1n

>2h1n_A Oligoendopeptidase F; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG, PSI; 3.00A {Geobacillus stearothermophilus} PDB: 2h1j_A Length = 567
 Score =  241 bits (614), Expect = 6e-64
 Identities = 86/567 (15%), Positives = 183/567 (32%), Gaps = 27/567 (4%)

Query: 66  AFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFY 125
             +  ++  L       +      A+     +      +A+   + +  + +      FY
Sbjct: 18  QLQASFQEALDSFRRAGSAALQHEAMKRINELRRRYSTMANLCHIRHTIDTNDE----FY 73

Query: 126 TDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSND 185
                   + E V+     +      AL+   +  +        W K +  + +  L   
Sbjct: 74  KKEQDFFDETEPVVKGLVNDYY---RALVSSPFRAE----LEQVWGKQLFALAETQLKTY 126

Query: 186 MECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKAL 245
              ++ D  +     L   + + I S +     ++  L +        DR +R+ A++A 
Sbjct: 127 APVIVEDLQKE--NKLASEYTKLIASAKIMFEGEERTLAQLQPFVESPDRAMRQRASEAR 184

Query: 246 SHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIAD---SRHLSNNVEPYVIEALMQSVK 302
              F         + + L        R   ++   +   +R    +    ++    + VK
Sbjct: 185 FSFFKDYEKELDELYDELVHVRTAIARKLGFQNFVELGYARLGRTDYNADMVAGYRRQVK 244

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQD-IIPFEVARDLVLQSYAKFSPQ 361
            +    + +  E +++ ++++ +Y++D     P  +       +       Q Y + SP+
Sbjct: 245 THIVPLAAKLRERQRQRIQVEKLYYYDEPFMFPTGNPTPKGDADWIVQNGRQMYEELSPE 304

Query: 362 MSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHG 421
                     H  +D     GK  G +         P+I  N+ G   D+  L HE GH 
Sbjct: 305 TGEFFRYMVEHELMDLVAKKGKAGGGYCTYIDDYKAPFIFSNFTGTSGDIDVLTHEAGHA 364

Query: 422 IHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLN 481
                S        N  +L   E  S+  E  T+  +       E+        + D L 
Sbjct: 365 FQVYESRHYDIPEYNWPTLEACEIHSMSMEFFTWPWMELFF--GEDADKYRFAHLSDALL 422

Query: 482 SIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPA--FDLSDLEYGSFWM 539
            +   ++  +F+  ++       D+       +W   +K  L      D   LE G FW 
Sbjct: 423 FLPYGVAVDEFQHAVYEN----PDMTPAERKSVWRNIEKAYLPTRDYADHDYLERGGFWQ 478

Query: 540 MVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPL 599
              H     FY   Y          +   + +        Y+ + R G S+ ++EL+   
Sbjct: 479 RQGHIYTDPFYYIDYTLAQVCAFQFWKRAQEDRAS-AWRDYVALCRLGGSRPFTELVKSA 537

Query: 600 NINLS-DPNFWERGLQTVEKMIDDVEK 625
           N+            +  +E+ +D V+ 
Sbjct: 538 NLQSPFADGAVASVVGHIERWLDSVDD 564