RPSBLAST alignment of GI: 254780915 and SCOP domain: d1i1ip_

Alignment
>d1i1ip_ d.92.1.5 (P:) Neurolysin (endopeptidase 24.16, thimet oligopeptidase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 665
 Score = 40.1 bits (93), Expect = 5e-04
 Identities = 37/209 (17%), Positives = 61/209 (29%), Gaps = 35/209 (16%)

Query: 408 PQDVMTLAHELGHGIHFVL-SSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKE 466
             +V T  HE GH +H +   ++       N      E  S   E   +D       SK 
Sbjct: 453 HDEVRTYFHEFGHVMHQICAQTDFARFSGTNVETDFVEVPSQMLENWVWDVDSLRKLSKH 512

Query: 467 ER--KILLANKIEDMLN--------SIVRQISFYDFELKLHTERRSTGDIPTHRINEIWL 516
            +    +    +E ++           +RQI     +  LHT         T      + 
Sbjct: 513 YKDGHPITDELLEKLVASRLVNTGLLTLRQIVLSKVDQSLHTN-------ATLDAASEYA 565

Query: 517 ETQKESLGPAFDLSDLEYGSFWMMVPHFIE--SSFYVYAYAFGNCLVNSLY-------DI 567
           +   E LG A         +F     H        Y Y Y +       ++        I
Sbjct: 566 KYCTEILGVAATPGTNMPATF----GHLAGGYDGQY-YGYLWSEVFSMDMFHSCFKKEGI 620

Query: 568 YKSNTVDCFKEKYLNILRAGNSKHYSELL 596
                   ++     IL+ G S    ++L
Sbjct: 621 MNPEVGMKYRN---LILKPGGSLDGMDML 646

SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Zincin-like
superfamily: Metalloproteases ("zincins"), catalytic domain
family: Neurolysin-like
domain: Neurolysin (endopeptidase 24.16, thimet oligopeptidase)
species: Rat (Rattus norvegicus) [TaxId: 10116]