RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254780915|ref|YP_003065328.1| oligoendopeptidase F
[Candidatus Liberibacter asiaticus str. psy62]
         (626 letters)



>d1j36a_ d.92.1.5 (A:) Angiotensin converting enzyme, ACE {Fruit fly
           (Drosophila melanogaster) [TaxId: 7227]}
          Length = 598

 Score =  188 bits (477), Expect = 2e-48
 Identities = 67/556 (12%), Positives = 139/556 (25%), Gaps = 66/556 (11%)

Query: 91  IAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLD 150
           +    +       + + A  +Y   ++    +K   +I+A+LA F K +     +     
Sbjct: 7   LENLNKELAKRTNVETEAAWAYRSAITDENEKK-KNEISAELAKFMKEVASDTTKFQWRS 65

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIE 210
               +       LT    A +      +     + ME   +   +V            ++
Sbjct: 66  YQSEDLKRQFKALTKLGYAALPEDDYAELLDTLSAMESNFA-KVKVCDYKDSTKCDLALD 124

Query: 211 SLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
               ++         +     +      +                +  +    AK     
Sbjct: 125 PEIEEVI--------SKSRDHEELAYYWREFYDKAGTAVRSQFERYVELNTKAAKLNNFT 176

Query: 271 DR---WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY--------ELKKKW 319
                W    +         ++   +     Q       +    Y          +    
Sbjct: 177 SGAEAWLDEYEDDTFEQQLEDIFADIRPLYQQIHGYVRFRLRKHYGDAVVSETGPIPMHL 236

Query: 320 LKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTH------- 372
           L       W  +A +     +    +V+ ++  Q+Y     +M  + + FFT        
Sbjct: 237 LGNMWAQQWSEIADIVSPFPEKPLVDVSAEMEKQAY--TPLKMFQMGDDFFTSMNLTKLP 294

Query: 373 -----NWIDAPQYDGKGSGAFAHGTI--PSVHPYILLNYLGKPQDVMTLAHELGHGIHFV 425
                  I     DG+     A            I          + T+ HELGH  +F+
Sbjct: 295 QDFWDKSIIEKPTDGRDLVCHASAWDFYLIDDVRIKQCTRVTQDQLFTVHHELGHIQYFL 354

Query: 426 LSSET----QGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLN 481
                    +          + +  S+   T      +              N++     
Sbjct: 355 QYQHQPFVYRTGANPGFHEAVGDVLSLSVSTPKHLEKIGLLKDYVRDDEARINQLFLTAL 414

Query: 482 SIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMV 541
             +  + F     K        G++     N  + + + E  G    +   E        
Sbjct: 415 DKIVFLPFAFTMDKYR-WSLFRGEVDKANWNCAFWKLRDEYSGIEPPVVRSEKDFDAPAK 473

Query: 542 PHFIESSFY-------VYAYAF--GNCLVNSLY------------DIYKSNTVDCFKEKY 580
            H      Y       +  + F    C+    Y            DIY S         +
Sbjct: 474 YHISADVEYLRYLVSFIIQFQFYKSACIKAGQYDPDNVELPLDNCDIYGSARAG---AAF 530

Query: 581 LNILRAGNSKHYSELL 596
            N+L  G SK + + L
Sbjct: 531 HNMLSMGASKPWPDAL 546


>d1uzea_ d.92.1.5 (A:) Angiotensin converting enzyme, ACE {Human
           (Homo sapiens) [TaxId: 9606]}
          Length = 579

 Score =  182 bits (462), Expect = 8e-47
 Identities = 66/560 (11%), Positives = 145/560 (25%), Gaps = 83/560 (14%)

Query: 91  IAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLD 150
           + EY+R  +++    + A  +YN N+++ T  K     N ++A+       +  +    D
Sbjct: 9   VEEYDRTSQVVWNEYAEANWNYNTNITTET-SKILLQKNMQIANHTL---KYGTQARKFD 64

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSND----MECLLSDTSQVGREALKRFFC 206
              L+ +             IK ++ +++  L          +L D       A      
Sbjct: 65  VNQLQNT--------TIKRIIKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHP- 115

Query: 207 ENIESLRFKINDQKIPLTKAYKSFFDSDR------EVRKSAAKALSHTFNKSSHIFSFIT 260
                     N   + L     +   + R         +           +    +  + 
Sbjct: 116 ----------NGSCLQLEPDLTNVMATSRKYEDLLWAWEGWRDKAGRAILQFYPKYVELI 165

Query: 261 NTLAKDEEIQDR---WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRY----- 312
           N  A+     D    WR   +          +   +    +             Y     
Sbjct: 166 NQAARLNGYVDAGDSWRSMYETPSLEQDLERLFQELQPLYLNLHAYVRRALHRHYGAQHI 225

Query: 313 ---YELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEV----------ARDLVLQSYAKFS 359
                +    L       W  +  L          +            R +  ++   F+
Sbjct: 226 NLEGPIPAHLLGNMWAQTWSNIYDLVVPFPSAPSMDTTEAMLKQGWTPRRMFKEADDFFT 285

Query: 360 PQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHP--YILLNYLGKPQDVMTLAHE 417
               +     F +  +     DG+     A            I        +D++   HE
Sbjct: 286 SLGLLPVPPEFWNKSMLEKPTDGREVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVAHHE 345

Query: 418 LGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDS---------LLQAASSKEER 468
           +GH  +F +  +   +     +      A      L+  +         L     S E  
Sbjct: 346 MGHIQYF-MQYKDLPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHD 404

Query: 469 KILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFD 528
              L     D +  I        +  ++       G I     N+ W   + +  G    
Sbjct: 405 INFLMKMALDKIAFIPFSYLVDQWRWRVF-----DGSITKENYNQEWWSLRLKYQGLCPP 459

Query: 529 LSDLEYGSFWMMVPHFIESSFY-------VYAYAFGNCLVNSLYDIYKSNTVDCFK---- 577
           +   +         H   S  Y       +  + F   L  +       +  D ++    
Sbjct: 460 VPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHEALCQAAGHTGPLHKCDIYQSKEA 519

Query: 578 -EKYLNILRAGNSKHYSELL 596
            ++    ++ G S+ + E +
Sbjct: 520 GQRLATAMKLGFSRPWPEAM 539


>d2ajfa1 d.92.1.5 (A:19-615) Angiotensin converting enzyme 2, ACE2
           {Human (Homo sapiens) [TaxId: 9606]}
          Length = 597

 Score =  166 bits (421), Expect = 5e-42
 Identities = 70/557 (12%), Positives = 148/557 (26%), Gaps = 66/557 (11%)

Query: 91  IAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLD 150
           + ++    E +   +S A  +YN N++     +   +   K + F K     A      +
Sbjct: 11  LDKFNHEAEDLFYQSSLASWNYNTNITEEN-VQNMNNAGDKWSAFLKEQSTLAQMYPLQE 69

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSD-TSQVGREALKRFFCENI 209
              L                ++ +++    +LS D    L+   + +         C   
Sbjct: 70  IQNLT-----------VKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPD 118

Query: 210 ESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEI 269
                 + +  +    A    ++      +S    +          +  + N +A+    
Sbjct: 119 NPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHY 178

Query: 270 QDRWRKYEKIAD------SRHLSNNVEPYVIEALMQSVKNY--------------YPKTS 309
           +D    +    +        +    +   V     +    Y              YP   
Sbjct: 179 EDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYI 238

Query: 310 HRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAK----------FS 359
                L    L      FW  L  L          +V   +V Q++            F 
Sbjct: 239 SPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFV 298

Query: 360 PQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELG 419
                   + F  N +     + + +             + +L       D    AH   
Sbjct: 299 SVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILMCTKVTMDDFLTAHHEM 358

Query: 420 HGIHFVLSSETQGIL---TNNSSLTLAETASIFGETLTFDSL----LQAASSKEERKILL 472
             I + ++   Q  L     N     A    +     T   L    L +   +E+ +  +
Sbjct: 359 GHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEI 418

Query: 473 ANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDL 532
              ++  L  +      Y  E          G+IP  +  + W E ++E +G    +   
Sbjct: 419 NFLLKQALTIVGTLPFTYMLEKWRW--MVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHD 476

Query: 533 EYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFK-------------EK 579
           E       + H + + +    Y           +                        +K
Sbjct: 477 ETYCDPASLFH-VSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQK 535

Query: 580 YLNILRAGNSKHYSELL 596
             N+LR G S+ ++  L
Sbjct: 536 LFNMLRLGKSEPWTLAL 552


>d1i1ip_ d.92.1.5 (P:) Neurolysin (endopeptidase 24.16, thimet
           oligopeptidase) {Rat (Rattus norvegicus) [TaxId: 10116]}
          Length = 665

 Score = 40.1 bits (93), Expect = 5e-04
 Identities = 37/209 (17%), Positives = 61/209 (29%), Gaps = 35/209 (16%)

Query: 408 PQDVMTLAHELGHGIHFVL-SSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKE 466
             +V T  HE GH +H +   ++       N      E  S   E   +D       SK 
Sbjct: 453 HDEVRTYFHEFGHVMHQICAQTDFARFSGTNVETDFVEVPSQMLENWVWDVDSLRKLSKH 512

Query: 467 ER--KILLANKIEDMLN--------SIVRQISFYDFELKLHTERRSTGDIPTHRINEIWL 516
            +    +    +E ++           +RQI     +  LHT         T      + 
Sbjct: 513 YKDGHPITDELLEKLVASRLVNTGLLTLRQIVLSKVDQSLHTN-------ATLDAASEYA 565

Query: 517 ETQKESLGPAFDLSDLEYGSFWMMVPHFIE--SSFYVYAYAFGNCLVNSLY-------DI 567
           +   E LG A         +F     H        Y Y Y +       ++        I
Sbjct: 566 KYCTEILGVAATPGTNMPATF----GHLAGGYDGQY-YGYLWSEVFSMDMFHSCFKKEGI 620

Query: 568 YKSNTVDCFKEKYLNILRAGNSKHYSELL 596
                   ++     IL+ G S    ++L
Sbjct: 621 MNPEVGMKYRN---LILKPGGSLDGMDML 646


>d1s4bp_ d.92.1.5 (P:) Neurolysin (endopeptidase 24.16, thimet
           oligopeptidase) {Human (Homo sapiens) [TaxId: 9606]}
          Length = 654

 Score = 40.1 bits (93), Expect = 6e-04
 Identities = 43/262 (16%), Positives = 75/262 (28%), Gaps = 54/262 (20%)

Query: 374 WIDAPQYDGKGSGAFAHGTIPSV--------HPYILLNY-----------LGKPQDVMTL 414
           ++D    +GK   A   G  P               +             L +  +V T 
Sbjct: 389 YLDLYPREGKYGHAACFGLQPGCLRQDGSRQIAIAAMVANFTKPTADAPSLLQHDEVETY 448

Query: 415 AHELGHGIHFVLSSETQGILT-NNSSLTLAETASIFGETLTFDSLLQA-----ASSKEER 468
            HE GH +H + S     + +  +      E  S   E   ++            +    
Sbjct: 449 FHEFGHVMHQLCSQAEFAMFSGTHVERDFVEAPSQMLENWVWEQEPLLRMSRHYRTGSAV 508

Query: 469 KILLANKIEDMLNS-----IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESL 523
              L  K+ +   +      +RQI     +  LHT+             E +    +E L
Sbjct: 509 PRELLEKLIESRQANTGLFNLRQIVLAKVDQALHTQ-------TDADPAEEYARLCQEIL 561

Query: 524 GPAFDLSDLEYGSFWMMVPHFI--ESSFYVYAYAFGNCLVNSLY-------DIYKSNTVD 574
           G           +F     H      + Y Y Y +       ++        +  S    
Sbjct: 562 GVPATPGTNMPATF----GHLAGGYDAQY-YGYLWSEVYSMDMFHTRFKQEGVLNSKVGM 616

Query: 575 CFKEKYLNILRAGNSKHYSELL 596
            ++     ILR G S+  S +L
Sbjct: 617 DYRS---CILRPGGSEDASAML 635


>d1mbaa_ a.1.1.2 (A:) Myoglobin {Slug sea hare (Aplysia limacina)
           [TaxId: 6502]}
          Length = 146

 Score = 32.0 bits (72), Expect = 0.15
 Identities = 16/145 (11%), Positives = 39/145 (26%), Gaps = 19/145 (13%)

Query: 179 KHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFF-DSDREV 237
             L       + ++ +  G + L   F +              P +  + + F       
Sbjct: 7   ADLAGKSWAPVFANKNANGLDFLVALFEKF-------------PDSANFFADFKGKSVAD 53

Query: 238 RKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEAL 297
            K++ K    + ++     +   N  A   ++     ++ K      + +     V    
Sbjct: 54  IKASPKLRDVS-SRIFTRLNEFVNNAANAGKMSAMLSQFAKEHVGFGVGSAQFENVRSMF 112

Query: 298 MQSVKNYYPKTSHRYYELKKKWLKL 322
              V +     +         W KL
Sbjct: 113 PGFVASVAAPPA----GADAAWTKL 133


>d1kjpa_ d.92.1.2 (A:) Thermolysin {Bacillus thermoproteolyticus
           [TaxId: 1427]}
          Length = 316

 Score = 30.7 bits (69), Expect = 0.34
 Identities = 22/100 (22%), Positives = 37/100 (37%), Gaps = 18/100 (18%)

Query: 370 FTHNWIDAPQYDGKGSG-------------AFAHGTIPSVHPYILLNYLGKPQDVMTLAH 416
           +  N  +   YDG  +              AF +G+           ++     +  +AH
Sbjct: 83  YYKNVHNRLSYDGNNAAIRSSVHYSQGYNNAFWNGSQMVYGDGDGQTFIPLSGGIDVVAH 142

Query: 417 ELGHGIHFVLSSETQGILTNNSSLTLAETAS-IFGETLTF 455
           EL H +    +  T G++  N S  + E  S IFG  + F
Sbjct: 143 ELTHAV----TDYTAGLIYQNESGAINEAISDIFGTLVEF 178


>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein
           1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]}
          Length = 1207

 Score = 30.1 bits (66), Expect = 0.58
 Identities = 17/170 (10%), Positives = 50/170 (29%), Gaps = 10/170 (5%)

Query: 175 RKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSD 234
             + K +       +        +        + +      + +    +         S 
Sbjct: 125 ANVCKKITGRLTSAIAKQEDVSVQLEALDIMADMLSRQGGLLVNFHPSILTCLLPQLTSP 184

Query: 235 RE-VRKSAAKALSHTFNKSS-----HIFSFITNTLAKDEEIQDRWRKYEKIAD-SRHLSN 287
           R  VRK    AL H            +   + + L+K++ +       + IA  SR   +
Sbjct: 185 RLAVRKRTIIALGHLVMSCGNIVFVDLIEHLLSELSKNDSMSTTRTYIQCIAAISRQAGH 244

Query: 288 NVEPY---VIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPL 334
            +  Y   +I  +++       +      +  + +++      +  ++ +
Sbjct: 245 RIGEYLEKIIPLVVKFCNVDDDELREYCIQAFESFVRRCPKEVYPHVSTI 294


>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter
           vinelandii [TaxId: 354]}
          Length = 233

 Score = 28.9 bits (64), Expect = 1.3
 Identities = 17/117 (14%), Positives = 37/117 (31%), Gaps = 5/117 (4%)

Query: 131 KLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLL 190
            L   E   +   +      E L + +  +D L   Y        ++ + +   D +   
Sbjct: 97  ALMFDEDREVRITVADRLPLEQLEQMAADRDYLVRAYVVQRIPPGRLFRFMRDEDRQVRK 156

Query: 191 SDTSQVGREALKRFFCENIESLRFKINDQKIP--LTKAYKSFFDSDREVRKSAAKAL 245
               ++  E+L     +    +R  +  +     L +      D D  VR +A +  
Sbjct: 157 LVAKRLPEESLGLMTQDPEPEVRRIVASRLRGDDLLELLH---DPDWTVRLAAVEHA 210


>d1w27a_ a.127.1.2 (A:) Phenylalanine ammonia-lyase, PAL {Parsley
           (Petroselinum crispum), PAL1 [TaxId: 4043]}
          Length = 692

 Score = 28.8 bits (64), Expect = 1.4
 Identities = 22/155 (14%), Positives = 53/155 (34%), Gaps = 19/155 (12%)

Query: 78  ATNQKNCHSLGAAIAEY-ERICELIGRIASYAMLSYNCNL--------SSPTIRKFYTDI 128
             + ++ +SLG   +       E++  +++  ++     +           T++   + +
Sbjct: 460 EQHNQDVNSLGLISSRKTSEAVEILKLMSTTFLVGLCQAIDLRHLEENLKSTVKNTVSSV 519

Query: 129 NAKLADFEK--VL---IFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLS 183
             ++        L    F   ++  + +     +Y  DP +  Y    K  + + +H L 
Sbjct: 520 AKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRQTLVEHALK 579

Query: 184 NDMECLLSDTSQVG-----REALKRFFCENIESLR 213
           N        TS         + LK    + +ES R
Sbjct: 580 NGDNERNLSTSIFQKIATFEDELKALLPKEVESAR 614


>d1s6ya2 d.162.1.2 (A:173-445) 6-phospho-beta-glucosidase {Bacillus
           stearothermophilus [TaxId: 1422]}
          Length = 270

 Score = 28.7 bits (64), Expect = 1.4
 Identities = 12/76 (15%), Positives = 19/76 (25%), Gaps = 1/76 (1%)

Query: 256 FSFITNTLAKDEEIQDR-WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYE 314
             F  +      E+ ++          S     N+     E          P   HRYY 
Sbjct: 31  MVFGLHVYLDGVEVTEKVIDLVAHPDRSGVTMKNIVDLGWEPDFLKGLKVLPCPYHRYYF 90

Query: 315 LKKKWLKLDTMYFWDR 330
              K L  +      +
Sbjct: 91  QTDKMLAEELEAAKTK 106


>d1of5a_ d.17.4.2 (A:) NTF2-like domain of mRNA export factor MEX67
           {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
          Length = 221

 Score = 28.8 bits (64), Expect = 1.4
 Identities = 18/108 (16%), Positives = 37/108 (34%), Gaps = 22/108 (20%)

Query: 225 KAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQD-----RWRKYEKI 279
             + + +D++RE   +     S         FS   ++      + D      +  Y  +
Sbjct: 19  TNFLNLWDNNREQLLNLYSPQS--------QFSVSVDSTIPPSTVTDSDQTPAFGYY--M 68

Query: 280 ADSRHLSNNVEPYVIEALMQ-------SVKNYYPKTSHRYYELKKKWL 320
           + SR++S       I+  +        S+    PKT H   E   ++ 
Sbjct: 69  SSSRNISKVSSEKSIQQRLSIGQESINSIFKTLPKTKHHLQEQPNEYS 116


>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli
           [TaxId: 562]}
          Length = 276

 Score = 28.3 bits (61), Expect = 1.9
 Identities = 13/128 (10%), Positives = 29/128 (22%), Gaps = 10/128 (7%)

Query: 187 ECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALS 246
             L    S     +           L+ +     + L   +    D +   R   A  L 
Sbjct: 26  RLLDDHNSLKRISS--------ARVLQLRGGQDAVRLAIEF--CSDKNYIRRDIGAFILG 75

Query: 247 HTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYP 306
                     +            +    +   I  +         Y  + + QS    + 
Sbjct: 76  QIKICKKCEDNVFNILNNMALNDKSACVRATAIESTAQRCKKNPIYSPKIVEQSQITAFD 135

Query: 307 KTSHRYYE 314
           K+++    
Sbjct: 136 KSTNVRRA 143


>d1up7a2 d.162.1.2 (A:163-415) 6-phospho-beta-glucosidase
           {Thermotoga maritima [TaxId: 2336]}
          Length = 253

 Score = 28.3 bits (63), Expect = 1.9
 Identities = 13/66 (19%), Positives = 26/66 (39%), Gaps = 5/66 (7%)

Query: 256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYEL 315
            SFI     K E++ ++  +  K+  S     +   +  +++             RYY +
Sbjct: 31  LSFIEKVFVKGEDVTEKVFENLKLKLSNIPDEDFPTWFYDSV-----RLIVNPYLRYYLM 85

Query: 316 KKKWLK 321
           +KK  K
Sbjct: 86  EKKMFK 91


>d2vgla_ a.118.1.10 (A:) Adaptin alpha C subunit N-terminal fragment
           {Mouse (Mus musculus) [TaxId: 10090]}
          Length = 584

 Score = 27.8 bits (61), Expect = 2.6
 Identities = 13/94 (13%), Positives = 27/94 (28%), Gaps = 3/94 (3%)

Query: 233 SDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPY 292
           +    ++     +S   N +S +   I N +  D  +  R            ++N     
Sbjct: 78  NRYTEKQIGYLFISVLVNSNSELIRLINNAIKND--LASR-NPTFMGLALHCIANVGSRE 134

Query: 293 VIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMY 326
           + EA    +              +   L L  +Y
Sbjct: 135 MAEAFAGEIPKILVAGDTMDSVKQSAALCLLRLY 168


>d1or7c_ a.180.1.1 (C:) N-terminal, cytoplasmic domain of
           anti-sigmaE factor RseA {Escherichia coli [TaxId: 562]}
          Length = 66

 Score = 27.4 bits (61), Expect = 3.4
 Identities = 10/26 (38%), Positives = 13/26 (50%)

Query: 259 ITNTLAKDEEIQDRWRKYEKIADSRH 284
           + N LA + E+Q  W  Y  I DS  
Sbjct: 19  LLNELAHNPEMQKTWESYHLIRDSMR 44


>d1bqba_ d.92.1.2 (A:) Aureolysin {Staphylococcus aureus [TaxId:
           1280]}
          Length = 301

 Score = 27.3 bits (60), Expect = 3.8
 Identities = 12/42 (28%), Positives = 21/42 (50%), Gaps = 5/42 (11%)

Query: 410 DVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETAS-IFG 450
               +AHE+ HG+    + +T  +   + S  L E+ S +FG
Sbjct: 138 ANDVVAHEITHGV----TQQTANLEYKDQSGALNESFSDVFG 175


>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein
           phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId:
           9606]}
          Length = 588

 Score = 27.1 bits (58), Expect = 4.5
 Identities = 18/106 (16%), Positives = 35/106 (33%), Gaps = 7/106 (6%)

Query: 175 RKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKI--PLTKAYKSFFD 232
           ++     +   +  +  D + + R           E     I  + +   + +      D
Sbjct: 474 KEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAG---D 530

Query: 233 SDREVRKSAAKALSHTFNK--SSHIFSFITNTLAKDEEIQDRWRKY 276
               VR + AK+L        +S + S +   L K  + QD   KY
Sbjct: 531 PVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKY 576


>d2vglb_ a.118.1.10 (B:) Adaptin beta subunit N-terminal fragment
           {Human (Homo sapiens) [TaxId: 9606]}
          Length = 579

 Score = 27.0 bits (59), Expect = 5.0
 Identities = 10/79 (12%), Positives = 23/79 (29%), Gaps = 3/79 (3%)

Query: 232 DSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEP 291
             + E++K     L +       +     N+  KD   +D      +    R +      
Sbjct: 57  TDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKD--CEDP-NPLIRALAVRTMGCIRVD 113

Query: 292 YVIEALMQSVKNYYPKTSH 310
            + E L + ++        
Sbjct: 114 KITEYLCEPLRKCLKDEDP 132


>d1hlma_ a.1.1.2 (A:) Hemoglobin, different isoforms {Caudina
           arenicola, also known as Molpadia arenicola [TaxId:
           7698]}
          Length = 158

 Score = 27.0 bits (59), Expect = 5.0
 Identities = 17/144 (11%), Positives = 47/144 (32%), Gaps = 16/144 (11%)

Query: 179 KHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVR 238
           K L+ +  + L++  +    +   R F  +  + R             +           
Sbjct: 17  KDLIRSTWDQLMTHRTGFVADVFIRIFHNDPTAQRK------------FPQMAGLSPAEL 64

Query: 239 KSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALM 298
           +++ +  +H    S+ + ++I       E + +      +  D  H+         + LM
Sbjct: 65  RTSRQMHAHAIRVSALMTTYIDEM--DTEVLPELLATLTRTHDKNHVGKKNYDLFGKVLM 122

Query: 299 QSVKNYYPKTSHRYYELKKKWLKL 322
           +++K        +  ++   W K 
Sbjct: 123 EAIKAELGVGFTK--QVHDAWAKT 144


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.319    0.134    0.396 

Gapped
Lambda     K      H
   0.267   0.0556    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 2,351,155
Number of extensions: 111272
Number of successful extensions: 393
Number of sequences better than 10.0: 1
Number of HSP's gapped: 372
Number of HSP's successfully gapped: 36
Length of query: 626
Length of database: 2,407,596
Length adjustment: 91
Effective length of query: 535
Effective length of database: 1,158,166
Effective search space: 619618810
Effective search space used: 619618810
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 56 (25.7 bits)