RPSBLAST alignment for GI: 254780917 and conserved domain: TIGR00630

>gnl|CDD|161968 TIGR00630, uvra, excinuclease ABC, A subunit. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). Length = 924
 Score = 53.9 bits (130), Expect = 1e-07
 Identities = 29/79 (36%), Positives = 44/79 (55%), Gaps = 4/79 (5%)

Query: 484 GENGSNLSGGQKQRIAIARAML-RDGH--ILVLDEATSALDTHTENLVRQALSRLM-QGR 539
           G+  + LSGG+ QRI +A+ +  R     + +LDE T+ L       + + L RL+ QG 
Sbjct: 823 GQPATTLSGGEAQRIKLAKELSKRSTGRTLYILDEPTTGLHFDDIKKLLEVLQRLVDQGN 882

Query: 540 TTIVIAHRISTIIEADHII 558
           T +VI H +  I  AD+II
Sbjct: 883 TVVVIEHNLDVIKTADYII 901