RPSBLAST alignment for GI: 254780917 and conserved domain: TIGR01978

>gnl|CDD|162636 TIGR01978, sufC, FeS assembly ATPase SufC. SufC is part of the SUF system, shown in E. coli to consist of six proteins and believed to act in Fe-S cluster formation during oxidative stress. SufC forms a complex with SufB and SufD. SufC belongs to the ATP-binding cassette transporter family (pfam00005) but is no longer thought to be part of a transporter. The complex is reported as cytosolic (PubMed:12554644) or associated with the membrane (PubMed:11943156). The SUF system also includes a cysteine desulfurase (SufS, enhanced by SufE) and a probable iron-sulfur cluster assembly scaffold protein, SufA. Length = 243
 Score = 70.0 bits (172), Expect = 2e-12
 Identities = 59/221 (26%), Positives = 108/221 (48%), Gaps = 23/221 (10%)

Query: 367 PVLSGINLCFKSGKMTALVGPSGSGKSTIINLLM--RMYDPSSGSIEIDGINIRDIT--- 421
            +L G+NL  K G++ A++GP+GSGKST+   +     Y+ +SG+I   G ++ ++    
Sbjct: 14  EILKGVNLTVKKGEIHAIMGPNGSGKSTLSKTIAGHPSYEVTSGTILFKGQDLLELEPDE 73

Query: 422 ------FSSLR--ERISYVGQDVFLFSNTVRYNILIGRPMATEEEMIEIAKSANAHDFIM 473
                 F + +  E I  V    FL S     N           ++++  K   A   ++
Sbjct: 74  RARAGLFLAFQYPEEIPGVSNLEFLRSA---LNARRSARGEEPLDLLDFLKLLKAKLALL 130

Query: 474 SLPQGY-DTYVGENGSNLSGGQKQRIAIARAMLRDGHILVLDEATSALDTHTENLVRQAL 532
            + + + +  V E     SGG+K+R  I +  L +  + +LDE  S LD     +V + +
Sbjct: 131 GMDEEFLNRSVNE---GFSGGEKKRNEILQMALLEPKLAILDEIDSGLDIDALKIVAEGI 187

Query: 533 SRLM-QGRTTIVIAH--RISTIIEADHIIFIEDGKVSESGD 570
           +RL    R+ ++I H  R+   I+ D++  + DG++ +SGD
Sbjct: 188 NRLREPDRSFLIITHYQRLLNYIKPDYVHVLLDGRIVKSGD 228