RPSBLAST alignment for GI: 254780917 and conserved domain: PLN03073

>gnl|CDD|178622 PLN03073, PLN03073, ABC transporter F family; Provisional. Length = 718
 Score = 61.0 bits (148), Expect = 9e-10
 Identities = 66/225 (29%), Positives = 99/225 (44%), Gaps = 45/225 (20%)

Query: 355 FRDVFFSYKQGHPVLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEIDG 414
           F D  F Y  G  +   +N         A+VGP+G GKSTI+ L+     PSSG++    
Sbjct: 511 FSDASFGYPGGPLLFKNLNFGIDLDSRIAMVGPNGIGKSTILKLISGELQPSSGTV---- 566

Query: 415 INIRDITFSSLRERISYVGQD----VFLFSNTVRYNILIGRPMATEEEMIEIAKSANAHD 470
                  F S + R++   Q     + L SN + Y ++   P   E+++        AH 
Sbjct: 567 -------FRSAKVRMAVFSQHHVDGLDLSSNPLLY-MMRCFPGVPEQKL-------RAH- 610

Query: 471 FIMSLPQGYDTYVGENGS-------NLSGGQKQRIAIARAMLRDGHILVLDEATSALDTH 523
            + S         G  G+        LSGGQK R+A A+   +  HIL+LDE ++ LD  
Sbjct: 611 -LGSF--------GVTGNLALQPMYTLSGGQKSRVAFAKITFKKPHILLLDEPSNHLDLD 661

Query: 524 TENLVRQALSRLMQGRTTIVI--AHRISTIIEADHIIFIEDGKVS 566
               + Q L  L QG   +V    H IS  +  D +  + +GKV+
Sbjct: 662 AVEALIQGLV-LFQGGVLMVSHDEHLISGSV--DELWVVSEGKVT 703