RPSBLAST alignment for GI: 254780917 and conserved domain: PRK11264

>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional. Length = 250
 Score =  105 bits (263), Expect = 4e-23
 Identities = 75/226 (33%), Positives = 117/226 (51%), Gaps = 21/226 (9%)

Query: 364 QGHPVLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEIDGINI---RDI 420
            G  VL GI+L  K G++ A++GPSGSGK+T++  +  +  P +G+I +  I I   R +
Sbjct: 14  HGQTVLHGIDLEVKPGEVVAIIGPSGSGKTTLLRCINLLEQPEAGTIRVGDITIDTARSL 73

Query: 421 T-----FSSLRERISYVGQDVFLFSN-TVRYNILIGRPMATEEEMIEIAKSANAHDFIMS 474
           +        LR+ + +V Q+  LF + TV  NI+ G  +   E   E    A      + 
Sbjct: 74  SQQKGLIRQLRQHVGFVFQNFNLFPHRTVLENIIEGPVIVKGEPKEEATARARELLAKVG 133

Query: 475 LPQGYDTYVGENGSNLSGGQKQRIAIARAMLRDGHILVLDEATSALDTHTENLVRQALSR 534
           L     +Y       LSGGQ+QR+AIARA+     +++ DE TSALD     LV + L+ 
Sbjct: 134 LAGKETSY----PRRLSGGQQQRVAIARALAMRPEVILFDEPTSALDPE---LVGEVLNT 186

Query: 535 LMQ----GRTTIVIAHRISTIIE-ADHIIFIEDGKVSESGDQKYLL 575
           + Q     RT +++ H +S   + AD  IF++ G++ E G  K L 
Sbjct: 187 IRQLAQEKRTMVIVTHEMSFARDVADRAIFMDQGRIVEQGPAKALF 232