RPSBLAST alignment for GI: 254780917 and conserved domain: PRK11819

>gnl|CDD|183324 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed. Length = 556
 Score = 47.8 bits (115), Expect = 8e-06
 Identities = 47/197 (23%), Positives = 76/197 (38%), Gaps = 54/197 (27%)

Query: 362 YKQGHPVLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEI-DGINIRDI 420
                 +L  I+L F  G    ++G +G+GKST++ ++  +     G      GI     
Sbjct: 16  VPPKKQILKDISLSFFPGAKIGVLGLNGAGKSTLLRIMAGVDKEFEGEARPAPGI----- 70

Query: 421 TFSSLRERISYVGQDVFL-FSNTVRYNIL---------------IGRPMATE-------- 456
                  ++ Y+ Q+  L    TVR N+                I    A          
Sbjct: 71  -------KVGYLPQEPQLDPEKTVRENVEEGVAEVKAALDRFNEIYAAYAEPDADFDALA 123

Query: 457 EEM---IEIAKSANAHDF---------IMSLPQGYDTYVGENGSNLSGGQKQRIAIARAM 504
            E     EI  +A+A D           +  P   D  V    + LSGG+++R+A+ R +
Sbjct: 124 AEQGELQEIIDAADAWDLDSQLEIAMDALRCPPW-DAKV----TKLSGGERRRVALCRLL 178

Query: 505 LRDGHILVLDEATSALD 521
           L    +L+LDE T+ LD
Sbjct: 179 LEKPDMLLLDEPTNHLD 195