RPSBLAST alignment for GI: 254780917 and conserved domain: PRK13648

>gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional. Length = 269
 Score =  104 bits (262), Expect = 5e-23
 Identities = 75/244 (30%), Positives = 112/244 (45%), Gaps = 34/244 (13%)

Query: 354 VFRDVFFSYKQGHPVLSGINLCFK--SGKMTALVGPSGSGKSTIINLLMRMYDPSSGSIE 411
           VF++V F Y Q     +  ++ F    G+ T++VG +GSGKSTI  L++ +    SG I 
Sbjct: 9   VFKNVSFQY-QSDASFTLKDVSFNIPKGQWTSIVGHNGSGKSTIAKLMIGIEKVKSGEIF 67

Query: 412 IDGINIRDITFSSLRERISYVGQD---VFLFSNTVRYNILIG--RPMATEEEMIEIAKSA 466
            +   I D  F  LR+ I  V Q+    F+ S  V+Y++  G        +EM      A
Sbjct: 68  YNNQAITDDNFEKLRKHIGIVFQNPDNQFVGS-IVKYDVAFGLENHAVPYDEMHRRVSEA 126

Query: 467 ----NAHDFIMSLPQGYDTYVGENGSNLSGGQKQRIAIARAMLRDGHILVLDEATSALDT 522
               +  +     P             LSGGQKQR+AIA  +  +  +++LDEATS LD 
Sbjct: 127 LKQVDMLERADYEPN-----------ALSGGQKQRVAIAGVLALNPSVIILDEATSMLDP 175

Query: 523 HTENLVRQALSRLMQ------GRTTIVIAHRISTIIEADHIIFIEDGKVSESGDQKYLLQ 576
                 RQ L  L++        T I I H +S  +EADH+I +  G V + G    +  
Sbjct: 176 DA----RQNLLDLVRKVKSEHNITIISITHDLSEAMEADHVIVMNKGTVYKEGTPTEIFD 231

Query: 577 QKDG 580
             + 
Sbjct: 232 HAEE 235