HHsearch alignment for GI: 254780918 and conserved domain: cd06427

>cd06427 CESA_like_2 CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis prot
Probab=99.96  E-value=9.3e-29  Score=194.46  Aligned_cols=195  Identities=18%  Similarity=0.244  Sum_probs=138.6

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHCCCCC--EEEEEECCCCCHHHHHHHHHHHHHHC-CCEEEEECCCCCCHHHHHHH
Q ss_conf             9789997475898889999999998288997--48999877578067999999988757-98899980888856489999
Q gi|254780918|r   67 PLISVIMPVYKIKKEWLEMAIESVRSQIYSH--WELCIAEDCSGDIETVSLLKKYANMD-SRIKVVFRAKNGHISAASNS  143 (623)
Q Consensus        67 P~iSIiip~yn~~~~~L~~~i~Si~~Qty~~--~EliivdD~S~d~~~~~~l~~~~~~d-~ri~~~~~~~n~g~~~a~N~  143 (623)
T Consensus         1 P~vsViIPa~NE-~~vI~~ti~sl~~~~YP~~~~evivv~d~s~~-~t~~~~~~~~~~~~~~~~~~~~~~~~gK~~alN~   78 (241)
T cd06427           1 PVYTILVPLYKE-AEVLPQLIASLSALDYPRSKLDVKLLLEEDDE-ETIAAARALRLPSIFRVVVVPPSQPRTKPKACNY   78 (241)
T ss_pred             CEEEEEEECCCC-HHHHHHHHHHHHHCCCCCCCEEEEEEECCCCH-HHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHH
T ss_conf             949999966898-89999999999967999761799999889996-8999999857876708999638988746999999


Q ss_pred             HHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHH-CCCCCCCCCCCEEECCCCCEEEECCCCCCC----H-----HHHCCC
Q ss_conf             999659989999769875273207999999873-247554202220675898365422566789----6-----674147
Q gi|254780918|r  144 AAQLATSEWLALLDHDDLLHPTALYYVADAINN-NPNAEIIYSDEDKINENQIRSGPYFKYDFN----P-----ELFHVH  213 (623)
Q Consensus       144 ~l~~a~Ge~i~~lD~DD~l~p~~L~~~~~~l~~-~p~~~~iYsDe~~i~~~g~~~~p~fkp~~~----~-----~~l~s~  213 (623)
T Consensus        79 al~~a~gd~v~~~DAD~~~~p~~L~~~v~~f~~~~~~v~~v~~~~~~~n~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~  158 (241)
T cd06427          79 ALAFARGEYVVIYDAEDAPDPDQLKKAVAAFARLDDKLACVQAPLNYYNARENWLTRMFALEYAAWFDYLLPGLARLGLP  158 (241)
T ss_pred             HHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEEECEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCE
T ss_conf             99961588599978655649779999999998579855777331674589998899988999999999999999966993


Q ss_pred             -CCCCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHCCCCCCEEECCCCEE
Q ss_conf             -85431457689999971887898773027413678864248752200684227
Q gi|254780918|r  214 -NMITHLGVYRTETFKKIGGFREKFEGAQDYDLVLRFLENIDLSQIIHIPRVLY  266 (623)
Q Consensus       214 -nyi~~~~~~rr~~~~~iGgf~~~~~~~~D~Dl~lR~~~~~~~~~i~hip~vLy  266 (623)
T Consensus       159 ~~~~G~~~~~Rr~~l~~vGg~~~~-~~tED~dl~~rl~~~G--~ri~~~~~~~~  209 (241)
T cd06427         159 IPLGGTSNHFRTDVLRELGGWDPF-NVTEDADLGLRLARAG--YRTGVLNSTTL  209 (241)
T ss_pred             EECCCCHHHHHHHHHHHHCCCCCC-CCCCHHHHHHHHHHCC--CEEEECCCCEE
T ss_conf             433872687799999980999887-6464799999999869--94985375442