>cd06442 DPM1_like DPM1_like represents putative enzymes similar to eukaryotic DPM1. Proteins similar to eukaryotic DPM1, including enzymes from bacteria and archaea; DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi,

Probab=99.83 E-value=7.4e-20 Score=139.93 Aligned_cols=111 Identities=19% Similarity=0.338 Sum_probs=65.8 Q ss_pred EEECCCCCCHHHHHHHHHHHHHCC-CCCEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHCC Q ss_conf 997475898889999999998288-9974899987757806799999998875798899980888856489999999659 Q gi|254780918|r 71 VIMPVYKIKKEWLEMAIESVRSQI-YSHWELCIAEDCSGDIETVSLLKKYANMDSRIKVVFRAKNGHISAASNSAAQLAT 149 (623) Q Consensus 71 Iiip~yn~~~~~L~~~i~Si~~Qt-y~~~EliivdD~S~d~~~~~~l~~~~~~d~ri~~~~~~~n~g~~~a~N~~l~~a~ 149 (623) T Consensus 1 IIIP~yN-Ee~~i~~~l~~i~~~~~~~~~eIIvVdDgStD-~T~~i~~~l~~~~~~~~~i~~~~n~G~g~Ai~~G~~~a~ 78 (224) T cd06442 1 IIIPTYN-ERENIPELIERLDAALKGIDYEIIVVDDNSPD-GTAEIVRELAKEYPRVRLIVRPGKRGLGSAYIEGFKAAR 78 (224) T ss_pred EEEEECC-CHHHHHHHHHHHHHHHCCCCEEEEEEECCCCC-CCHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHC T ss_conf 3999548-78889999999998606899499999896973-717888654224772478633667872799999998601 Q ss_pred CCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCC Q ss_conf 98999976987527320799999987324755420 Q gi|254780918|r 150 SEWLALLDHDDLLHPTALYYVADAINNNPNAEIIY 184 (623) Q Consensus 150 Ge~i~~lD~DD~l~p~~L~~~~~~l~~~p~~~~iY 184 (623) T Consensus 79 ~~~i~~~DaD~q~~p~~i~~li~~~~~~-~~d~V~ 112 (224) T cd06442 79 GDVIVVMDADLSHPPEYIPELLEAQLEG-GADLVI 112 (224) T ss_pred CCCEEEECCCCCCCHHHHHHHHHHHHCC-CCCEEE T ss_conf 7846886599976277789999998718-872479

HHsearch alignment for GI: 254780918 and conserved domain: cd06442