>gnl|CDD|133022 cd04179, DPM_DPG-synthase_like, DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily. Length = 185

 Score = 44.1 bits (105), Expect = 1e-04
 Identities = 16/69 (23%), Positives = 32/69 (46%), Gaps = 5/69 (7%)

Query: 328 IIIPTYNHHHLLKICLESIY-HKTTYSSFEVIIIDNLSDDSKTFLYLQKIQKKYPNLRVI 386
           ++IP YN    +   +E +         +E+I++D+ S D  T    +++  + P +RVI
Sbjct: 1   VVIPAYNEEENIPELVERLLAVLEEGYDYEIIVVDDGSTD-GTAEIARELAARVPRVRVI 59

Query: 387 TDNTHPFNY 395
                  N+
Sbjct: 60  ---RLSRNF 65