>gnl|CDD|133062 cd06442, DPM1_like, DPM1_like represents putative enzymes similar to eukaryotic DPM1. Proteins similar to eukaryotic DPM1, including enzymes from bacteria and archaea; DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. This protein family belongs to Glycosyltransferase 2 superfamily. Length = 224

 Score = 39.8 bits (94), Expect = 0.002
 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 5/61 (8%)

Query: 328 IIIPTYNHHHLLKICLESIYHKTTYSSFEVIIIDNLSDDSK--TFLYLQKIQKKYPNLRV 385
           IIIPTYN    +   +E +        +E+I++D   D+S   T   ++++ K+YP +R+
Sbjct: 1   IIIPTYNERENIPELIERLDAALKGIDYEIIVVD---DNSPDGTAEIVRELAKEYPRVRL 57

Query: 386 I 386
           I
Sbjct: 58  I 58