HHsearch alignment for GI: 254780921 and conserved domain: COG0136

>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism].
Probab=94.84  E-value=0.031  Score=31.78  Aligned_cols=86  Identities=20%  Similarity=0.294  Sum_probs=46.1

Q ss_pred             CEEEEECCCCHHHHHHHHHHHCCC-E-----EEEECHHH----CCCCC-----HHHHHHHHHHCCCCEEEECCCCCCCCC
Q ss_conf             949999788978899999996498-5-----99961367----08789-----999999997559989997863445432
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQDV-E-----IIRVGRPD----IDLLK-----PKDFASFFLSFSPDVIINPAAYTAVDK   65 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~~~-~-----v~~~~r~~----~D~~~-----~~~~~~~l~~~~pd~Vih~Aa~~~~~~   65 (290)
T Consensus         2 ~~VavvGATG~VG~~~~~~L~e~~f~~~~~~~~AS~rSaG~~~~~f~~~~~~v~~~~~~~~~~~~~Divf~~ag~~~---   78 (334)
T COG0136           2 LNVAVLGATGAVGQVLLELLEERHFPFEELVLLASARSAGKKYIEFGGKSIGVPEDAADEFVFSDVDIVFFAAGGSV---   78 (334)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCHHH---
T ss_conf             18999942355899999998753998405788852311577160106750357621134100124999999176687---


Q ss_pred             CCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             233221024201222110001122333333445532111
Q gi|254780921|r   66 AEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVF  104 (290)
Q Consensus        66 ~e~~~~~~~~~Nv~~~~~l~~~~~~~~~~~I~iSS~~Vy  104 (290)
T Consensus        79 ---------------s~~~~p~~~~~G~~VIdnsSa~Rm  102 (334)
T COG0136          79 ---------------SKEVEPKAAEAGCVVIDNSSAFRM  102 (334)
T ss_pred             ---------------HHHHHHHHHHCCCEEEECCCCCCC
T ss_conf             ---------------899999999769889968731115