HHsearch alignment for GI: 254780921 and conserved domain: COG0569

>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism].
Probab=96.11  E-value=0.028  Score=32.02  Aligned_cols=31  Identities=23%  Similarity=0.518  Sum_probs=27.5

Q ss_pred             CEEEEECCCCHHHHHHHHHHH-CCCEEEEECHH
Q ss_conf             949999788978899999996-49859996136
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCV-QDVEIIRVGRP   32 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~-~~~~v~~~~r~   32 (290)
T Consensus         1 m~iiIiG~-G~vG~~va~~L~~~g~~Vv~Id~d   32 (225)
T COG0569           1 MKIIIIGA-GRVGRSVARELSEEGHNVVLIDRD   32 (225)
T ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             98999898-578899999998789908999768