HHsearch alignment for GI: 254780921 and conserved domain: KOG1014

>KOG1014 consensus.
Probab=97.95  E-value=1.8e-05  Score=50.00  Aligned_cols=123  Identities=16%  Similarity=0.209  Sum_probs=80.9

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH----------------------CCCCCHH----HHHHHHHHCCCCEEE
Q ss_conf             999978897889999999-6498599961367----------------------0878999----999999755998999
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD----------------------IDLLKPK----DFASFFLSFSPDVII   55 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~----------------------~D~~~~~----~~~~~l~~~~pd~Vi   55 (290)
T Consensus        52 AVVTGaTDGIGKayA~eLAkrG~nvvLIsRt~~KL~~v~kEI~~~~~vev~~i~~Dft~~~~~ye~i~~~l~~~~VgILV  131 (312)
T KOG1014          52 AVVTGATDGIGKAYARELAKRGFNVVLISRTQEKLEAVAKEIEEKYKVEVRIIAIDFTKGDEVYEKLLEKLAGLDVGILV  131 (312)
T ss_pred             EEEECCCCCCHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHHHHHHHCCCCEEEEE
T ss_conf             99977888522999999997598799996888999999999988758079999986489815689999886278648999


Q ss_pred             ECCCCCC--CCC----CCCCCCEEEEECCCCCCCCCCC----CCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             7863445--432----2332210242012221100011----223333-3344553211135755442111122221110
Q gi|254780921|r   56 NPAAYTA--VDK----AEDEPEIAFSINAEGAGAIAKA----ADSIGI-PCIYISTDYVFDGLSRTPIDEFSPTNPLNIY  124 (290)
Q Consensus        56 h~Aa~~~--~~~----~e~~~~~~~~~Nv~~~~~l~~~----~~~~~~-~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Y  124 (290)
T Consensus       132 NNvG~~~~~P~~f~~~~~~~~~~ii~vN~~~~~~~t~~ilp~M~~r~~G~IvnigS~a---g~~p~p--------~~s~y  200 (312)
T KOG1014         132 NNVGMSYDYPESFLKYPEGELQNIINVNILSVTLLTQLILPGMVERKKGIIVNIGSFA---GLIPTP--------LLSVY  200 (312)
T ss_pred             ECCCCCCCCCHHHHHCCHHHHHHEEEEECCHHHHHHHHHHHHHHCCCCCEEEEECCCC---CCCCCH--------HHHHH
T ss_conf             6553167883778738556453146774326899998850555337886699822633---556671--------57887


Q ss_pred             HHHHHHHHHHHC
Q ss_conf             124566665310
Q gi|254780921|r  125 GKSKLAGEEKVA  136 (290)
Q Consensus       125 g~sK~~~E~~v~  136 (290)
T Consensus       201 sasK~~v~~~S~  212 (312)
T KOG1014         201 SASKAFVDFFSR  212 (312)
T ss_pred             HHHHHHHHHHHH
T ss_conf             787888888779