HHsearch alignment for GI: 254780921 and conserved domain: KOG1207

>KOG1207 consensus.
Probab=98.15  E-value=3.4e-06  Score=54.07  Aligned_cols=124  Identities=19%  Similarity=0.262  Sum_probs=88.2

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHHC------------------CCCCHHHHHHHHHHCCC-CEEEECCCCC
Q ss_conf             4999978897889999999-64985999613670------------------87899999999975599-8999786344
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPDI------------------DLLKPKDFASFFLSFSP-DVIINPAAYT   61 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~~------------------D~~~~~~~~~~l~~~~p-d~Vih~Aa~~   61 (290)
T Consensus         9 ~vlvTgagaGIG~~~v~~La~aGA~ViAvaR~~a~L~sLV~e~p~~I~Pi~~Dls~wea~~~~l~~v~pidgLVNNAgvA   88 (245)
T KOG1207           9 IVLVTGAGAGIGKEIVLSLAKAGAQVIAVARNEANLLSLVKETPSLIIPIVGDLSAWEALFKLLVPVFPIDGLVNNAGVA   88 (245)
T ss_pred             EEEEECCCCCCCHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHCCCCCHHHHHCCCHHH
T ss_conf             99960566641499999998668879999569889999985297642455751338999997614657513430350144


Q ss_pred             C--C--CCCCCCCCEEEEECCCCCCCCCCCC----CCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             5--4--3223322102420122211000112----23333--33445532111357554421111222211101245666
Q gi|254780921|r   62 A--V--DKAEDEPEIAFSINAEGAGAIAKAA----DSIGI--PCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAG  131 (290)
Q Consensus        62 ~--~--~~~e~~~~~~~~~Nv~~~~~l~~~~----~~~~~--~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~  131 (290)
T Consensus        89 ~~~pf~eiT~q~fDr~F~VNvravi~v~Q~var~lv~R~~~GaIVNvSSqa-----s~R~~~------nHtvYcatKaAL  157 (245)
T KOG1207          89 TNHPFGEITQQSFDRTFAVNVRAVILVAQLVARNLVDRQIKGAIVNVSSQA-----SIRPLD------NHTVYCATKAAL  157 (245)
T ss_pred             HCCHHHHHHHHHHCCEEEEEEEEEEEHHHHHHHHHHHCCCCCEEEEECCHH-----CCCCCC------CCEEEEECHHHH
T ss_conf             316378886876300045421222108999887666405886089740211-----036668------834775138789


Q ss_pred             HHHHC
Q ss_conf             65310
Q gi|254780921|r  132 EEKVA  136 (290)
Q Consensus       132 E~~v~  136 (290)
T Consensus       158 DmlTk  162 (245)
T KOG1207         158 DMLTK  162 (245)
T ss_pred             HHHHH
T ss_conf             99999