HHsearch alignment for GI: 254780921 and conserved domain: KOG1210

>KOG1210 consensus.
Probab=98.24  E-value=1.1e-05  Score=51.33  Aligned_cols=99  Identities=18%  Similarity=0.283  Sum_probs=73.8

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH-----------------------CCCCCHHHHHHHHHHC-----CCC
Q ss_conf             4999978897889999999-6498599961367-----------------------0878999999999755-----998
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD-----------------------IDLLKPKDFASFFLSF-----SPD   52 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~-----------------------~D~~~~~~~~~~l~~~-----~pd   52 (290)
T Consensus        35 hi~itggS~glgl~la~e~~~~ga~Vti~ar~~~kl~~a~~~l~l~~~~~~v~~~S~d~~~Y~~v~~~~~~l~~~~~~~d  114 (331)
T KOG1210          35 HILITGGSSGLGLALALECKREGADVTITARSGKKLLEAKAELELLTQVEDVSYKSVDVIDYDSVSKVIEELRDLEGPID  114 (331)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCC
T ss_conf             69981684156689999999703742999464878999874311444353036753553028999988763233048950


Q ss_pred             EEEECCCCCCCCCC----CCCCCEEEEECCCCCCCCCCCCC-------CCCCCCCCCCCC
Q ss_conf             99978634454322----33221024201222110001122-------333333445532
Q gi|254780921|r   53 VIINPAAYTAVDKA----EDEPEIAFSINAEGAGAIAKAAD-------SIGIPCIYISTD  101 (290)
Q Consensus        53 ~Vih~Aa~~~~~~~----e~~~~~~~~~Nv~~~~~l~~~~~-------~~~~~~I~iSS~  101 (290)
T Consensus       115 ~l~~cAG~~v~g~f~~~s~~~v~~~m~vNylgt~~v~~~~~~~mk~~~~~g-~I~~vsS~  173 (331)
T KOG1210         115 NLFCCAGVAVPGLFEDLSPEVVEKLMDVNYLGTVNVAKAAARAMKKREHLG-RIILVSSQ  173 (331)
T ss_pred             EEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC-EEEEEHHH
T ss_conf             278706765542001399999999887553446799999999863225684-79984332