HHsearch alignment for GI: 254780921 and conserved domain: KOG1371

>KOG1371 consensus.
Probab=100.00  E-value=1.5e-37  Score=230.64  Aligned_cols=272  Identities=19%  Similarity=0.238  Sum_probs=208.1

Q ss_pred             CEEEEECCCCHHHHHHH-HHHHCCCEEEEECH------------------------HHCCCCCHHHHHHHHHHCCCCEEE
Q ss_conf             94999978897889999-99964985999613------------------------670878999999999755998999
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLS-SMCVQDVEIIRVGR------------------------PDIDLLKPKDFASFFLSFSPDVII   55 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~-~~l~~~~~v~~~~r------------------------~~~D~~~~~~~~~~l~~~~pd~Vi   55 (290)
T Consensus         3 ~~VLVtGgaGyiGsht~l~L~~~gy~v~~vDNl~n~~~~sl~r~~~l~~~~~~v~f~~~Dl~D~~~L~kvF~~~~fd~V~   82 (343)
T KOG1371           3 KHVLVTGGAGYIGSHTVLALLKRGYGVVIVDNLNNSYLESLKRVRQLLGEGKSVFFVEGDLNDAEALEKLFSEVKFDAVM   82 (343)
T ss_pred             CEEEEECCCCCEEHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHCCCCCCEEEEEECCCCHHHHHHHHHHCCCCEEE
T ss_conf             37999668763105999999867981799824332124677889986278774389981566899999998633886577


Q ss_pred             ECCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCHHHHHHHHH
Q ss_conf             78634454322332210242012221100011223333-33445532111357554421111222-21110124566665
Q gi|254780921|r   56 NPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGI-PCIYISTDYVFDGLSRTPIDEFSPTN-PLNIYGKSKLAGEE  133 (290)
Q Consensus        56 h~Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~-~~I~iSS~~Vy~g~~~~p~~E~d~~~-P~~~Yg~sK~~~E~  133 (290)
T Consensus        83 Hfa~~~~vgeS~~~p~~Y~~nNi~gtlnlLe~~~~~~~~~~V~sssatvYG~p~~vp~te~~~t~~p~~pyg~tK~~iE~  162 (343)
T KOG1371          83 HFAALAAVGESMENPLSYYHNNIAGTLNLLEVMKAHNVKALVFSSSATVYGLPTKVPITEEDPTDQPTNPYGKTKKAIEE  162 (343)
T ss_pred             EEHHHHCCCHHHHCCHHHEEHHHHHHHHHHHHHHHCCCCEEEEECCEEEECCCCEECCCCCCCCCCCCCCCCHHHHHHHH
T ss_conf             62444133156628223100211468999999997598648884230463476432035768778888864013677999


Q ss_pred             HHCCCCCC----CCCCCCCCCEE--CCCC------CCCCEEE----CC-CCCCCCEEE--------CCCCCCCCCCHHHH
Q ss_conf             31012223----22355542000--3686------3200020----11-246652153--------04554544522368
Q gi|254780921|r  134 KVASYTNN----YVILRTAWVYS--IFGS------NFLLSML----RL-AKERREISV--------VCDQFGTPTSALQI  188 (290)
Q Consensus       134 ~v~~~~~~----~~IlR~~~vyG--~~~~------~~v~~~l----~~-~~~~~~i~~--------~~d~~~~p~~v~D~  188 (290)
T Consensus       163 i~~d~~~~~~~~~~~LRyfn~~ga~p~Gr~ge~p~~~~nnl~p~v~~vaigr~~~l~v~g~d~~t~dgt~vrdyi~v~Dl  242 (343)
T KOG1371         163 IIHDYNKAYGWKVTGLRYFNVIGAHPSGRIGEAPLGIPNNLLPYVFQVAIGRRPNLQVVGRDYTTIDGTIVRDYIHVLDL  242 (343)
T ss_pred             HHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHCCCCCCCEEECCCCCCCCCCEEECCEEEEEH
T ss_conf             76765314560479988425567665467788876675653401330000232452540476602179711232201664


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHCCCCHHEEECCHHHHCCCCCCCC---CCCCCH
Q ss_conf             99999999844202443344313762386667889999999999997279800057628588087689975---110086
Q gi|254780921|r  189 ARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTKQYPTKAHRPA---YSCLDC  265 (290)
Q Consensus       189 a~~i~~~~~~~~~~~~~~~~Giyn~~~~~~~~s~~e~a~~I~~~~~~~~~~~~~i~~~~~~~~~~~a~RP~---~~~Ld~  265 (290)
T Consensus       243 a~~h~~al~k~~~~~~---~~i~Nlgtg~-g~~V~~l----v~a~~k~~g~~~k~~~v--------~~R~gdv~~~ya~~  306 (343)
T KOG1371         243 ADGHVAALGKLRGAAE---FGVYNLGTGK-GSSVLEL----VTAFEKALGVKIKKKVV--------PRRNGDVAFVYANP  306 (343)
T ss_pred             HHHHHHHHHCCCCCCC---EEEEECCCCC-CCCHHHH----HHHHHHHHCCCCCCCCC--------CCCCCCCEEEEECH
T ss_conf             7788987642000000---3457604788-8229999----99999875579872003--------77899841465174


Q ss_pred             HHHHHHHCCCCC-CHHHHHHHHHH
Q ss_conf             899996178999-98999999997
Q gi|254780921|r  266 SKLANTHNIRIS-TWKEGVRNILV  288 (290)
Q Consensus       266 ~K~~~~lg~~~~-~~~e~i~~~i~  288 (290)
T Consensus       307 ~~a~~elgwk~~~~iee~c~dlw~  330 (343)
T KOG1371         307 SKAQRELGWKAKYGLQEMLKDLWR  330 (343)
T ss_pred             HHHHHHHCCCCCCCHHHHHHHHHH
T ss_conf             789998488642389999999999