HHsearch alignment for GI: 254780921 and conserved domain: KOG3019

>KOG3019 consensus.
Probab=98.06  E-value=1.6e-06  Score=56.00  Aligned_cols=260  Identities=16%  Similarity=0.112  Sum_probs=144.6

Q ss_pred             EEEECCCCHHHHHHHH-----HH-----HCCCEEEEECHHHC--CCCCHHHHHHHHHHC----CCCEEEECCCCCCCCCC
Q ss_conf             9999788978899999-----99-----64985999613670--878999999999755----99899978634454322
Q gi|254780921|r    3 CLVIGNNGQIAQSLSS-----MC-----VQDVEIIRVGRPDI--DLLKPKDFASFFLSF----SPDVIINPAAYTAVDKA   66 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~-----~l-----~~~~~v~~~~r~~~--D~~~~~~~~~~l~~~----~pd~Vih~Aa~~~~~~~   66 (290)
T Consensus        15 a~~~~~~g~i~~nl~~~~~~~H~t~~~~a~~h~vtv~sR~pg~~ritw~----e-l~~~Gip~sc~a~vna~g~n~----   85 (315)
T KOG3019          15 AVSNWSNGIIRENLGSETSCCHDTNVHSADNHAVTVLSRSPGKARITWP----E-LDFPGIPISCVAGVNAVGNNA----   85 (315)
T ss_pred             CCCCCCCCCHHCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCC----H-HCCCCCCEEHHHHHHHHHHHC----
T ss_conf             7887666403201367630012488886554316999648997523450----2-207998502687775665532----


Q ss_pred             CCCCCE----EEEECC-----CCCCCCCCCCCCCC--C-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             332210----242012-----22110001122333--3-33445532111357554421111222211101245666653
Q gi|254780921|r   67 EDEPEI----AFSINA-----EGAGAIAKAADSIG--I-PCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEK  134 (290)
Q Consensus        67 e~~~~~----~~~~Nv-----~~~~~l~~~~~~~~--~-~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~  134 (290)
T Consensus        86 -l~P~rRWsp~fqkev~gSRi~~t~~la~aI~~aPq~~~~~Vlv~gva~y~pS~s~eY~e~~~~qgfd~~srL~l~WE~a  164 (315)
T KOG3019          86 -LLPIRRWSPEFQKEVKGSRIRVTSKLADAINNAPQEARPTVLVSGVAVYVPSESQEYSEKIVHQGFDILSRLCLEWEGA  164 (315)
T ss_pred             -CCCHHHCCHHHHHHHHCCEEEHHHHHHHHHHCCCCCCCCEEEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             -4923216977887753242008899999985498878775898766886145110033226567757999998988887


Q ss_pred             HCCCCC--CCCCCCCCCCEECCCCCCCCEEEC--CCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             101222--322355542000368632000201--1246652153045545445223689999999984420244334431
Q gi|254780921|r  135 VASYTN--NYVILRTAWVYSIFGSNFLLSMLR--LAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGI  210 (290)
Q Consensus       135 v~~~~~--~~~IlR~~~vyG~~~~~~v~~~l~--~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~~Gi  210 (290)
T Consensus       165 A~~~~~~~r~~~iR~GvVlG~gGG-a~~~M~lpF~~g~GGPlG-sG~Q~fpWIHv~DL~~li~~ale~------~~v~GV  236 (315)
T KOG3019         165 ALKANKDVRVALIRIGVVLGKGGG-ALAMMILPFQMGAGGPLG-SGQQWFPWIHVDDLVNLIYEALEN------PSVKGV  236 (315)
T ss_pred             HHCCCCCEEEEEEEEEEEEECCCC-CHHHHHHHHHHCCCCCCC-CCCEEEEEEEHHHHHHHHHHHHHC------CCCCCE
T ss_conf             634676404799997579833874-012322222303678678-877443356667789999999756------897742


Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHCCCCHHEEECCHHHHCCC-C-CCCCCCCCCH-----HHHHHHHCCCC--CCHHH
Q ss_conf             37623866678899999999999972798000576285880876-8-9975110086-----89999617899--99899
Q gi|254780921|r  211 FHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTKQYPTK-A-HRPAYSCLDC-----SKLANTHNIRI--STWKE  281 (290)
Q Consensus       211 yn~~~~~~~~s~~e~a~~I~~~~~~~~~~~~~i~~~~~~~~~~~-a-~RP~~~~Ld~-----~K~~~~lg~~~--~~~~e  281 (290)
T Consensus       237 iNgvAP-~~~~n~Ef~q~lg~aL~-----Rp~~~pvP~fvvqA~fG~er-A~~vLeGqKV~Pqral~-~Gf~f~yp~vk~  308 (315)
T KOG3019         237 INGVAP-NPVRNGEFCQQLGSALS-----RPSWLPVPDFVVQALFGPER-ATVVLEGQKVLPQRALE-LGFEFKYPYVKD  308 (315)
T ss_pred             ECCCCC-CCCCHHHHHHHHHHHHC-----CCCCCCCCHHHHHHHHCCCC-EEEEEECCCCCCHHHHH-CCCEEECHHHHH
T ss_conf             346589-84405899999998857-----88535770999998747444-06996077014366764-376330647999


Q ss_pred             HHHHHHH
Q ss_conf             9999997
Q gi|254780921|r  282 GVRNILV  288 (290)
Q Consensus       282 ~i~~~i~  288 (290)
T Consensus       309 Al~~i~~  315 (315)
T KOG3019         309 ALRAIMQ  315 (315)
T ss_pred             HHHHHHC
T ss_conf             9999749