HHsearch alignment for GI: 254780921 and conserved domain: PRK00711

>PRK00711 D-amino acid dehydrogenase small subunit; Validated.
Probab=94.76  E-value=0.046  Score=30.82  Aligned_cols=31  Identities=19%  Similarity=0.355  Sum_probs=27.4

Q ss_pred             CEEEEECCCCHHHHHHHHHH-HCCCEEEEECHH
Q ss_conf             94999978897889999999-649859996136
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP   32 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~   32 (290)
T Consensus         1 m~VvIIGa-Gi~G~stA~~La~~G~~V~vler~   32 (416)
T PRK00711          1 MRVVVLGS-GVVGVTSAWYLARAGHEVTVIDRQ   32 (416)
T ss_pred             CEEEEECC-HHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             97999994-499999999999689968999699