HHsearch alignment for GI: 254780921 and conserved domain: PRK05650

>PRK05650 short chain dehydrogenase; Provisional.
Probab=99.47  E-value=1.4e-13  Score=95.59  Aligned_cols=183  Identities=16%  Similarity=0.137  Sum_probs=112.9

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------0878999999999755-----99899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
T Consensus         2 rVlITGassGIG~alA~~la~~G~~V~l~~r~~~~l~~~~~~l~~~g~~~~~~~~Dvt~~~~~~~~~~~v~~~~g~iDiL   81 (270)
T PRK05650          2 RVMITGAASGLGRAIALRWAREGWRLALADVNEEGGEETLKELREAGGDGFYQRCDVRDYSQLTALAQACEEKWGGIDVI   81 (270)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             79998876499999999999889989999798899999999998449928999845899999999999999983997789


Q ss_pred             EECCCCCCCCC----CCCCCCEEEEECCCCCCCCCCCC----CCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             97863445432----23322102420122211000112----2333-333445532111357554421111222211101
Q gi|254780921|r   55 INPAAYTAVDK----AEDEPEIAFSINAEGAGAIAKAA----DSIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        55 ih~Aa~~~~~~----~e~~~~~~~~~Nv~~~~~l~~~~----~~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
T Consensus        82 VNNAGi~~~g~~~~~~~e~~~~~~~vNl~g~~~~~~~~lp~m~~~~~G~IvnisS~ag~---~~~p~--------~~~Y~  150 (270)
T PRK05650         82 VNNAGVASGGFFEELSLEDWDWQIAINLMGVVKGCKAFLPLFKEQGKGRIVNIASMAGL---MQGPA--------MSSYN  150 (270)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHC---CCCCC--------CHHHH
T ss_conf             62476679986201999999999999659999999999976755699589998585552---89999--------66799


Q ss_pred             HHHHHHHHHHCCCCC---CCCCCCCCCCE-ECCCCCCCCEEECCC-CCCCCEEECCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             245666653101222---32235554200-036863200020112-46652153045545445223689999999984
Q gi|254780921|r  126 KSKLAGEEKVASYTN---NYVILRTAWVY-SIFGSNFLLSMLRLA-KERREISVVCDQFGTPTSALQIARAIIQIAHN  198 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~---~~~IlR~~~vy-G~~~~~~v~~~l~~~-~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~  198 (290)
T Consensus       151 asK~av~~~tesL~~El~~~g-I~V~~v~PG~v~T~~~~~~~~~~~~~~~~~~--~~~~~~~~~~e~vA~~i~~~i~~  225 (270)
T PRK05650        151 VAKAGVVALSETLLVELADDE-IGVHVVCPSFFQTNLLDSFRGPNPAMKAQVG--KLLEKSPITAADIADYIYQQVAK  225 (270)
T ss_pred             HHHHHHHHHHHHHHHHHCCCC-CEEEEEECCCCCCCCCCCCCCCCCHHHHHHH--HHHHCCCCCHHHHHHHHHHHHHC
T ss_conf             999999999999999853219-6899997388986656577888804678887--66414899999999999999975