HHsearch alignment for GI: 254780921 and conserved domain: PRK05876

>PRK05876 short chain dehydrogenase; Provisional.
Probab=99.03  E-value=3.3e-10  Score=76.65  Aligned_cols=126  Identities=11%  Similarity=0.090  Sum_probs=90.6

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHH-----CCCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------087899999999975-----599899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLS-----FSPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~-----~~pd~V   54 (290)
T Consensus         8 vavITGaasGIG~a~A~~la~~Ga~Vvi~d~~~~~l~~~~~~l~~~g~~~~~~~~Dvt~~~~v~~l~~~~~~~~G~iDil   87 (275)
T PRK05876          8 GAVITGGASGIGLATGTEFARRGARVVLGDVDKPGLRQAVNHLRAEGFDVHGVMCDVRHREEVTHLADEAFRLLGHVDVV   87 (275)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             79992826699999999999879989999798899999999998269847999788899999999999999984898851


Q ss_pred             EECCCCCCCCC----CCCCCCEEEEECCCCCCCCCCCCC----CC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             97863445432----233221024201222110001122----33--333344553211135755442111122221110
Q gi|254780921|r   55 INPAAYTAVDK----AEDEPEIAFSINAEGAGAIAKAAD----SI--GIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIY  124 (290)
Q Consensus        55 ih~Aa~~~~~~----~e~~~~~~~~~Nv~~~~~l~~~~~----~~--~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Y  124 (290)
T Consensus        88 vnNAGi~~~~~~~~~~~~~w~~~~~vNl~g~~~~~~~~lP~m~~~g~~G~IvntsS~agl---~~~~--------~~~~Y  156 (275)
T PRK05876         88 FSNAGIVVGGPIVEMTHDDWRWVIDVDLWGSIHTVEAFLPRLLEQGTGGHVVFTASFAGL---VPNA--------GLGAY  156 (275)
T ss_pred             ECCCCCCCCCCCCCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHC---CCCC--------CCHHH
T ss_conf             215744689872329999999987641389999999999999981999499996867753---8999--------97469


Q ss_pred             HHHHHHHHHHHCCC
Q ss_conf             12456666531012
Q gi|254780921|r  125 GKSKLAGEEKVASY  138 (290)
Q Consensus       125 g~sK~~~E~~v~~~  138 (290)
T Consensus       157 ~asK~av~~lte~L  170 (275)
T PRK05876        157 GVAKYGVVGLAETL  170 (275)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999999999999