HHsearch alignment for GI: 254780921 and conserved domain: PRK06123

>PRK06123 short chain dehydrogenase; Provisional.
Probab=99.03  E-value=3.3e-10  Score=76.65  Aligned_cols=128  Identities=16%  Similarity=0.129  Sum_probs=89.4

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHH----------------------HCCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             999978897889999999-649859996136----------------------70878999999999755-----99899
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP----------------------DIDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~----------------------~~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
T Consensus         6 alITGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~~G~iDiL   85 (249)
T PRK06123          6 MIITGASRGIGAATALLAAERGYAVCLNYLRNRDAAEAVVQAIRRQGGEALAVAADVADEADVLRLFEAVDRELGRLDAL   85 (249)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             99968687999999999998799899980898789999999999649909999847999999999999999982998789


Q ss_pred             EECCCCCCCCC-----CCCCCCEEEEECCCCCCCCCCCCC----CC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             97863445432-----233221024201222110001122----33----333344553211135755442111122221
Q gi|254780921|r   55 INPAAYTAVDK-----AEDEPEIAFSINAEGAGAIAKAAD----SI----GIPCIYISTDYVFDGLSRTPIDEFSPTNPL  121 (290)
Q Consensus        55 ih~Aa~~~~~~-----~e~~~~~~~~~Nv~~~~~l~~~~~----~~----~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~  121 (290)
T Consensus        86 VnNAG~~~~~~~~~~~~~~~w~~~~~vNl~~~~~~~~~~~~~m~~~~~g~~g~IInisS~~~~---~~~~-------~~~  155 (249)
T PRK06123         86 VNNAGILEAQMRLEQMDAARLTRIFATNVVGSFLCAREAVKRMSTRHGGRGGAIVNVSSMAAR---LGSP-------GEY  155 (249)
T ss_pred             EECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHHC---CCCC-------CCH
T ss_conf             988855789997212999999999854069999999999999999708998379997447656---5898-------306


Q ss_pred             CCCHHHHHHHHHHHCCCCC
Q ss_conf             1101245666653101222
Q gi|254780921|r  122 NIYGKSKLAGEEKVASYTN  140 (290)
Q Consensus       122 ~~Yg~sK~~~E~~v~~~~~  140 (290)
T Consensus       156 ~~Y~asKaav~~ltr~lA~  174 (249)
T PRK06123        156 IDYAASKGAIDTMTIGLAK  174 (249)
T ss_pred             HHHHHHHHHHHHHHHHHHH
T ss_conf             8789999999999999999