HHsearch alignment for GI: 254780921 and conserved domain: PRK06125

>PRK06125 short chain dehydrogenase; Provisional.
Probab=99.15  E-value=9.3e-11  Score=79.79  Aligned_cols=128  Identities=10%  Similarity=0.062  Sum_probs=94.0

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH----------------------CCCCCHHHHHHHHHHC-CCCEEEEC
Q ss_conf             4999978897889999999-6498599961367----------------------0878999999999755-99899978
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD----------------------IDLLKPKDFASFFLSF-SPDVIINP   57 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~----------------------~D~~~~~~~~~~l~~~-~pd~Vih~   57 (290)
T Consensus         9 ~alITG~s~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~~~~~~~~~~~D~~~~~~~~~~~~~~g~iDiLVnn   88 (259)
T PRK06125          9 RVLITGASKGIGAAAAEAFAAEGCHLVLAARDADALAALAADLRAAHGVDVAVHALDLSSPEAREQLAAEAGDIDILVNN   88 (259)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEC
T ss_conf             89996877689999999999879989999798899999999998700986699988899999999999985899899976


Q ss_pred             CCCCCCC----CCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             6344543----2233221024201222110001122----333-333445532111357554421111222211101245
Q gi|254780921|r   58 AAYTAVD----KAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSK  128 (290)
Q Consensus        58 Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK  128 (290)
T Consensus        89 AG~~~~~~~~~~~~~~w~~~~~vnl~~~~~l~~~~~p~m~~~~~G~Iini~s~~~~---~~~--------~~~~~y~asK  157 (259)
T PRK06125         89 AGAIPGGSLDDVDDAAWRAGWELKVFGYINLTRLFYPRMKARGSGVIVNVIGAAGE---NPD--------AGYICGSAGN  157 (259)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCC---CCC--------CCCHHHHHHH
T ss_conf             87789986454999999999998634378899999997653498199999421337---888--------7648999999


Q ss_pred             HHHHHHHCCCCC
Q ss_conf             666653101222
Q gi|254780921|r  129 LAGEEKVASYTN  140 (290)
Q Consensus       129 ~~~E~~v~~~~~  140 (290)
T Consensus       158 aal~~ltr~lA~  169 (259)
T PRK06125        158 AALMAFTRALGG  169 (259)
T ss_pred             HHHHHHHHHHHH
T ss_conf             999999999999