HHsearch alignment for GI: 254780921 and conserved domain: PRK06139

>PRK06139 short chain dehydrogenase; Provisional.
Probab=99.31  E-value=6.8e-12  Score=86.16  Aligned_cols=181  Identities=17%  Similarity=0.179  Sum_probs=112.2

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHH-----CCCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------087899999999975-----599899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLS-----FSPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~-----~~pd~V   54 (290)
T Consensus         8 vvlITGASsGIG~aiA~~~A~~Ga~Vvl~~R~~~~L~~~a~e~~~~G~~~~~v~~DVsd~~~v~~~~~~~~~~~G~IDiL   87 (324)
T PRK06139          8 VVVITGASSGIGRATAEAFARRGARLVLAARDEEALFEVAEECRALGAEVLVVPTDVTHADQVQALATQAASFLGRIDVW   87 (324)
T ss_pred             EEEEECHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             79993825499999999999879989999899999999999999549948999766788578999999999974998788


Q ss_pred             EECCCCCCCCCCC----CCCCEEEEECCCCCCCCCCCC----CCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             9786344543223----322102420122211000112----2333-333445532111357554421111222211101
Q gi|254780921|r   55 INPAAYTAVDKAE----DEPEIAFSINAEGAGAIAKAA----DSIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        55 ih~Aa~~~~~~~e----~~~~~~~~~Nv~~~~~l~~~~----~~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
T Consensus        88 VNNAGi~~~g~~~e~~~e~~~~vi~vNl~G~~~~~~aalp~M~~~g~G~IINisS~ag~---~~~P~--------~saY~  156 (324)
T PRK06139         88 FNNVGVGAVGRFEETPLEAHEQVIQTNLIGYLRDAHAALPIFKAQGHGIFINMISLGGF---AAQPY--------AAAYS  156 (324)
T ss_pred             EECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHH---CCCCC--------CCHHH
T ss_conf             64575577775355999999999999869999999999999986599189997363241---36999--------84198


Q ss_pred             HHHHHHHHHHCCCC---CCCCCCCCCCCE-ECCCCCCCCEEECCCCCCCCEEECCCCCCCCCC-HHHHHHHHHHHHHHHH
Q ss_conf             24566665310122---232235554200-036863200020112466521530455454452-2368999999998442
Q gi|254780921|r  126 KSKLAGEEKVASYT---NNYVILRTAWVY-SIFGSNFLLSMLRLAKERREISVVCDQFGTPTS-ALQIARAIIQIAHNLI  200 (290)
Q Consensus       126 ~sK~~~E~~v~~~~---~~~~IlR~~~vy-G~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~-v~D~a~~i~~~~~~~~  200 (290)
T Consensus       157 ASK~Av~gftesLr~EL~~~~gI~Vt~V~Pg~v~TP~~~~~~~~~--~~~~~~-----~~p~~~pe~vA~ai~~~~~~~~  229 (324)
T PRK06139        157 ASKFGLRGFSEALRAELTDFPDIHVCDVYPAFVDTPGFRHGANYT--GRRLTP-----PPPMYDPRRVAKAMVRLADRPR  229 (324)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCHHHHHCC--CCCCCC-----CCCCCCHHHHHHHHHHHHHCCC
T ss_conf             999999999999999837998918999857995885201435337--878899-----9998799999999999983899