HHsearch alignment for GI: 254780921 and conserved domain: PRK06171

>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional.
Probab=99.28  E-value=5e-12  Score=86.94  Aligned_cols=128  Identities=17%  Similarity=0.177  Sum_probs=95.1

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH------------CCCCCHHHHHHHHHHC-----CCCEEEECCCCCCC
Q ss_conf             4999978897889999999-6498599961367------------0878999999999755-----99899978634454
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD------------IDLLKPKDFASFFLSF-----SPDVIINPAAYTAV   63 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~------------~D~~~~~~~~~~l~~~-----~pd~Vih~Aa~~~~   63 (290)
T Consensus        11 valVTGgs~GIG~aia~~la~~Ga~V~~~d~~~~~~~~~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~iDiLVNNAGi~~~   90 (266)
T PRK06171         11 IIIVTGGSSGIGLAIVEELLAQGANVQMVDIHGGDEKHKGYQFWPTDISSAKEVNHTVAEIIERFGRIDGLVNNAGINFP   90 (266)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHCCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCCC
T ss_conf             79994778789999999999879999999788535058976999816999999999999999983998899988866765


Q ss_pred             -------------CCCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             -------------32233221024201222110001122----333-333445532111357554421111222211101
Q gi|254780921|r   64 -------------DKAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        64 -------------~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
T Consensus        91 ~~~~d~~~~~~~~e~~~~~w~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~~g~~g---~~--------~~~~Y~  159 (266)
T PRK06171         91 RLLVDEKAPAGQYELNEAAFEKMVNINQKGVFLMSQAVARQMVKQHDGVIVNMSSEAGLEG---SE--------GQSCYA  159 (266)
T ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC---CC--------CCHHHH
T ss_conf             3212445766545599999999999994999999999999999839957998057775678---98--------758999


Q ss_pred             HHHHHHHHHHCCCCC
Q ss_conf             245666653101222
Q gi|254780921|r  126 KSKLAGEEKVASYTN  140 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~  140 (290)
T Consensus       160 asKaav~~ltr~lA~  174 (266)
T PRK06171        160 ATKAAVNSFTRSWAK  174 (266)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999999