HHsearch alignment for GI: 254780921 and conserved domain: PRK06194

>PRK06194 hypothetical protein; Provisional.
Probab=99.24  E-value=3.2e-11  Score=82.39  Aligned_cols=124  Identities=10%  Similarity=0.103  Sum_probs=89.9

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEEE
Q ss_conf             999978897889999999-6498599961367---------------------0878999999999755-----998999
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVII   55 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~Vi   55 (290)
T Consensus         9 avITGassGIG~a~A~~la~~Ga~Vvl~d~~~~~l~~~~~~l~~~g~~v~~~~~DVsd~~~v~~l~~~~~~~fG~iDiLV   88 (301)
T PRK06194          9 AVITGAASGFGREFARIGARLGMKLVLADVQQDALDRAVAELRAQGAEVLGVRTDVSDAAQVEALADAALERFGAVHLLF   88 (301)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCEEEEE
T ss_conf             99927377999999999998799899997988999999999984598499996568999999999999999839937999


Q ss_pred             ECCCCCCCC----CCCCCCCEEEEECCCCCCCCCCCCC----CCC-------CCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             786344543----2233221024201222110001122----333-------3334455321113575544211112222
Q gi|254780921|r   56 NPAAYTAVD----KAEDEPEIAFSINAEGAGAIAKAAD----SIG-------IPCIYISTDYVFDGLSRTPIDEFSPTNP  120 (290)
Q Consensus        56 h~Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-------~~~I~iSS~~Vy~g~~~~p~~E~d~~~P  120 (290)
T Consensus        89 NNAGi~~~~~~~e~~~edw~~v~~VNl~G~~~~~r~~lP~M~~~~~~~~~~~G~IVNisSiaG~---~~~p~--------  157 (301)
T PRK06194         89 NNAGVGAGGLLWENSLADWEWVLGVNLMGVIHGVRIFTPLMLAAAEKDPAYEGHIVNTASMAGL---LAPPA--------  157 (301)
T ss_pred             ECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCHHHC---CCCCC--------
T ss_conf             5576678887344999999999999819999999999999997688788986499994542323---58999--------


Q ss_pred             CCCCHHHHHHHHHHHCC
Q ss_conf             11101245666653101
Q gi|254780921|r  121 LNIYGKSKLAGEEKVAS  137 (290)
Q Consensus       121 ~~~Yg~sK~~~E~~v~~  137 (290)
T Consensus       158 ~~~Y~ASK~AV~glT~s  174 (301)
T PRK06194        158 MGVYNVSKHAVVSLTET  174 (301)
T ss_pred             CCHHHHHHHHHHHHHHH
T ss_conf             70789999999999999