HHsearch alignment for GI: 254780921 and conserved domain: PRK06300

>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional.
Probab=97.76  E-value=5.9e-05  Score=47.10  Aligned_cols=178  Identities=15%  Similarity=0.139  Sum_probs=88.4

Q ss_pred             EEEECC--CCHHHHHHHHHH-HCCCEEEEECHH-----------------------------------HC----------
Q ss_conf             999978--897889999999-649859996136-----------------------------------70----------
Q gi|254780921|r    3 CLVIGN--NGQIAQSLSSMC-VQDVEIIRVGRP-----------------------------------DI----------   34 (290)
Q Consensus         3 iLVtG~--~G~iG~~l~~~l-~~~~~v~~~~r~-----------------------------------~~----------   34 (290)
T Consensus        11 AlVTGaGgs~GIG~aiA~~lA~~GA~Vvi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~   90 (298)
T PRK06300         11 AFIAGIGDDQGYGWGIAKMLAEAGATIIVGTWVPIYKIFSQSWELGKFNESRKLSNGELLTIAKIYPMDASFDKPEDVPE   90 (298)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHCEEEEECCCCCCHHHHHH
T ss_conf             99908799862999999999982999999237530245556887655688887505630000346530034574323057


Q ss_pred             CCCCHH--------HHHHHH----HH-CCCCEEEECCCCCC------CCCCCCCCCEEEEECCCCCCCCCCCCC---CCC
Q ss_conf             878999--------999999----75-59989997863445------432233221024201222110001122---333
Q gi|254780921|r   35 DLLKPK--------DFASFF----LS-FSPDVIINPAAYTA------VDKAEDEPEIAFSINAEGAGAIAKAAD---SIG   92 (290)
Q Consensus        35 D~~~~~--------~~~~~l----~~-~~pd~Vih~Aa~~~------~~~~e~~~~~~~~~Nv~~~~~l~~~~~---~~~   92 (290)
T Consensus        91 di~~~~~~~~l~~~~v~~~v~~~~~~fG~iDiLVnna~~~~~~~~~~~e~~~~~~~~~~~~n~~~~~~~~~~~~p~m~~~  170 (298)
T PRK06300         91 DIAENKRYKGISGYTISEVVEQVKKDFGHIDILVHSLANSPEISKPLLETSRKGYLAALSTSSYSFVSLLSHFGPIMNAG  170 (298)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             77656654100157999999999987799778998998887567784558999999999898499999999999997638


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCC----CCCCCCCCCCC-----EECCCC--CCCCE
Q ss_conf             33344553211135755442111122221110124566665310122----23223555420-----003686--32000
Q gi|254780921|r   93 IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYT----NNYVILRTAWV-----YSIFGS--NFLLS  161 (290)
Q Consensus        93 ~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~v~~~~----~~~~IlR~~~v-----yG~~~~--~~v~~  161 (290)
T Consensus       171 G~ii~i~s~~---~~~~~p-------~~~~~ysasKaal~~lTr~lA~E~g~~ygI-RVNaI~PG~i~T~~~~~~~~~e~  239 (298)
T PRK06300        171 GSTISLTYLA---SMRAVP-------GYGGGMSAAKAALESDTKTLAWEAGRRWGI-RVNTISAGPLASRAGKAIGFIER  239 (298)
T ss_pred             CCEEEEEEEE---CCCCCC-------CCCHHHHHHHHHHHHHHHHHHHHHCCCCCE-EEEEEECCCCCCCHHHCCCCCHH
T ss_conf             9447754300---134467-------740367999999986599999985701180-89998548644712321466299


Q ss_pred             EECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             2011246652153045545445223689999999984
Q gi|254780921|r  162 MLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHN  198 (290)
Q Consensus       162 ~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~  198 (290)
T Consensus       240 ~~~~~~~~~Pl-------~R~g~peeiA~~v~FLaSd  269 (298)
T PRK06300        240 MVDYYQDWAPL-------PEPMEAEQVGAVAAFLVSP  269 (298)
T ss_pred             HHHHHHHCCCC-------CCCCCHHHHHHHHHHHHCC
T ss_conf             99999857998-------9998999999999998084