HHsearch alignment for GI: 254780921 and conserved domain: PRK06483

>PRK06483 short chain dehydrogenase; Provisional.
Probab=99.25  E-value=1e-11  Score=85.13  Aligned_cols=127  Identities=20%  Similarity=0.185  Sum_probs=89.7

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH----------------CCCCCHHHHHHHHHHC-----CCCEEEECCCC
Q ss_conf             999978897889999999-6498599961367----------------0878999999999755-----99899978634
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD----------------IDLLKPKDFASFFLSF-----SPDVIINPAAY   60 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~----------------~D~~~~~~~~~~l~~~-----~pd~Vih~Aa~   60 (290)
T Consensus         5 VlVTGas~GIG~aiA~~la~~Ga~Vvi~~r~~~~~~~~l~~~~~~~~~~Dv~~~~~v~~~~~~~~~~~g~id~lVnNAg~   84 (236)
T PRK06483          5 ILITGAGQRIGLALAKHLLAQGQPVIVSYRSHYPAIDELRQAGATCIQADFSTNAGIMAFIDELKQHTDGLRAIIHNASD   84 (236)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             99978998899999999998899899995984799999985699899922799999999999999983997599977744


Q ss_pred             CCCCC----CCCCCCEEEEECCCCCCCCCCCCC----CCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             45432----233221024201222110001122----333---3334455321113575544211112222111012456
Q gi|254780921|r   61 TAVDK----AEDEPEIAFSINAEGAGAIAKAAD----SIG---IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKL  129 (290)
Q Consensus        61 ~~~~~----~e~~~~~~~~~Nv~~~~~l~~~~~----~~~---~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~  129 (290)
T Consensus        85 ~~~~~~~~~~~~~~~~~~~vn~~~~~~~~~~~~~~l~~~~~~~~~Ii~isS~~~~~g---~~--------~~~~Y~asKa  153 (236)
T PRK06483         85 WLAESPGAPLADVLARMMQIHVNAPYLLNLALEDLLRGHGHAASDIIHITDYVVEKG---SD--------KHIAYAASKA  153 (236)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHCC---CC--------CCHHHHHHHH
T ss_conf             678883438899999999973358999999989999975888667765422656424---88--------8478999999


Q ss_pred             HHHHHHCCCCC
Q ss_conf             66653101222
Q gi|254780921|r  130 AGEEKVASYTN  140 (290)
Q Consensus       130 ~~E~~v~~~~~  140 (290)
T Consensus       154 al~~ltr~lA~  164 (236)
T PRK06483        154 ALDNMTLSFAA  164 (236)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999999