HHsearch alignment for GI: 254780921 and conserved domain: PRK06484

>PRK06484 short chain dehydrogenase; Validated.
Probab=99.12  E-value=7.5e-11  Score=80.29  Aligned_cols=127  Identities=17%  Similarity=0.196  Sum_probs=95.1

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH------------------CCCCCHHHHHHHHHHC-----CCCEEEECC
Q ss_conf             999978897889999999-6498599961367------------------0878999999999755-----998999786
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD------------------IDLLKPKDFASFFLSF-----SPDVIINPA   58 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~------------------~D~~~~~~~~~~l~~~-----~pd~Vih~A   58 (290)
T Consensus       277 alVTGaa~GIG~aiA~~la~~GA~Vvi~d~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~fG~iDiLVNNA  356 (530)
T PRK06484        277 VCVTGGASGIGAAIADRFAALGDRVAIIDSDGEEAVKLREILGGEHLSWQVDITDEASVESAFAGIQGRLGPLDVLVNNA  356 (530)
T ss_pred             EEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCEEEECC
T ss_conf             99928767899999999998879899995888999999997399736999538999999999999999829988999897


Q ss_pred             CCCCC-----CCCCCCCCEEEEECCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             34454-----32233221024201222110001122----3333334455321113575544211112222111012456
Q gi|254780921|r   59 AYTAV-----DKAEDEPEIAFSINAEGAGAIAKAAD----SIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKL  129 (290)
Q Consensus        59 a~~~~-----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~  129 (290)
T Consensus       357 Gi~~~~~~~~e~t~e~w~~v~~vNl~g~f~~~~~~~~~m~~~gG~IVnisS~~~~~~---~--------~~~~~Y~asKa  425 (530)
T PRK06484        357 GIAEPFAPSAEQSLEDFRRTIDVNLKGAFHCSREAARQMGAGGGVIVNLGSITSLLA---L--------PPRHAYGASKA  425 (530)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC---C--------CCCHHHHHHHH
T ss_conf             789899980009999999999997199999999999973148976999716443658---8--------99579999999


Q ss_pred             HHHHHHCCCCC
Q ss_conf             66653101222
Q gi|254780921|r  130 AGEEKVASYTN  140 (290)
Q Consensus       130 ~~E~~v~~~~~  140 (290)
T Consensus       426 av~~lTr~lA~  436 (530)
T PRK06484        426 AITMLTRCLAA  436 (530)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999999