HHsearch alignment for GI: 254780921 and conserved domain: PRK06522

>PRK06522 2-dehydropantoate 2-reductase; Reviewed.
Probab=95.06  E-value=0.035  Score=31.54  Aligned_cols=31  Identities=23%  Similarity=0.362  Sum_probs=27.6

Q ss_pred             CEEEEECCCCHHHHHHHHHHH-CCCEEEEECHH
Q ss_conf             949999788978899999996-49859996136
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCV-QDVEIIRVGRP   32 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~-~~~~v~~~~r~   32 (290)
T Consensus         1 MkI~IiGa-GaiG~~~a~~L~~ag~~V~li~r~   32 (307)
T PRK06522          1 MKIAILGA-GAIGGLFGARLAQAGHDVTLVARG   32 (307)
T ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             98999991-499999999998489988999788